BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF022G09

Length=788
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009760936.1|  PREDICTED: CTD nuclear envelope phosphatase ...    226   3e-68   Nicotiana sylvestris
ref|XP_009610468.1|  PREDICTED: CTD nuclear envelope phosphatase ...    224   9e-68   Nicotiana tomentosiformis
ref|XP_004240939.1|  PREDICTED: CTD nuclear envelope phosphatase ...    222   4e-67   Solanum lycopersicum
ref|XP_011084905.1|  PREDICTED: LOW QUALITY PROTEIN: CTD nuclear ...    219   5e-66   
ref|XP_006338842.1|  PREDICTED: CTD small phosphatase-like protei...    219   7e-66   Solanum tuberosum [potatoes]
ref|XP_011035940.1|  PREDICTED: CTD nuclear envelope phosphatase 1      216   5e-65   Populus euphratica
ref|XP_006378658.1|  hypothetical protein POPTR_0010s19580g             216   5e-65   Populus trichocarpa [western balsam poplar]
emb|CAN64082.1|  hypothetical protein VITISV_006933                     213   9e-65   Vitis vinifera
emb|CDP14017.1|  unnamed protein product                                216   2e-64   Coffea canephora [robusta coffee]
ref|XP_011076695.1|  PREDICTED: CTD small phosphatase-like protein      215   1e-63   Sesamum indicum [beniseed]
gb|EYU20007.1|  hypothetical protein MIMGU_mgv1a010325mg                213   2e-63   Erythranthe guttata [common monkey flower]
ref|XP_002273682.1|  PREDICTED: carboxy-terminal domain RNA polym...    213   2e-63   Vitis vinifera
ref|XP_009622999.1|  PREDICTED: CTD small phosphatase-like protein 2    211   7e-63   Nicotiana tomentosiformis
ref|XP_006355653.1|  PREDICTED: CTD small phosphatase-like protei...    211   1e-62   Solanum tuberosum [potatoes]
ref|XP_010264631.1|  PREDICTED: CTD nuclear envelope phosphatase ...    211   1e-62   Nelumbo nucifera [Indian lotus]
gb|KDO68952.1|  hypothetical protein CISIN_1g022258mg                   210   1e-62   Citrus sinensis [apfelsine]
ref|XP_007008962.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    210   1e-62   
ref|XP_006435743.1|  hypothetical protein CICLE_v10031856mg             212   2e-62   Citrus clementina [clementine]
gb|KDP44760.1|  hypothetical protein JCGZ_01260                         210   2e-62   Jatropha curcas
gb|KHN20843.1|  CTD small phosphatase-like protein 2                    210   2e-62   Glycine soja [wild soybean]
ref|XP_009616349.1|  PREDICTED: uncharacterized protein C2F7.02c-...    208   2e-62   
ref|XP_010922553.1|  PREDICTED: CTD small phosphatase-like protein 2    209   2e-62   Elaeis guineensis
ref|XP_008463241.1|  PREDICTED: carboxy-terminal domain RNA polym...    209   3e-62   Cucumis melo [Oriental melon]
ref|XP_009369172.1|  PREDICTED: probable C-terminal domain small ...    209   3e-62   Pyrus x bretschneideri [bai li]
gb|KHN48568.1|  CTD small phosphatase-like protein 2                    209   4e-62   Glycine soja [wild soybean]
ref|XP_008345306.1|  PREDICTED: probable C-terminal domain small ...    209   4e-62   Malus domestica [apple tree]
ref|XP_006429395.1|  hypothetical protein CICLE_v10012210mg             209   4e-62   Citrus clementina [clementine]
ref|XP_010689631.1|  PREDICTED: CTD nuclear envelope phosphatase ...    209   4e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006481044.1|  PREDICTED: CTD small phosphatase-like protei...    209   5e-62   Citrus sinensis [apfelsine]
gb|KDO56645.1|  hypothetical protein CISIN_1g020937mg                   209   5e-62   Citrus sinensis [apfelsine]
gb|KJB78769.1|  hypothetical protein B456_013G018000                    208   9e-62   Gossypium raimondii
ref|XP_010067527.1|  PREDICTED: CTD small phosphatase-like protein      207   1e-61   Eucalyptus grandis [rose gum]
ref|XP_004239942.1|  PREDICTED: carboxy-terminal domain RNA polym...    208   1e-61   Solanum lycopersicum
ref|XP_008805431.1|  PREDICTED: carboxy-terminal domain RNA polym...    207   1e-61   Phoenix dactylifera
ref|NP_001242244.1|  uncharacterized protein LOC100783451               207   2e-61   Glycine max [soybeans]
ref|XP_003545230.1|  PREDICTED: LOW QUALITY PROTEIN: carboxy-term...    210   2e-61   
gb|KDO68954.1|  hypothetical protein CISIN_1g022258mg                   206   3e-61   Citrus sinensis [apfelsine]
ref|XP_011046823.1|  PREDICTED: CTD nuclear envelope phosphatase ...    206   5e-61   Populus euphratica
ref|XP_007141764.1|  hypothetical protein PHAVU_008G223800g             206   6e-61   Phaseolus vulgaris [French bean]
ref|XP_004149232.1|  PREDICTED: CTD small phosphatase-like protei...    206   6e-61   Cucumis sativus [cucumbers]
ref|XP_002309143.2|  hypothetical protein POPTR_0006s10170g             206   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_009344958.1|  PREDICTED: carboxy-terminal domain RNA polym...    205   1e-60   Pyrus x bretschneideri [bai li]
gb|KJB74327.1|  hypothetical protein B456_011G288400                    205   1e-60   Gossypium raimondii
ref|XP_002528087.1|  conserved hypothetical protein                     204   1e-60   
ref|XP_008374036.1|  PREDICTED: CTD small phosphatase-like protein      205   2e-60   Malus domestica [apple tree]
ref|XP_009385548.1|  PREDICTED: carboxy-terminal domain RNA polym...    205   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004307664.1|  PREDICTED: CTD nuclear envelope phosphatase ...    204   2e-60   Fragaria vesca subsp. vesca
gb|KHG26952.1|  ctdspl2                                                 204   2e-60   Gossypium arboreum [tree cotton]
tpg|DAA56990.1|  TPA: hypothetical protein ZEAMMB73_478385              199   4e-60   
ref|XP_011019112.1|  PREDICTED: CTD small phosphatase-like protei...    203   4e-60   Populus euphratica
ref|XP_008805436.1|  PREDICTED: carboxy-terminal domain RNA polym...    203   5e-60   Phoenix dactylifera
ref|XP_011019111.1|  PREDICTED: carboxy-terminal domain RNA polym...    204   6e-60   Populus euphratica
ref|XP_011019110.1|  PREDICTED: carboxy-terminal domain RNA polym...    204   6e-60   Populus euphratica
ref|XP_010920860.1|  PREDICTED: carboxy-terminal domain RNA polym...    203   8e-60   
gb|AFK34480.1|  unknown                                                 202   1e-59   Lotus japonicus
ref|XP_009377758.1|  PREDICTED: carboxy-terminal domain RNA polym...    202   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_007218742.1|  hypothetical protein PRUPE_ppa009189mg             202   2e-59   Prunus persica
ref|XP_010101420.1|  CTD small phosphatase-like protein                 201   4e-59   Morus notabilis
ref|XP_002265560.1|  PREDICTED: CTD small phosphatase-like protein      202   4e-59   Vitis vinifera
ref|XP_006646453.1|  PREDICTED: CTD small phosphatase-like protei...    200   5e-59   
ref|XP_008370102.1|  PREDICTED: carboxy-terminal domain RNA polym...    200   9e-59   
ref|NP_001044710.1|  Os01g0833100                                       201   9e-59   
ref|XP_004961795.1|  PREDICTED: CTD small phosphatase-like protei...    200   9e-59   Setaria italica
ref|XP_002439933.1|  hypothetical protein SORBIDRAFT_09g022940          200   1e-58   Sorghum bicolor [broomcorn]
gb|EPS72976.1|  hypothetical protein M569_01780                         200   1e-58   Genlisea aurea
gb|ACG32959.1|  CTD small phosphatase-like protein                      200   1e-58   Zea mays [maize]
ref|XP_007205648.1|  hypothetical protein PRUPE_ppa009333mg             200   1e-58   Prunus persica
ref|XP_003616639.1|  CTD small phosphatase-like protein                 200   1e-58   Medicago truncatula
gb|EEC71746.1|  hypothetical protein OsI_04315                          200   1e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_002458718.1|  hypothetical protein SORBIDRAFT_03g038910          200   2e-58   Sorghum bicolor [broomcorn]
ref|XP_004491033.1|  PREDICTED: CTD small phosphatase-like protei...    200   2e-58   Cicer arietinum [garbanzo]
ref|XP_004302575.1|  PREDICTED: carboxy-terminal domain RNA polym...    199   2e-58   Fragaria vesca subsp. vesca
ref|XP_009416286.1|  PREDICTED: CTD nuclear envelope phosphatase ...    200   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001136647.1|  uncharacterized protein LOC100216776               201   2e-58   Zea mays [maize]
ref|XP_008672265.1|  PREDICTED: uncharacterized protein LOC100216...    201   2e-58   Zea mays [maize]
gb|KDP24445.1|  hypothetical protein JCGZ_25009                         199   3e-58   Jatropha curcas
ref|XP_010044096.1|  PREDICTED: CTD small phosphatase-like protein      200   3e-58   Eucalyptus grandis [rose gum]
ref|XP_008793248.1|  PREDICTED: carboxy-terminal domain RNA polym...    199   4e-58   Phoenix dactylifera
ref|XP_003564541.1|  PREDICTED: CTD small phosphatase-like protein      199   4e-58   Brachypodium distachyon [annual false brome]
gb|EMS66920.1|  CTD small phosphatase-like protein 2                    196   5e-58   Triticum urartu
gb|EAY98360.1|  hypothetical protein OsI_20271                          199   5e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_004970462.1|  PREDICTED: CTD small phosphatase-like protei...    199   5e-58   Setaria italica
ref|XP_008243657.1|  PREDICTED: carboxy-terminal domain RNA polym...    198   6e-58   Prunus mume [ume]
ref|XP_003600913.1|  CTD small phosphatase-like protein                 197   7e-58   Medicago truncatula
gb|EEE64021.1|  hypothetical protein OsJ_18850                          198   1e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392189.1|  PREDICTED: CTD nuclear envelope phosphatase ...    197   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT13698.1|  CTD small phosphatase-like protein 2                    197   3e-57   
emb|CDM84840.1|  unnamed protein product                                197   3e-57   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ91589.1|  predicted protein                                      196   6e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006655392.1|  PREDICTED: CTD small phosphatase-like protei...    194   8e-57   Oryza brachyantha
ref|XP_008442416.1|  PREDICTED: CTD small phosphatase-like protein 2    195   1e-56   Cucumis melo [Oriental melon]
ref|XP_004137719.1|  PREDICTED: CTD small phosphatase-like protei...    194   2e-56   Cucumis sativus [cucumbers]
ref|XP_010095241.1|  CTD small phosphatase-like protein 2               192   2e-56   
ref|NP_001148462.1|  LOC100282077                                       192   2e-55   Zea mays [maize]
ref|XP_002323581.2|  hypothetical protein POPTR_0016s12400g             191   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010534600.1|  PREDICTED: CTD small phosphatase-like protein      191   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_010535319.1|  PREDICTED: carboxy-terminal domain RNA polym...    191   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_009406928.1|  PREDICTED: CTD nuclear envelope phosphatase ...    189   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT12311.1|  CTD small phosphatase-like protein 2                    189   9e-54   
emb|CDX93216.1|  BnaC04g46800D                                          184   1e-52   
dbj|BAK00193.1|  predicted protein                                      184   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004500494.1|  PREDICTED: probable C-terminal domain small ...    183   2e-52   Cicer arietinum [garbanzo]
ref|XP_009103976.1|  PREDICTED: CTD small phosphatase-like protein      183   3e-52   Brassica rapa
emb|CDY46516.1|  BnaC06g15690D                                          183   3e-52   Brassica napus [oilseed rape]
emb|CDX72186.1|  BnaC08g26880D                                          183   4e-52   
emb|CDY27252.1|  BnaA09g35500D                                          183   4e-52   Brassica napus [oilseed rape]
ref|XP_009141872.1|  PREDICTED: carboxy-terminal domain RNA polym...    183   4e-52   Brassica rapa
ref|XP_009116289.1|  PREDICTED: CTD small phosphatase-like protei...    182   4e-52   Brassica rapa
ref|XP_009116288.1|  PREDICTED: CTD small phosphatase-like protei...    182   5e-52   Brassica rapa
ref|XP_006403042.1|  hypothetical protein EUTSA_v10006119mg             182   6e-52   Eutrema salsugineum [saltwater cress]
gb|KFK34835.1|  hypothetical protein AALP_AA5G199300                    182   6e-52   Arabis alpina [alpine rockcress]
ref|NP_191155.1|  Haloacid dehalogenase-like hydrolase (HAD) supe...    182   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427400.1|  PREDICTED: carboxy-terminal domain RNA polym...    182   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002878054.1|  NLI interacting factor family protein              182   1e-51   Arabidopsis lyrata subsp. lyrata
emb|CDX67629.1|  BnaA07g16690D                                          181   1e-51   
ref|XP_010516189.1|  PREDICTED: carboxy-terminal domain RNA polym...    181   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010504466.1|  PREDICTED: carboxy-terminal domain RNA polym...    181   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006291562.1|  hypothetical protein CARUB_v10017717mg             181   4e-51   Capsella rubella
gb|KFK23193.1|  hypothetical protein AALP_AAs48948U000100               180   5e-51   Arabis alpina [alpine rockcress]
ref|XP_006411263.1|  hypothetical protein EUTSA_v10016941mg             180   7e-51   Eutrema salsugineum [saltwater cress]
emb|CDY07060.1|  BnaA04g22550D                                          179   1e-50   
gb|KJB74328.1|  hypothetical protein B456_011G288400                    177   6e-50   Gossypium raimondii
ref|XP_006294652.1|  hypothetical protein CARUB_v10023688mg             177   7e-50   
ref|XP_010508910.1|  PREDICTED: probable C-terminal domain small ...    177   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010505730.1|  PREDICTED: CTD small phosphatase-like protei...    177   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010517420.1|  PREDICTED: CTD nuclear envelope phosphatase ...    177   1e-49   Camelina sativa [gold-of-pleasure]
gb|KHG26951.1|  putative phosphatase PSR2                               176   2e-49   Gossypium arboreum [tree cotton]
ref|XP_010505729.1|  PREDICTED: CTD small phosphatase-like protei...    177   2e-49   
ref|XP_010505722.1|  PREDICTED: CTD small phosphatase-like protei...    177   2e-49   
ref|XP_010517419.1|  PREDICTED: CTD nuclear envelope phosphatase ...    177   2e-49   
ref|XP_010517418.1|  PREDICTED: CTD nuclear envelope phosphatase ...    177   2e-49   
ref|XP_010517411.1|  PREDICTED: CTD nuclear envelope phosphatase ...    177   2e-49   
ref|XP_010505726.1|  PREDICTED: CTD small phosphatase-like protei...    176   2e-49   
ref|XP_010508909.1|  PREDICTED: CTD small phosphatase-like protei...    177   5e-49   
gb|AAT58765.1|  unknown protein, contains NLI interacting factor-...    173   1e-48   Oryza sativa Japonica Group [Japonica rice]
gb|KDO68955.1|  hypothetical protein CISIN_1g022258mg                   169   6e-47   Citrus sinensis [apfelsine]
ref|XP_002315157.2|  NLI interacting factor family protein              166   3e-46   
gb|KCW65681.1|  hypothetical protein EUGRSUZ_G03062                     165   1e-45   Eucalyptus grandis [rose gum]
ref|XP_006843565.1|  hypothetical protein AMTR_s00007p00087260          164   1e-45   
ref|XP_008370103.1|  PREDICTED: carboxy-terminal domain RNA polym...    165   2e-45   
ref|XP_002312160.2|  NLI interacting factor family protein              165   5e-45   
ref|XP_002990146.1|  hypothetical protein SELMODRAFT_131171             153   1e-41   
ref|XP_002992543.1|  hypothetical protein SELMODRAFT_135380             153   1e-41   
gb|AAW22871.1|  hypothetical protein 56B23-g1                           140   4e-38   Solanum lycopersicum
ref|XP_009609474.1|  PREDICTED: mitochondrial import inner membra...    139   1e-37   Nicotiana tomentosiformis
ref|XP_006294651.1|  hypothetical protein CARUB_v10023688mg             142   7e-37   
ref|XP_009762549.1|  PREDICTED: mitochondrial import inner membra...    137   2e-36   Nicotiana sylvestris
ref|XP_010517421.1|  PREDICTED: CTD nuclear envelope phosphatase ...    140   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010231274.1|  PREDICTED: uncharacterized protein LOC100829084    137   9e-35   Brachypodium distachyon [annual false brome]
gb|AFW82277.1|  hypothetical protein ZEAMMB73_719646                    136   3e-34   
ref|XP_005648282.1|  hypothetical protein COCSUDRAFT_63263              118   2e-28   Coccomyxa subellipsoidea C-169
emb|CDP11904.1|  unnamed protein product                                110   1e-26   Coffea canephora [robusta coffee]
ref|XP_001699661.1|  hypothetical protein CHLREDRAFT_111940             112   2e-26   Chlamydomonas reinhardtii
ref|XP_002501116.1|  predicted protein                                  102   4e-23   Micromonas commoda
ref|XP_002956598.1|  hypothetical protein VOLCADRAFT_36131            95.5    8e-21   Volvox carteri f. nagariensis
ref|XP_011401617.1|  CTD small phosphatase-like protein               87.8    2e-17   Auxenochlorella protothecoides
ref|XP_005647998.1|  hypothetical protein COCSUDRAFT_62990            90.5    5e-17   Coccomyxa subellipsoidea C-169
ref|XP_002985448.1|  hypothetical protein SELMODRAFT_5502             82.8    4e-16   
ref|XP_002979786.1|  hypothetical protein SELMODRAFT_5501             82.8    5e-16   
ref|XP_008614870.1|  hypothetical protein SDRG_10647                  83.6    9e-16   Saprolegnia diclina VS20
gb|KDO32623.1|  hypothetical protein SPRG_02324                       83.2    1e-15   Saprolegnia parasitica CBS 223.65
gb|KFK44809.1|  hypothetical protein AALP_AA1G305500                  82.8    1e-15   Arabis alpina [alpine rockcress]
ref|XP_009538580.1|  hypothetical protein PHYSODRAFT_551168           83.2    1e-15   Phytophthora sojae
ref|XP_008895497.1|  hypothetical protein PPTG_04907                  83.2    2e-15   Phytophthora parasitica INRA-310
gb|KJB66868.1|  hypothetical protein B456_010G161800                  83.6    2e-15   Gossypium raimondii
gb|KIZ04779.1|  hypothetical protein MNEG_3173                        86.3    2e-15   Monoraphidium neglectum
ref|XP_011085316.1|  PREDICTED: CTD small phosphatase-like protein    82.8    3e-15   Sesamum indicum [beniseed]
gb|AAV63941.1|  putative nuclear LIM factor interactor-interactin...  82.0    4e-15   Phytophthora infestans [potato late blight]
ref|XP_002906966.1|  CTD small phosphatase-like protein, putative     82.0    4e-15   Phytophthora infestans T30-4
gb|ETI38295.1|  hypothetical protein F443_15895                       81.6    4e-15   Phytophthora parasitica P1569
gb|ETO67065.1|  hypothetical protein F444_15879                       81.6    4e-15   Phytophthora parasitica P1976
ref|XP_008388217.1|  PREDICTED: uncharacterized protein LOC103450630  81.3    6e-15   
ref|XP_007025282.1|  Haloacid dehalogenase hydrolase domain-conta...  81.6    9e-15   
ref|XP_004309632.1|  PREDICTED: CTD small phosphatase-like protein    82.0    1e-14   Fragaria vesca subsp. vesca
gb|KJB69665.1|  hypothetical protein B456_011G036100                  81.6    1e-14   Gossypium raimondii
ref|XP_005537320.1|  mitochondrial presequence translocase subuni...  82.0    2e-14   Cyanidioschyzon merolae strain 10D
gb|EPS60408.1|  hypothetical protein M569_14397                       79.3    3e-14   Genlisea aurea
gb|KDP21150.1|  hypothetical protein JCGZ_21621                       80.1    3e-14   Jatropha curcas
ref|XP_009593846.1|  PREDICTED: probable C-terminal domain small ...  79.7    3e-14   Nicotiana tomentosiformis
ref|XP_010538232.1|  PREDICTED: probable C-terminal domain small ...  79.3    3e-14   Tarenaya hassleriana [spider flower]
ref|XP_009776554.1|  PREDICTED: probable C-terminal domain small ...  79.7    3e-14   Nicotiana sylvestris
ref|XP_009351769.1|  PREDICTED: carboxy-terminal domain RNA polym...  79.3    4e-14   Pyrus x bretschneideri [bai li]
ref|XP_007025284.1|  Haloacid dehalogenase-like hydrolase superfa...  79.7    4e-14   
ref|XP_010549563.1|  PREDICTED: probable C-terminal domain small ...  79.0    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_002983484.1|  hypothetical protein SELMODRAFT_5512             77.0    4e-14   
ref|XP_008371514.1|  PREDICTED: carboxy-terminal domain RNA polym...  79.3    5e-14   Malus domestica [apple tree]
emb|CDO96877.1|  unnamed protein product                              79.3    5e-14   Coffea canephora [robusta coffee]
ref|XP_002974008.1|  hypothetical protein SELMODRAFT_5873             76.6    6e-14   
ref|XP_007213826.1|  hypothetical protein PRUPE_ppa009682mg           79.0    6e-14   Prunus persica
ref|XP_010499496.1|  PREDICTED: carboxy-terminal domain RNA polym...  79.0    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004309622.1|  PREDICTED: carboxy-terminal domain RNA polym...  79.0    6e-14   Fragaria vesca subsp. vesca
ref|XP_011462148.1|  PREDICTED: CTD small phosphatase-like protein    79.7    7e-14   Fragaria vesca subsp. vesca
ref|XP_008225241.1|  PREDICTED: carboxy-terminal domain RNA polym...  78.6    8e-14   Prunus mume [ume]
ref|XP_010462980.1|  PREDICTED: carboxy-terminal domain RNA polym...  78.2    9e-14   Camelina sativa [gold-of-pleasure]
emb|CEG65560.1|  hypothetical protein RMATCC62417_02324               78.6    1e-13   Rhizopus microsporus
ref|XP_006449562.1|  hypothetical protein CICLE_v10016126mg           78.2    1e-13   
ref|XP_002978918.1|  hypothetical protein SELMODRAFT_418692           77.4    1e-13   
ref|XP_009352935.1|  PREDICTED: CTD small phosphatase-like protein    78.2    1e-13   
ref|XP_009352715.1|  PREDICTED: CTD small phosphatase-like protein    78.2    1e-13   
ref|NP_174270.1|  haloacid dehalogenase-like hydrolase                77.8    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008383597.1|  PREDICTED: carboxy-terminal domain RNA polym...  77.8    1e-13   Malus domestica [apple tree]
ref|XP_010478348.1|  PREDICTED: carboxy-terminal domain RNA polym...  77.8    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_001439574.1|  hypothetical protein                             79.7    2e-13   Paramecium tetraurelia strain d4-2
gb|KJB69664.1|  hypothetical protein B456_011G036000                  78.6    2e-13   Gossypium raimondii
ref|XP_002264996.1|  PREDICTED: carboxy-terminal domain RNA polym...  77.8    2e-13   Vitis vinifera
ref|XP_006304077.1|  hypothetical protein CARUB_v10009936mg           77.0    2e-13   Capsella rubella
ref|XP_005826001.1|  hypothetical protein GUITHDRAFT_165068           79.0    2e-13   Guillardia theta CCMP2712
emb|CEG65559.1|  hypothetical protein RMATCC62417_02324               78.6    3e-13   Rhizopus microsporus
gb|EYU43303.1|  hypothetical protein MIMGU_mgv1a011086mg              77.0    3e-13   Erythranthe guttata [common monkey flower]
emb|CEI87716.1|  hypothetical protein RMCBS344292_02125               78.6    3e-13   Rhizopus microsporus
ref|XP_010248403.1|  PREDICTED: carboxy-terminal domain RNA polym...  77.0    3e-13   Nelumbo nucifera [Indian lotus]
gb|AAV63939.1|  putative nuclear LIM factor interactor-interactin...  77.4    4e-13   Phytophthora infestans [potato late blight]
ref|XP_006415548.1|  hypothetical protein EUTSA_v10009586mg           76.6    4e-13   Eutrema salsugineum [saltwater cress]
ref|XP_002890829.1|  NLI interacting factor family protein            76.6    4e-13   
ref|XP_002901996.1|  NLI interacting factor-like phosphatase, put...  77.0    4e-13   Phytophthora infestans T30-4
ref|XP_006304661.1|  hypothetical protein CARUB_v10011857mg           75.5    4e-13   
gb|KJB66824.1|  hypothetical protein B456_010G162100                  77.0    5e-13   Gossypium raimondii
ref|XP_008383866.1|  PREDICTED: CTD small phosphatase-like protein    77.4    5e-13   
gb|KJB69663.1|  hypothetical protein B456_011G035900                  76.6    5e-13   Gossypium raimondii
ref|XP_011039376.1|  PREDICTED: carboxy-terminal domain RNA polym...  76.3    5e-13   Populus euphratica
emb|CEP17909.1|  hypothetical protein                                 77.8    5e-13   Parasitella parasitica
ref|XP_002991478.1|  hypothetical protein SELMODRAFT_133639           75.5    5e-13   
ref|XP_009805067.1|  PREDICTED: CTD small phosphatase-like protei...  75.1    6e-13   Nicotiana sylvestris
gb|KJB66870.1|  hypothetical protein B456_010G162000                  75.9    6e-13   Gossypium raimondii
ref|XP_011010921.1|  PREDICTED: probable C-terminal domain small ...  73.9    6e-13   Populus euphratica
ref|XP_002984918.1|  hypothetical protein SELMODRAFT_424005           74.7    6e-13   
dbj|GAN02241.1|  HAD-like protein                                     77.4    6e-13   Mucor ambiguus
ref|XP_009805066.1|  PREDICTED: CTD small phosphatase-like protei...  75.1    7e-13   Nicotiana sylvestris
ref|XP_002522273.1|  Carboxy-terminal domain RNA polymerase II po...  76.3    7e-13   Ricinus communis
ref|XP_004036743.1|  NLI interacting factor-like phosphatase fami...  74.3    8e-13   Ichthyophthirius multifiliis
ref|XP_002984913.1|  hypothetical protein SELMODRAFT_5868             74.3    8e-13   
ref|XP_005708391.1|  mitochondrial presequence translocase subuni...  76.6    8e-13   Galdieria sulphuraria
gb|KJB66872.1|  hypothetical protein B456_010G162300                  76.3    8e-13   Gossypium raimondii
ref|XP_002984912.1|  hypothetical protein SELMODRAFT_48489            73.9    9e-13   
ref|XP_007025283.1|  Haloacid dehalogenase hydrolase domain-conta...  76.6    9e-13   
ref|XP_002440775.1|  hypothetical protein SORBIDRAFT_09g006400        75.9    1e-12   Sorghum bicolor [broomcorn]
ref|XP_009834767.1|  hypothetical protein H257_10034                  74.7    1e-12   Aphanomyces astaci
gb|KIM68582.1|  hypothetical protein SCLCIDRAFT_104632                73.6    1e-12   Scleroderma citrinum Foug A
ref|XP_002533382.1|  conserved hypothetical protein                   75.1    1e-12   
ref|XP_004960604.1|  PREDICTED: probable C-terminal domain small ...  74.7    1e-12   
ref|XP_008864818.1|  hypothetical protein H310_02908                  74.3    1e-12   Aphanomyces invadans
ref|XP_006467590.1|  PREDICTED: CTD small phosphatase-like protei...  75.5    1e-12   
emb|CDX90210.1|  BnaA08g17740D                                        75.1    1e-12   
gb|EPB83424.1|  hypothetical protein HMPREF1544_09808                 76.6    1e-12   Mucor circinelloides f. circinelloides 1006PhL
emb|CDS03623.1|  hypothetical protein LRAMOSA01025                    76.6    1e-12   Lichtheimia ramosa
ref|XP_002984914.1|  hypothetical protein SELMODRAFT_121036           73.9    1e-12   
ref|XP_002457958.1|  hypothetical protein SORBIDRAFT_03g023470        74.3    2e-12   
emb|CAN66698.1|  hypothetical protein VITISV_026605                   77.0    2e-12   Vitis vinifera
ref|XP_010105625.1|  CTD small phosphatase-like protein               75.1    2e-12   Morus notabilis
ref|XP_002984910.1|  hypothetical protein SELMODRAFT_121210           73.6    2e-12   
emb|CCI44559.1|  unnamed protein product                              76.6    2e-12   Albugo candida
ref|XP_002984911.1|  hypothetical protein SELMODRAFT_121282           73.6    2e-12   
ref|XP_002985967.1|  hypothetical protein SELMODRAFT_123223           73.6    2e-12   
ref|XP_006358085.1|  PREDICTED: probable C-terminal domain small ...  74.7    2e-12   Solanum tuberosum [potatoes]
ref|XP_010052154.1|  PREDICTED: carboxy-terminal domain RNA polym...  75.1    2e-12   Eucalyptus grandis [rose gum]
ref|XP_007767400.1|  NLI interacting factor                           73.2    2e-12   Coniophora puteana RWD-64-598 SS2
emb|CCI44560.1|  unnamed protein product                              76.6    2e-12   Albugo candida
ref|XP_004233068.1|  PREDICTED: CTD small phosphatase-like protein    74.7    2e-12   Solanum lycopersicum
ref|XP_008225256.1|  PREDICTED: carboxy-terminal domain RNA polym...  75.1    2e-12   Prunus mume [ume]
gb|EIE85640.1|  hypothetical protein RO3G_10350                       75.9    2e-12   Rhizopus delemar RA 99-880
ref|XP_010916740.1|  PREDICTED: probable C-terminal domain small ...  74.3    2e-12   
emb|CDH48498.1|  had-like protein                                     75.9    3e-12   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002316807.2|  hypothetical protein POPTR_0011s06780g           74.3    3e-12   
gb|KIP07696.1|  hypothetical protein PHLGIDRAFT_70560                 72.4    3e-12   Phlebiopsis gigantea 11061_1 CR5-6
gb|ETI50521.1|  hypothetical protein F443_05965                       71.6    3e-12   Phytophthora parasitica P1569
gb|EAY96916.1|  hypothetical protein OsI_18835                        74.3    3e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001054894.1|  Os05g0205100                                     74.3    3e-12   
ref|XP_007511213.1|  general stress response phosphoprotein phosp...  75.9    3e-12   Bathycoccus prasinos
ref|XP_005845048.1|  hypothetical protein CHLNCDRAFT_137319           76.3    3e-12   Chlorella variabilis
ref|XP_009353431.1|  PREDICTED: CTD nuclear envelope phosphatase ...  74.7    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_002305050.2|  hypothetical protein POPTR_0004s06150g           73.9    4e-12   Populus trichocarpa [western balsam poplar]
emb|CCI39932.1|  unnamed protein product                              72.4    4e-12   Albugo candida
emb|CDY35276.1|  BnaC03g59470D                                        73.2    4e-12   Brassica napus [oilseed rape]
ref|XP_001440554.1|  hypothetical protein                             75.5    4e-12   Paramecium tetraurelia strain d4-2
gb|KIM23710.1|  hypothetical protein M408DRAFT_77067                  72.0    4e-12   Serendipita vermifera MAFF 305830
ref|XP_002984804.1|  hypothetical protein SELMODRAFT_5836             71.6    5e-12   
ref|XP_001643212.1|  hypothetical protein Kpol_457p5                  75.1    5e-12   Vanderwaltozyma polyspora DSM 70294
gb|AFW81624.1|  hypothetical protein ZEAMMB73_313891                  73.9    5e-12   
ref|XP_002890830.1|  NLI interacting factor family protein            72.4    5e-12   Arabidopsis lyrata subsp. lyrata
gb|ETO79247.1|  hypothetical protein F444_06022                       73.9    5e-12   
ref|XP_009610469.1|  PREDICTED: nuclear envelope morphology prote...  73.2    6e-12   
ref|XP_008916842.1|  hypothetical protein PPTG_19960                  70.5    6e-12   
emb|CEI90874.1|  Putative TIM50                                       73.6    6e-12   
emb|CDY35277.1|  BnaC03g59460D                                        73.2    6e-12   
emb|CCA25650.1|  lectin putative                                      75.5    6e-12   
gb|KIK94189.1|  hypothetical protein PAXRUDRAFT_33653                 73.6    6e-12   
ref|NP_174271.1|  Haloacid dehalogenase-like hydrolase (HAD) supe...  72.4    7e-12   
ref|XP_009760937.1|  PREDICTED: nuclear envelope morphology prote...  72.8    7e-12   
ref|XP_006415547.1|  hypothetical protein EUTSA_v10009741mg           72.4    7e-12   
ref|XP_001302150.1|  NLI interacting factor-like phosphatase fami...  73.2    7e-12   
ref|XP_001783372.1|  predicted protein                                71.6    7e-12   
gb|AAG10616.1|AC008030_16  Hypothetical protein                       72.4    8e-12   
ref|XP_004023859.1|  NLI interacting factor-like phosphatase fami...  72.8    8e-12   
ref|XP_009109642.1|  PREDICTED: carboxy-terminal domain RNA polym...  72.8    8e-12   
pdb|3QLE|A  Chain A, Structural Basis For The Function Of Tim50 I...  71.6    8e-12   
ref|XP_004485939.1|  PREDICTED: probable C-terminal domain small ...  72.8    9e-12   
ref|XP_002985977.1|  hypothetical protein SELMODRAFT_123069           71.6    9e-12   
ref|XP_004134627.1|  PREDICTED: CTD small phosphatase-like protei...  72.4    1e-11   
ref|XP_002902000.1|  nuclear LIM factor interactor-interacting pr...  72.4    1e-11   
ref|XP_006957876.1|  NIF-domain-containing protein                    73.9    1e-11   
ref|XP_004163350.1|  PREDICTED: CTD small phosphatase-like protei...  72.4    1e-11   
ref|XP_001424187.1|  hypothetical protein                             74.3    1e-11   
gb|AAV63937.1|  putative nuclear LIM factor interactor-interactin...  72.8    1e-11   
gb|ETK90401.1|  hypothetical protein L915_05840                       69.7    1e-11   
emb|CBK20438.2|  unnamed protein product                              72.0    1e-11   
ref|XP_004363966.1|  NLI interacting factor family protein            73.2    1e-11   
ref|XP_009109641.1|  PREDICTED: CTD small phosphatase-like protein    71.2    2e-11   
ref|XP_002985968.1|  hypothetical protein SELMODRAFT_5469             69.7    2e-11   
gb|EJT97493.1|  hypothetical protein DACRYDRAFT_58644                 70.1    2e-11   
ref|XP_002985969.1|  hypothetical protein SELMODRAFT_122967           70.9    2e-11   
emb|CCA14728.1|  putative nuclear LIM factor interactorinteractin...  71.2    2e-11   
emb|CDX90211.1|  BnaA08g17730D                                        71.2    2e-11   
ref|XP_009519706.1|  hypothetical protein PHYSODRAFT_296510           72.8    2e-11   
ref|XP_009519698.1|  hypothetical protein PHYSODRAFT_311407           72.8    2e-11   
ref|NP_586242.1|  similarity to HYPOTHETICAL PROTEIN YA22_SCHPO       71.2    2e-11   
gb|KDO56646.1|  hypothetical protein CISIN_1g020937mg                 71.2    2e-11   
emb|CDX98150.1|  BnaC07g09480D                                        69.7    2e-11   
emb|CDX99852.1|  BnaC05g22740D                                        72.0    2e-11   
ref|XP_008790076.1|  PREDICTED: CTD small phosphatase-like protein    72.0    2e-11   
ref|XP_001016911.1|  NLI interacting factor-like phosphatase fami...  73.9    2e-11   
ref|XP_010460753.1|  PREDICTED: probable C-terminal domain small ...  70.9    2e-11   
ref|XP_009115216.1|  PREDICTED: probable C-terminal domain small ...  71.6    2e-11   
ref|XP_008439711.1|  PREDICTED: carboxy-terminal domain RNA polym...  71.6    2e-11   
ref|XP_002990255.1|  hypothetical protein SELMODRAFT_131302           70.9    2e-11   
ref|XP_008371727.1|  PREDICTED: CTD nuclear envelope phosphatase ...  72.4    2e-11   
gb|EWM29185.1|  nuclear lim factor interactor-interacting protein...  72.8    2e-11   
ref|XP_007302351.1|  NLI interacting factor                           69.3    3e-11   
ref|XP_004039006.1|  NLI interacting factor-like phosphatase fami...  70.5    3e-11   
ref|XP_001877698.1|  predicted protein                                69.7    3e-11   
gb|ETO79245.1|  hypothetical protein F444_06020                       70.9    3e-11   
ref|XP_010499497.1|  PREDICTED: probable C-terminal domain small ...  70.5    3e-11   
gb|KIK30637.1|  hypothetical protein PISMIDRAFT_86388                 69.7    3e-11   
gb|ETL99503.1|  hypothetical protein L917_03664                       70.9    3e-11   
ref|XP_010665680.1|  PREDICTED: carboxy-terminal domain RNA polym...  71.6    3e-11   
ref|XP_001430773.1|  hypothetical protein                             73.2    3e-11   
ref|XP_002984917.1|  hypothetical protein SELMODRAFT_121192           70.1    3e-11   
emb|CEP61925.1|  LALA0S04e03774g1_1                                   72.4    3e-11   
ref|XP_007214735.1|  hypothetical protein PRUPE_ppa025444mg           70.9    3e-11   
gb|KII94818.1|  hypothetical protein PLICRDRAFT_192906                72.4    3e-11   
gb|ETP20252.1|  hypothetical protein F441_05981                       71.2    3e-11   
gb|ETK90384.1|  hypothetical protein L915_05848                       71.6    3e-11   
ref|XP_001449952.1|  hypothetical protein                             72.4    4e-11   
gb|KDR83790.1|  hypothetical protein GALMADRAFT_54740                 72.0    4e-11   
gb|EGA56571.1|  Tim50p                                                72.0    4e-11   
gb|ETP48195.1|  hypothetical protein F442_06005                       71.2    4e-11   
gb|KIO12904.1|  hypothetical protein M404DRAFT_58949                  69.3    4e-11   
ref|XP_004343502.2|  import inner membrane translocase subunit TIM50  72.0    4e-11   
gb|KIM46232.1|  hypothetical protein M413DRAFT_64928                  71.6    4e-11   
ref|XP_006460060.1|  hypothetical protein AGABI2DRAFT_191826          70.5    4e-11   
ref|XP_001448324.1|  hypothetical protein                             72.4    4e-11   
ref|XP_002984909.1|  hypothetical protein SELMODRAFT_423987           69.7    4e-11   
gb|ETO79269.1|  hypothetical protein F444_06008                       71.2    4e-11   
ref|XP_008891378.1|  hypothetical protein PPTG_02126                  70.9    4e-11   
ref|XP_007329505.1|  hypothetical protein AGABI1DRAFT_113526          70.5    4e-11   
gb|KIJ70000.1|  hypothetical protein HYDPIDRAFT_23152                 72.0    5e-11   
gb|AFK36200.1|  unknown                                               70.5    5e-11   
gb|EDN61078.1|  translocase of the inner membrane                     72.0    5e-11   
ref|XP_007766321.1|  NLI interacting factor                           68.9    6e-11   
ref|XP_006398252.1|  hypothetical protein EUTSA_v10000984mg           70.5    6e-11   
ref|XP_007861736.1|  hypothetical protein GLOTRDRAFT_34014            69.3    6e-11   
ref|NP_015262.1|  Tim50p                                              72.0    6e-11   
gb|KII63201.1|  CTD small phosphatase-like protein                    70.9    6e-11   
ref|XP_002961880.1|  hypothetical protein SELMODRAFT_77112            69.7    6e-11   
ref|XP_001578880.1|  NLI interacting factor-like phosphatase fami...  71.2    6e-11   
gb|KIY51614.1|  NLI interacting factor                                68.2    6e-11   
ref|XP_009266924.1|  Nuclear envelope morphology protein 1            72.0    6e-11   
gb|EKC98705.1|  protein phosphatase                                   71.6    6e-11   
ref|XP_009543571.1|  hypothetical protein HETIRDRAFT_443965           72.0    7e-11   
gb|KDQ64274.1|  hypothetical protein JAAARDRAFT_27896                 71.6    7e-11   
gb|ETI50503.1|  hypothetical protein F443_05975                       70.9    7e-11   
ref|XP_003593807.1|  CTD small phosphatase-like protein               70.5    7e-11   
ref|XP_005855272.1|  translocase of inner mitochondrial membrane ...  71.2    8e-11   
gb|KIK67046.1|  hypothetical protein GYMLUDRAFT_156868                68.9    8e-11   
gb|KIK65320.1|  hypothetical protein GYMLUDRAFT_38769                 71.2    8e-11   
emb|CCA71789.1|  related to nuclear envelope protein NEM1             71.6    8e-11   
ref|XP_001420859.1|  predicted protein                                68.2    8e-11   
ref|XP_009691890.1|  RNA polymerase II carboxyterminal domain pho...  70.1    8e-11   
gb|EJT52167.1|  protein phosphatase                                   71.6    8e-11   
ref|XP_007000918.1|  hypothetical protein TREMEDRAFT_41494            68.6    8e-11   
ref|XP_009102809.1|  PREDICTED: probable C-terminal domain small ...  68.9    9e-11   
gb|EAR83949.2|  NLI interacting factor-like phosphatase               72.0    9e-11   
gb|KIJ56854.1|  hypothetical protein M422DRAFT_773601                 71.2    9e-11   
ref|XP_003029995.1|  hypothetical protein SCHCODRAFT_57677            68.6    9e-11   
gb|KJA30030.1|  hypothetical protein HYPSUDRAFT_252080                70.9    9e-11   
gb|KIL70103.1|  hypothetical protein M378DRAFT_67508                  70.9    9e-11   
ref|XP_001457501.1|  hypothetical protein                             70.1    1e-10   
gb|EWM27179.1|  mitochondrial import inner membrane translocase s...  71.2    1e-10   
ref|XP_009409386.1|  PREDICTED: CTD small phosphatase-like protein    70.1    1e-10   
ref|XP_001876656.1|  predicted protein                                70.9    1e-10   
gb|ETP48230.1|  hypothetical protein F442_05995                       70.1    1e-10   
ref|NP_595583.2|  TIM23 translocase complex subunit Tim50 (predic...  70.9    1e-10   
gb|EJU04267.1|  NLI interacting factor                                68.2    1e-10   
ref|XP_002946658.1|  hypothetical protein VOLCADRAFT_103070           70.1    1e-10   
ref|XP_008916843.1|  hypothetical protein PPTG_19961                  70.1    1e-10   
ref|XP_008656380.1|  PREDICTED: probable phosphatase PSR2 isoform X1  68.2    1e-10   
gb|KIM65061.1|  hypothetical protein SCLCIDRAFT_113907                68.6    1e-10   
emb|CCU98777.1|  unnamed protein product                              69.3    1e-10   
gb|EJT44498.1|  TIM50-like protein                                    70.9    1e-10   
gb|EJY64652.1|  NLI interacting factor-like phosphatase family pr...  71.2    1e-10   
ref|NP_199382.1|  haloacid dehalogenase-like hydrolase (HAD) supe...  69.3    1e-10   
gb|KIO19513.1|  hypothetical protein M407DRAFT_16113                  67.4    1e-10   
emb|CDS08568.1|  hypothetical protein LRAMOSA09929                    67.8    1e-10   
emb|CDY59322.1|  BnaCnng34680D                                        69.3    1e-10   
ref|XP_010478349.1|  PREDICTED: probable C-terminal domain small ...  68.6    1e-10   
ref|XP_002865229.1|  NLI interacting factor family protein            69.3    1e-10   
ref|XP_010441680.1|  PREDICTED: CTD nuclear envelope phosphatase ...  69.3    1e-10   
gb|KGG51729.1|  hypothetical protein DI09_28p100                      70.5    1e-10   
gb|KIJ20917.1|  hypothetical protein PAXINDRAFT_66889                 69.7    1e-10   
gb|KIY44365.1|  NLI interacting factor                                68.2    2e-10   
gb|AAV63940.1|  putative nuclear LIM factor interactor-interactin...  69.7    2e-10   
ref|XP_001452557.1|  hypothetical protein                             70.1    2e-10   
gb|KIL68965.1|  hypothetical protein M378DRAFT_184815                 68.9    2e-10   
ref|XP_002901998.1|  nuclear LIM factor interactor-interacting pr...  69.7    2e-10   
gb|EGA60299.1|  Tim50p                                                70.5    2e-10   
ref|XP_002289784.1|  predicted protein                                67.8    2e-10   
ref|XP_009519699.1|  hypothetical protein PHYSODRAFT_325530           69.7    2e-10   
ref|XP_003566435.1|  PREDICTED: probable C-terminal domain small ...  69.3    2e-10   
emb|CDW89382.1|  nli interacting factor-like phosphatase family p...  70.9    2e-10   
gb|ETP20253.1|  hypothetical protein F441_05982                       70.1    2e-10   
gb|ETK90383.1|  hypothetical protein L915_05847                       70.1    2e-10   
gb|ETI50502.1|  hypothetical protein F443_05974                       70.1    2e-10   
dbj|GAM29155.1|  hypothetical protein SAMD00019534_123310             68.6    2e-10   
gb|ETO79246.1|  hypothetical protein F444_06021                       70.1    2e-10   
gb|EJY70344.1|  NLI interacting factor-like phosphatase family pr...  70.1    2e-10   
emb|CDY43188.1|  BnaA07g07660D                                        68.9    2e-10   
ref|XP_001732718.1|  hypothetical protein MGL_0493                    68.9    2e-10   
gb|KIY73708.1|  NIF-domain-containing protein                         70.5    2e-10   
gb|KIM90723.1|  hypothetical protein PILCRDRAFT_811185                70.1    2e-10   
ref|XP_001316499.1|  hypothetical protein                             69.7    2e-10   
ref|NP_001043640.2|  Os01g0629400                                     67.4    2e-10   
gb|KDO28629.1|  hypothetical protein SPRG_06484                       69.7    2e-10   
emb|CCU97386.1|  unnamed protein product                              70.1    2e-10   
gb|ETL43802.1|  hypothetical protein L916_05781                       69.3    2e-10   
gb|EMD40843.1|  hypothetical protein CERSUDRAFT_149311                70.1    2e-10   
gb|KIK48820.1|  hypothetical protein CY34DRAFT_513201                 70.1    2e-10   
emb|CDW86754.1|  nli interacting factor-like phosphatase family p...  70.5    2e-10   
emb|CCO26799.1|  Nuclear envelope morphology protein 1                67.4    2e-10   
gb|KHJ31898.1|  putative had-like protein                             68.6    2e-10   
gb|EJY77926.1|  NLI interacting factor-like phosphatase family pr...  70.5    2e-10   
ref|XP_004361173.1|  dullard-like phosphatase domain containing p...  69.3    3e-10   
emb|CBJ29851.1|  putative nuclear LIM interactor-interacting protein  69.3    3e-10   
gb|AAV63938.1|  putative nuclear LIM factor interactor-interactin...  69.3    3e-10   
ref|XP_001459615.1|  hypothetical protein                             69.7    3e-10   
emb|CCM05067.1|  predicted protein                                    70.1    3e-10   
emb|CDS19359.1|  mitochondrial import inner membrane translocase      69.3    3e-10   
ref|XP_001877699.1|  predicted protein                                67.0    3e-10   
ref|XP_003546048.1|  PREDICTED: probable C-terminal domain small ...  68.9    3e-10   
gb|EHM99923.1|  Tim50p                                                69.7    3e-10   
ref|XP_007415302.1|  hypothetical protein MELLADRAFT_39109            66.6    3e-10   
gb|EUB60343.1|  Mitochondrial import inner membrane translocase s...  69.3    3e-10   
ref|XP_010481542.1|  PREDICTED: CTD nuclear envelope phosphatase ...  68.6    3e-10   
ref|XP_003888202.1|  Dullard-like phosphatase domain-containing p...  67.8    3e-10   
gb|KDQ27800.1|  hypothetical protein PLEOSDRAFT_1042370               67.0    3e-10   
gb|KIK03519.1|  hypothetical protein K443DRAFT_676695                 69.7    3e-10   
gb|KJB66869.1|  hypothetical protein B456_010G161900                  67.0    3e-10   
gb|KIR47497.1|  carboxy-terminal domain RNA polymerase II polypep...  69.7    3e-10   
ref|XP_002901997.1|  nuclear LIM factor interactor-interacting pr...  69.3    3e-10   
gb|KIJ65609.1|  hypothetical protein HYDPIDRAFT_88462                 67.8    3e-10   
ref|WP_028833278.1|  hypothetical protein                             67.8    3e-10   
gb|KJE03954.1|  carboxy-terminal domain RNA polymerase II polypep...  69.7    3e-10   
gb|KIR53535.1|  carboxy-terminal domain RNA polymerase II polypep...  69.7    3e-10   
ref|XP_003195869.1|  protein phosphatase                              69.7    3e-10   
ref|XP_009547234.1|  protein phosphatase                              67.0    4e-10   
gb|KIR88393.1|  carboxy-terminal domain RNA polymerase II polypep...  69.7    4e-10   
gb|KIR62448.1|  carboxy-terminal domain RNA polymerase II polypep...  69.7    4e-10   
ref|XP_010518827.1|  PREDICTED: carboxy-terminal domain RNA polym...  68.6    4e-10   
gb|KFG65834.1|  Dullard family phosphatase domain-containing protein  69.7    4e-10   
gb|EPR60901.1|  Dullard family phosphatase domain-containing protein  69.7    4e-10   
gb|KIM45038.1|  hypothetical protein M413DRAFT_66696                  66.6    4e-10   
ref|XP_006461039.1|  hypothetical protein AGABI2DRAFT_68868           66.6    4e-10   
gb|KIR34049.1|  carboxy-terminal domain RNA polymerase II polypep...  69.7    4e-10   
gb|KFG44455.1|  Dullard family phosphatase domain-containing protein  69.7    4e-10   
gb|KFH18074.1|  Dullard family phosphatase domain-containing protein  69.7    4e-10   
gb|ABR26130.1|  ctd-phosphatase-like protein                          66.6    4e-10   
ref|XP_002364312.1|  NLI interacting factor-like phosphatase doma...  69.7    4e-10   
gb|KFG40970.1|  Dullard family phosphatase domain-containing protein  69.7    4e-10   
gb|EPT26165.1|  Dullard family phosphatase domain-containing protein  69.7    4e-10   
ref|XP_003730009.1|  PREDICTED: CTD nuclear envelope phosphatase ...  66.6    4e-10   
gb|KGB76984.1|  protein phosphatase                                   69.7    4e-10   
gb|KFH02301.1|  Dullard family phosphatase domain-containing protein  69.7    4e-10   
gb|KIR98421.1|  carboxy-terminal domain RNA polymerase II polypep...  69.3    4e-10   
ref|XP_008035413.1|  NIF-domain-containing protein                    69.3    4e-10   
gb|KIK98739.1|  hypothetical protein PAXRUDRAFT_133578                69.3    4e-10   
gb|ETM50089.1|  hypothetical protein L914_05797                       68.9    4e-10   
ref|XP_003380541.1|  nuclear envelope morphology protein 1            68.2    4e-10   
ref|XP_008886594.1|  Dullard family phosphatase domain-containing...  69.3    4e-10   
gb|EMD37721.1|  hypothetical protein CERSUDRAFT_65328                 67.4    4e-10   
ref|XP_003386476.1|  PREDICTED: mitochondrial import inner membra...  68.9    5e-10   
ref|XP_001447860.1|  hypothetical protein                             69.3    5e-10   
ref|XP_006279676.1|  hypothetical protein CARUB_v10026939mg           67.8    5e-10   
emb|CDO71384.1|  hypothetical protein BN946_scf184908.g142            69.7    5e-10   
gb|KIO10168.1|  hypothetical protein M404DRAFT_130838                 66.6    5e-10   
ref|XP_572886.1|  protein phosphatase                                 69.3    5e-10   
gb|AGV14593.1|  carboxy-terminal domain RNA polymerase II polypep...  69.3    5e-10   
ref|XP_002142834.1|  NLI interacting factor-like phosphatase fami...  68.9    5e-10   
gb|AFR96956.2|  carboxy-terminal domain RNA polymerase II polypep...  69.3    5e-10   
ref|XP_003082437.1|  protein phosphatase, putative (ISS)              68.6    5e-10   
ref|XP_009035542.1|  hypothetical protein AURANDRAFT_24304            68.9    5e-10   
ref|XP_001450546.1|  hypothetical protein                             68.9    5e-10   
ref|XP_001460920.1|  hypothetical protein                             68.9    6e-10   



>ref|XP_009760936.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Nicotiana sylvestris]
Length=324

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ELS+FADLVLFTAGLEGYARP+VDK+D+ + F  R YRPSTTSTEYREHVKDLSCISKDL
Sbjct  185  ELSEFADLVLFTAGLEGYARPLVDKIDLGNRFSMRFYRPSTTSTEYREHVKDLSCISKDL  244

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SRIV+VDNNPFSFLLQPLNGIPC+PF+AGQPHD QLLEVILPLL+HLSQQKDVRPVLYE 
Sbjct  245  SRIVIVDNNPFSFLLQPLNGIPCIPFAAGQPHDIQLLEVILPLLKHLSQQKDVRPVLYER  304

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQKHGIPAS
Sbjct  305  FHMPEWFQKHGIPAS  319



>ref|XP_009610468.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=325

 Score =   224 bits (571),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            EL +FADLVLFTAGLEGYARP+VDK+D+ + F  RLYRPSTTSTEYREHVKDLSCISKDL
Sbjct  185  ELGEFADLVLFTAGLEGYARPLVDKIDLGNRFSMRLYRPSTTSTEYREHVKDLSCISKDL  244

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SRIV+VDNNPFSFLLQPLNGIPC+PF+AGQPHD QLLEVILPLL+HLSQQKDVRPVLYE 
Sbjct  245  SRIVIVDNNPFSFLLQPLNGIPCIPFAAGQPHDIQLLEVILPLLKHLSQQKDVRPVLYER  304

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQKHGIP S
Sbjct  305  FHMPEWFQKHGIPVS  319



>ref|XP_004240939.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Solanum 
lycopersicum]
Length=306

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ELS+FA+LVLFTAGLEGYARP+VDK+DV + F  RLYRPST STEYREHVKDL CISKDL
Sbjct  166  ELSEFANLVLFTAGLEGYARPLVDKIDVGNRFSLRLYRPSTISTEYREHVKDLVCISKDL  225

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SRIV+VDNNPFSFLLQPLNGIPC+PFSAGQPHD QLLEVILPLL+HLS+QKDVRPVLY+ 
Sbjct  226  SRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDIQLLEVILPLLKHLSKQKDVRPVLYDR  285

Query  427  FHMPEWFQKHGIPASRAMNE  368
            FHMPEWFQKHGIPAS   +E
Sbjct  286  FHMPEWFQKHGIPASALTSE  305



>ref|XP_011084905.1| PREDICTED: LOW QUALITY PROTEIN: CTD nuclear envelope phosphatase 
1 homolog [Sesamum indicum]
Length=307

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LSKFADLVLFTAGLEGYARP+VD++DV++ F  RLYRPST STEYREHVKDLSC++KDL
Sbjct  167  QLSKFADLVLFTAGLEGYARPLVDRIDVENRFSLRLYRPSTISTEYREHVKDLSCLAKDL  226

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SRIV+VDNNPFSFLLQPLNGIPCVPFSAGQP DEQLLEVILPLL+HLS QKDVRP+LYE 
Sbjct  227  SRIVIVDNNPFSFLLQPLNGIPCVPFSAGQPQDEQLLEVILPLLKHLSLQKDVRPMLYEK  286

Query  427  FHMPEWFQKHGIPASRAMNEG  365
            FHMPEWFQKHGIPA    N G
Sbjct  287  FHMPEWFQKHGIPALEWTNIG  307



>ref|XP_006338842.1| PREDICTED: CTD small phosphatase-like protein 2-like [Solanum 
tuberosum]
Length=313

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 130/141 (92%), Gaps = 1/141 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ELS+FA+LVLFTAGLEGYARP+VDK+DV + F  RLYRPST STEYREHVKDL CISKDL
Sbjct  173  ELSEFANLVLFTAGLEGYARPLVDKIDVGNRFSLRLYRPSTISTEYREHVKDLLCISKDL  232

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR+V+VDNNPFSFLLQPLNGIPC+PFSAGQPHD QLLEVILPLL+HLS+QKDVRPVLY+ 
Sbjct  233  SRMVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDIQLLEVILPLLKHLSKQKDVRPVLYDR  292

Query  427  FHMPEWFQKHGIPASRAMNEG  365
            FHMPEWFQKHGIPAS A+  G
Sbjct  293  FHMPEWFQKHGIPAS-ALTSG  312



>ref|XP_011035940.1| PREDICTED: CTD nuclear envelope phosphatase 1 [Populus euphratica]
Length=294

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F  RLYRPST+STEYREHVKDLSCISKD 
Sbjct  157  QLSEFAELVLFTAGLEGYARPLVDRIDTENRFSLRLYRPSTSSTEYREHVKDLSCISKDP  216

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPCVPFSAGQPHD QLL+V+LPLL+ LSQQKDVRPVLYE 
Sbjct  217  CRIVIVDNNPFSFLLQPLNGIPCVPFSAGQPHDTQLLDVLLPLLKQLSQQKDVRPVLYER  276

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIPAS
Sbjct  277  FHMPEWFQKQGIPAS  291



>ref|XP_006378658.1| hypothetical protein POPTR_0010s19580g [Populus trichocarpa]
 gb|ERP56455.1| hypothetical protein POPTR_0010s19580g [Populus trichocarpa]
Length=294

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F  RLYRPST+STEYREHVKDLSCISKD 
Sbjct  157  QLSEFAELVLFTAGLEGYARPLVDRIDTENRFSLRLYRPSTSSTEYREHVKDLSCISKDP  216

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPCVPFSAGQPHD QLL+V+LPLL+ LSQQKDVRPVLYE 
Sbjct  217  CRIVIVDNNPFSFLLQPLNGIPCVPFSAGQPHDTQLLDVLLPLLKQLSQQKDVRPVLYER  276

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIPAS
Sbjct  277  FHMPEWFQKQGIPAS  291



>emb|CAN64082.1| hypothetical protein VITISV_006933 [Vitis vinifera]
Length=208

 Score =   213 bits (541),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+F++LVLFTAGLEGYARP+VD++DV++LF  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  70   QLSEFSELVLFTAGLEGYARPLVDRIDVENLFSLRLYRPSTISTEYREHVKDLSCLSKDL  129

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNG+PC+PFSAGQP+D QLLEV+LPLL+HLSQQ DVRPVLY+ 
Sbjct  130  CRIVIVDNNPFSFLLQPLNGVPCIPFSAGQPNDGQLLEVLLPLLKHLSQQNDVRPVLYDR  189

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWFQKHGIPAS
Sbjct  190  FRMPEWFQKHGIPAS  204



>emb|CDP14017.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  172  QLSEFANLVLFTAGLEGYARPLVDRIDAENRFSLRLYRPSTISTEYREHVKDLSCVSKDL  231

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R+V+VDNNPFSFLLQPLNGIPC+PFSAGQP DEQLLEVILPLL+HLSQQKDVRPVLYE 
Sbjct  232  CRMVIVDNNPFSFLLQPLNGIPCIPFSAGQPQDEQLLEVILPLLKHLSQQKDVRPVLYER  291

Query  427  FHMPEWFQKHGIPASRAMN  371
            FHMPEWFQ+HGIPAS   N
Sbjct  292  FHMPEWFQRHGIPASWWAN  310



>ref|XP_011076695.1| PREDICTED: CTD small phosphatase-like protein [Sesamum indicum]
Length=382

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++DVD+ F  RLYRPST STEYREHVKDLSC+SKD 
Sbjct  245  QLSEFADLVLFTAGLEGYARPLVDRIDVDNRFSRRLYRPSTISTEYREHVKDLSCLSKDF  304

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPC+PFS GQPHD QL+EVILPLL+HLS QKDVRPVLYE 
Sbjct  305  CRIVIVDNNPFSFLLQPLNGIPCIPFSPGQPHDVQLMEVILPLLKHLSLQKDVRPVLYER  364

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+KHGIPAS
Sbjct  365  FHMPEWFRKHGIPAS  379



>gb|EYU20007.1| hypothetical protein MIMGU_mgv1a010325mg [Erythranthe guttata]
Length=316

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VDKLD  + F  RLYRPSTTSTEYREHVKDLS +SKD 
Sbjct  178  QLSEFADLVLFTAGLEGYARPLVDKLDGGNRFSRRLYRPSTTSTEYREHVKDLSSLSKDF  237

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPC+PFS GQPHDEQLLEVILPLL+HLS QKDVRPVLYE 
Sbjct  238  CRIVIVDNNPFSFLLQPLNGIPCIPFSPGQPHDEQLLEVILPLLKHLSLQKDVRPVLYER  297

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQKHGIPAS
Sbjct  298  FHMPEWFQKHGIPAS  312



>ref|XP_002273682.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Vitis vinifera]
 emb|CBI25474.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+F++LVLFTAGLEGYARP+VD++DV++LF  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  180  QLSEFSELVLFTAGLEGYARPLVDRIDVENLFSLRLYRPSTISTEYREHVKDLSCLSKDL  239

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNG+PC+PFSAGQP+D QLLEV+LPLL+HLSQQ DVRPVLY+ 
Sbjct  240  CRIVIVDNNPFSFLLQPLNGVPCIPFSAGQPNDGQLLEVLLPLLKHLSQQNDVRPVLYDR  299

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWFQKHGIPAS
Sbjct  300  FRMPEWFQKHGIPAS  314



>ref|XP_009622999.1| PREDICTED: CTD small phosphatase-like protein 2 [Nicotiana tomentosiformis]
Length=304

 Score =   211 bits (537),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VDK+D ++ F HRLYRPST STE+REHVKDLS ISKDL
Sbjct  166  QLSEFANLVLFTAGLEGYARPLVDKIDPENWFSHRLYRPSTISTEFREHVKDLSSISKDL  225

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPC+PFS GQPHDEQLLEVILPLL+HLS+QKDVRPVL+E 
Sbjct  226  CRIVIVDNNPFSFLLQPLNGIPCIPFSPGQPHDEQLLEVILPLLKHLSEQKDVRPVLHER  285

Query  427  FHMPEWFQKHGIPASRAMN  371
            F MPEWFQ HGIPA R M+
Sbjct  286  FQMPEWFQNHGIPAYRFMD  304



>ref|XP_006355653.1| PREDICTED: CTD small phosphatase-like protein 2-like [Solanum 
tuberosum]
Length=317

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARPVVDK+D+++LF HRLYRPST STE+REHVKDLSCIS+DL
Sbjct  177  QLSEFANLVLFTAGLEGYARPVVDKIDLENLFSHRLYRPSTISTEFREHVKDLSCISEDL  236

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R+V+VDNNPFSFLLQPLNGIPC+ FS GQPHD QLLE ILPLL+HLS+QKDVRPVL E 
Sbjct  237  CRVVIVDNNPFSFLLQPLNGIPCISFSPGQPHDNQLLEEILPLLKHLSEQKDVRPVLRER  296

Query  427  FHMPEWFQKHGIPASRAMN  371
            F MPEWFQ HGIP     N
Sbjct  297  FQMPEWFQNHGIPTCEFTN  315



>ref|XP_010264631.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Nelumbo 
nucifera]
Length=309

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            + S+FADLVLFTAGLEGYARP+VD++DV+  F  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  171  QTSEFADLVLFTAGLEGYARPLVDRIDVEKRFSLRLYRPSTISTEYREHVKDLSCLSKDL  230

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPC+PFSAGQP+DEQLLEV+LPLL+HLS QKDVRPVLYE 
Sbjct  231  CRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPYDEQLLEVLLPLLKHLSLQKDVRPVLYER  290

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQKHGIP S
Sbjct  291  FHMPEWFQKHGIPTS  305



>gb|KDO68952.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
 gb|KDO68953.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=300

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADL+LFTAGLEGYARP+VD++D ++LF  RLYRPSTTSTEYREHVKDLSC+SKDL
Sbjct  164  QLSEFADLILFTAGLEGYARPLVDRIDGENLFSLRLYRPSTTSTEYREHVKDLSCLSKDL  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R ++VDNNPFSFLLQPLNGIPC+PFSAGQPHD QLL V+LPLL+HLS QKDVRP LYE 
Sbjct  224  CRTLIVDNNPFSFLLQPLNGIPCIPFSAGQPHDNQLLNVLLPLLKHLSLQKDVRPELYER  283

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIP S
Sbjct  284  FHMPEWFQKQGIPTS  298



>ref|XP_007008962.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY17772.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 1 [Theobroma cacao]
Length=310

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  172  QLSEFAELVLFTAGLEGYARPLVDRIDAENRFSLRLYRPSTISTEYREHVKDLSCLSKDL  231

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQPLNGIPC+PFSAGQPHD QLL+V+LPLL+HLSQQKDVR VLYE 
Sbjct  232  CRTVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDTQLLDVLLPLLKHLSQQKDVRSVLYER  291

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWFQK GIPAS
Sbjct  292  FRMPEWFQKQGIPAS  306



>ref|XP_006435743.1| hypothetical protein CICLE_v10031856mg [Citrus clementina]
 ref|XP_006486313.1| PREDICTED: CTD small phosphatase-like protein-like [Citrus sinensis]
 gb|ESR48983.1| hypothetical protein CICLE_v10031856mg [Citrus clementina]
Length=375

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADL+LFTAGLEGYARP+VD++D ++LF  RLYRPSTTSTEYREHVKDLSC+SKDL
Sbjct  239  QLSEFADLILFTAGLEGYARPLVDRIDGENLFSLRLYRPSTTSTEYREHVKDLSCLSKDL  298

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQPLNGIPC+PFSAGQPHD QLL V+LPLL+HLS QKDVRP LYE 
Sbjct  299  CRTVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDNQLLNVLLPLLKHLSLQKDVRPELYER  358

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIP S
Sbjct  359  FHMPEWFQKQGIPTS  373



>gb|KDP44760.1| hypothetical protein JCGZ_01260 [Jatropha curcas]
Length=297

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+F+DLVLFTAGLEGYA+P+VDK+D D+LF  RLYRPST STEYREHVKDLSC+SKD 
Sbjct  159  KLSEFSDLVLFTAGLEGYAKPLVDKIDTDNLFSLRLYRPSTISTEYREHVKDLSCLSKDP  218

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQPLNGIPCVPFSAGQP+D QL++V+LPLL+HLS+QKDVRPVLYE 
Sbjct  219  CRTVIVDNNPFSFLLQPLNGIPCVPFSAGQPYDTQLMDVLLPLLKHLSEQKDVRPVLYER  278

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWFQK GIPAS
Sbjct  279  FRMPEWFQKQGIPAS  293



>gb|KHN20843.1| CTD small phosphatase-like protein 2 [Glycine soja]
Length=306

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FAD+VLFTAGLEGYARP+VD++DV++ F  RLYRPST STEYREHVKDL+CISKDL
Sbjct  168  QLSEFADMVLFTAGLEGYARPLVDRIDVENRFSLRLYRPSTISTEYREHVKDLTCISKDL  227

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSF+LQP+NGIPC+PFSAGQPHD QLL+VILPLL+ LS+Q DVRP LYE 
Sbjct  228  CRIVIVDNNPFSFVLQPVNGIPCIPFSAGQPHDTQLLDVILPLLKQLSEQNDVRPFLYEK  287

Query  427  FHMPEWFQKHGIPAS  383
            FHMP+WFQK GIPAS
Sbjct  288  FHMPDWFQKQGIPAS  302



>ref|XP_009616349.1| PREDICTED: uncharacterized protein C2F7.02c-like [Nicotiana tomentosiformis]
Length=251

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VDK+D ++ F HRLYRPST STE+REHVKDLS IS DL
Sbjct  113  QLSEFANLVLFTAGLEGYARPLVDKMDPENWFSHRLYRPSTISTEFREHVKDLSSISTDL  172

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPC+PFS GQPHDEQLLEVILPLL+HLS+QKDVRPVL+E 
Sbjct  173  CRIVIVDNNPFSFLLQPLNGIPCIPFSPGQPHDEQLLEVILPLLKHLSEQKDVRPVLHER  232

Query  427  FHMPEWFQKHGIPASRAMN  371
            F MPEWFQ HGIPA R M+
Sbjct  233  FQMPEWFQNHGIPAYRFMD  251



>ref|XP_010922553.1| PREDICTED: CTD small phosphatase-like protein 2 [Elaeis guineensis]
Length=302

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S+FADLVLFTAGLEGYARP+VD++DV++ F  RLYRP+T STEYREHVKDL+C+SKDL
Sbjct  164  QISEFADLVLFTAGLEGYARPLVDRIDVENRFSLRLYRPATVSTEYREHVKDLTCLSKDL  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR V+VDNNPFSFLLQP NGIPCVPFSAGQP+DEQL+ V+ PLL+HLS QKDVRPVLYE 
Sbjct  224  SRTVIVDNNPFSFLLQPSNGIPCVPFSAGQPYDEQLMGVVFPLLKHLSLQKDVRPVLYER  283

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQKHGIP S
Sbjct  284  FHMPEWFQKHGIPPS  298



>ref|XP_008463241.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Cucumis melo]
Length=297

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            L  FADLVLFTAGLEGYARP+VD++D ++ F  RLYRPST STEYR+HVKDLSC+SKDL 
Sbjct  162  LGGFADLVLFTAGLEGYARPLVDRIDEENRFSLRLYRPSTISTEYRDHVKDLSCLSKDLR  221

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            RIV+VDNNPFSFLLQPLNGIPC+PFSAGQPHD QLL+VILPLLEHLSQQ DVRPVLYE F
Sbjct  222  RIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDSQLLDVILPLLEHLSQQNDVRPVLYERF  281

Query  424  HMPEWFQKHGIPA  386
            HMPEWFQKHGIP 
Sbjct  282  HMPEWFQKHGIPT  294



>ref|XP_009369172.1| PREDICTED: probable C-terminal domain small phosphatase [Pyrus 
x bretschneideri]
 ref|XP_009369173.1| PREDICTED: probable C-terminal domain small phosphatase [Pyrus 
x bretschneideri]
Length=300

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S+FA+LVLFTAGLEGYARP+VD++DVD+LF +RLYRPSTTSTEYREHVKDLS +SKD+
Sbjct  163  QVSQFAELVLFTAGLEGYARPLVDRIDVDNLFSYRLYRPSTTSTEYREHVKDLSGLSKDM  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPC+PFSAGQ HD+QLL+V+LPLL+ LS QKDVRP LYE 
Sbjct  223  RRIVIVDNNPFSFLLQPLNGIPCIPFSAGQTHDKQLLDVLLPLLKQLSLQKDVRPALYER  282

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIP++
Sbjct  283  FHMPEWFQKQGIPST  297



>gb|KHN48568.1| CTD small phosphatase-like protein 2 [Glycine soja]
Length=304

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FAD+VLFTAGLEGYARP+VD++DV++ F  RLYRPST STEYREHVKDL+CISKDL
Sbjct  166  QLSEFADMVLFTAGLEGYARPLVDRIDVENRFCLRLYRPSTISTEYREHVKDLTCISKDL  225

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSF+LQP+NGIPC+PFSAGQPHD QLL+VILPLL+ LS++ D+RP+LYE 
Sbjct  226  CRIVIVDNNPFSFVLQPVNGIPCIPFSAGQPHDTQLLDVILPLLKQLSERNDIRPLLYEK  285

Query  427  FHMPEWFQKHGIPAS  383
            FHMP+WFQK GIPAS
Sbjct  286  FHMPDWFQKQGIPAS  300



>ref|XP_008345306.1| PREDICTED: probable C-terminal domain small phosphatase [Malus 
domestica]
Length=298

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S+FA+LVLFTAGLEGYARP+VD++DVD+LF +RLYRPSTTSTEYREHVKDLS +SKD+
Sbjct  161  QVSQFAELVLFTAGLEGYARPLVDRIDVDNLFSYRLYRPSTTSTEYREHVKDLSGLSKDM  220

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPC+PFSAGQ HD+QLL+V+LPLL+ LS QKDVRP LYE 
Sbjct  221  RRIVIVDNNPFSFLLQPLNGIPCIPFSAGQTHDKQLLDVLLPLLKQLSLQKDVRPALYER  280

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIP++
Sbjct  281  FHMPEWFQKQGIPST  295



>ref|XP_006429395.1| hypothetical protein CICLE_v10012210mg [Citrus clementina]
 gb|ESR42635.1| hypothetical protein CICLE_v10012210mg [Citrus clementina]
Length=321

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L++FADLVLFTAGLEGYARP+VDK+D ++LF  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  183  KLAEFADLVLFTAGLEGYARPLVDKIDRENLFSLRLYRPSTVSTEYREHVKDLSCLSKDL  242

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R+V+VDNNPFSFLLQPLNGIPC+PFS GQP+D QLLEV+LPLL HLS QKDVRPVL+E 
Sbjct  243  CRVVLVDNNPFSFLLQPLNGIPCIPFSTGQPYDNQLLEVLLPLLNHLSLQKDVRPVLHER  302

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQ HGIPAS
Sbjct  303  FHMPEWFQMHGIPAS  317



>ref|XP_010689631.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=312

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADL+LFTAGLEGYARP+VD++D D+ F  RLYRPSTTSTEYR+HVKDLSCIS++L
Sbjct  174  QLSEFADLILFTAGLEGYARPLVDRIDADNRFSRRLYRPSTTSTEYRDHVKDLSCISQEL  233

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R+V+VDNNPFSFLLQPLNGIPCVPFSAGQPHD+QLLEV+LP+L+HLS Q DVRP+LYE 
Sbjct  234  CRVVIVDNNPFSFLLQPLNGIPCVPFSAGQPHDDQLLEVLLPILKHLSLQDDVRPILYEK  293

Query  427  FHMPEWFQKHGI  392
            FHMPEWFQKHGI
Sbjct  294  FHMPEWFQKHGI  305



>ref|XP_006481044.1| PREDICTED: CTD small phosphatase-like protein-like [Citrus sinensis]
Length=321

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L++FADLVLFTAGLEGYARP+VDK+D ++LF  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  183  KLAEFADLVLFTAGLEGYARPLVDKIDRENLFSLRLYRPSTVSTEYREHVKDLSCLSKDL  242

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R+V+VDNNPFSFLLQPLNGIPC+PFS GQP+D QLLEV+LPLL HLS QKDVRPVL+E 
Sbjct  243  CRVVLVDNNPFSFLLQPLNGIPCIPFSTGQPYDNQLLEVLLPLLNHLSLQKDVRPVLHER  302

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQ HGIPAS
Sbjct  303  FHMPEWFQMHGIPAS  317



>gb|KDO56645.1| hypothetical protein CISIN_1g020937mg [Citrus sinensis]
Length=319

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L++FADLVLFTAGLEGYARP+VDK+D ++LF  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  181  KLAEFADLVLFTAGLEGYARPLVDKIDRENLFSLRLYRPSTVSTEYREHVKDLSCLSKDL  240

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R+V+VDNNPFSFLLQPLNGIPC+PFS GQP+D QLLEV+LPLL HLS QKDVRPVL+E 
Sbjct  241  CRVVLVDNNPFSFLLQPLNGIPCIPFSTGQPYDNQLLEVLLPLLNHLSLQKDVRPVLHER  300

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQ HGIPAS
Sbjct  301  FHMPEWFQMHGIPAS  315



>gb|KJB78769.1| hypothetical protein B456_013G018000 [Gossypium raimondii]
Length=302

 Score =   208 bits (529),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F  RLYRPST STEYREHVKDL+CISKDL
Sbjct  164  QLSEFAELVLFTAGLEGYARPLVDRIDAENRFSLRLYRPSTVSTEYREHVKDLTCISKDL  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP+NGIPC+PFSAGQPHD QLL V+LPLL+HLSQ+KDVRPVLY+ 
Sbjct  224  CRTVIVDNNPFSFLLQPVNGIPCIPFSAGQPHDTQLLGVLLPLLKHLSQEKDVRPVLYDR  283

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWFQK GIP+S
Sbjct  284  FRMPEWFQKQGIPSS  298



>ref|XP_010067527.1| PREDICTED: CTD small phosphatase-like protein [Eucalyptus grandis]
 gb|KCW65680.1| hypothetical protein EUGRSUZ_G03062 [Eucalyptus grandis]
Length=289

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L +FADLVLFTAGLEGYA+P+VD +DV++ F  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  151  QLHEFADLVLFTAGLEGYAKPLVDTIDVENRFSLRLYRPSTISTEYREHVKDLSCLSKDL  210

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SRIV+VDNNPFSFLLQP+NGIPC+PF+AGQPHD QLLEV++PLL+HLS Q+DVRPVLYE 
Sbjct  211  SRIVIVDNNPFSFLLQPVNGIPCIPFTAGQPHDNQLLEVLVPLLKHLSMQRDVRPVLYER  270

Query  427  FHMPEWFQKHGIPA  386
            F MPEWFQK+GIPA
Sbjct  271  FRMPEWFQKYGIPA  284



>ref|XP_004239942.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Solanum lycopersicum]
Length=318

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARPVVDK+D+++LF HRLYRPST STE+REHVKDLSCIS+DL
Sbjct  178  QLSEFANLVLFTAGLEGYARPVVDKIDLENLFSHRLYRPSTISTEFREHVKDLSCISEDL  237

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R+V+VDNNPFSFLLQPLNGIPC+ FS GQP+D QLLE ILPLL+HLS+QKDVRPVL E 
Sbjct  238  CRVVIVDNNPFSFLLQPLNGIPCISFSPGQPYDNQLLEEILPLLKHLSEQKDVRPVLRER  297

Query  427  FHMPEWFQKHGIPASRAMN  371
            F MPEWFQ HGIP     N
Sbjct  298  FQMPEWFQNHGIPTCEFTN  316



>ref|XP_008805431.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Phoenix dactylifera]
Length=301

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S FADLVLFTAGLEGYARP+VD++D+++ F  RLYRP+T STEYREHVKDL+C+SKDL
Sbjct  163  QISDFADLVLFTAGLEGYARPLVDRIDIENRFSLRLYRPATVSTEYREHVKDLTCLSKDL  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQPLNGIPCVPFSAGQP+DEQL+ V+ PLL+HLS QKDVRPVL+E 
Sbjct  223  CRTVLVDNNPFSFLLQPLNGIPCVPFSAGQPYDEQLMAVVFPLLKHLSLQKDVRPVLHER  282

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQKHGIP S
Sbjct  283  FHMPEWFQKHGIPPS  297



>ref|NP_001242244.1| uncharacterized protein LOC100783451 [Glycine max]
 gb|ACU20842.1| unknown [Glycine max]
Length=304

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FAD+ LFTAGLEGYARP+VD++DV++ F  RLYRPST STEYREHVKDL+CISKDL
Sbjct  166  QLSEFADMALFTAGLEGYARPLVDRIDVENRFCLRLYRPSTISTEYREHVKDLTCISKDL  225

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSF+LQP+NGIPC+PFSAGQPHD QLL+VILPLL+ LS++ D+RP+LYE 
Sbjct  226  CRIVIVDNNPFSFVLQPVNGIPCIPFSAGQPHDTQLLDVILPLLKQLSERNDIRPLLYEK  285

Query  427  FHMPEWFQKHGIPAS  383
            FHMP+WFQK GIPAS
Sbjct  286  FHMPDWFQKQGIPAS  300



>ref|XP_003545230.1| PREDICTED: LOW QUALITY PROTEIN: carboxy-terminal domain RNA polymerase 
II polypeptide A small phosphatase 2-like [Glycine 
max]
Length=393

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FAD+VLFTAGLEGYARP+VD++DV++ F  RLYRPST STEYREHVKDL+CISKDL
Sbjct  255  QLSEFADMVLFTAGLEGYARPLVDRIDVENRFSLRLYRPSTISTEYREHVKDLTCISKDL  314

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSF+LQP+NGIPC+PFSAGQPHD QLL+VILPLL+ LS+Q DVRP LYE 
Sbjct  315  CRIVIVDNNPFSFVLQPVNGIPCIPFSAGQPHDTQLLDVILPLLKQLSEQNDVRPFLYEK  374

Query  427  FHMPEWFQKHGIPAS  383
            FHMP+WFQK GIPAS
Sbjct  375  FHMPDWFQKQGIPAS  389



>gb|KDO68954.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=285

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 110/135 (81%), Gaps = 15/135 (11%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADL+LFTAGLEGYARP+VD++D ++LF  RLYRPSTTSTEYREHVKDLSC+SKDL
Sbjct  164  QLSEFADLILFTAGLEGYARPLVDRIDGENLFSLRLYRPSTTSTEYREHVKDLSCLSKDL  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R ++VDNNPFSFLLQPLNGIPC+PFSAGQPHD                QKDVRP LYE 
Sbjct  224  CRTLIVDNNPFSFLLQPLNGIPCIPFSAGQPHD---------------NQKDVRPELYER  268

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIP S
Sbjct  269  FHMPEWFQKQGIPTS  283



>ref|XP_011046823.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Populus 
euphratica]
Length=295

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VDK+D ++ F  RLYRPSTTSTEY+EHVKDLSCIS D 
Sbjct  158  QLSEFAELVLFTAGLEGYARPLVDKIDAENRFSLRLYRPSTTSTEYQEHVKDLSCISNDP  217

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPCVPFSAGQPHD QLL+V+LPLL+HLSQQ DVRPVL E 
Sbjct  218  CRIVIVDNNPFSFLLQPLNGIPCVPFSAGQPHDTQLLDVLLPLLKHLSQQNDVRPVLSER  277

Query  427  FHMPEWFQKHGIPAS  383
            FHM EWFQK GIPAS
Sbjct  278  FHMLEWFQKQGIPAS  292



>ref|XP_007141764.1| hypothetical protein PHAVU_008G223800g [Phaseolus vulgaris]
 gb|ESW13758.1| hypothetical protein PHAVU_008G223800g [Phaseolus vulgaris]
Length=303

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F  RLYRPST STEYREHVKDL+CISKDL
Sbjct  165  KLSEFANLVLFTAGLEGYARPLVDRIDAENRFSLRLYRPSTISTEYREHVKDLTCISKDL  224

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSF+LQP+NGIPC+PFSAGQPHD QLL+VILPLL+ LS+  DVRP+LYE 
Sbjct  225  CRIVIVDNNPFSFVLQPVNGIPCIPFSAGQPHDTQLLDVILPLLKQLSELNDVRPLLYEK  284

Query  427  FHMPEWFQKHGIPAS  383
            FHMP+WFQK GIPAS
Sbjct  285  FHMPDWFQKQGIPAS  299



>ref|XP_004149232.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 ref|XP_004172125.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 gb|KGN50658.1| hypothetical protein Csa_5G203410 [Cucumis sativus]
Length=297

 Score =   206 bits (523),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            L  FADLVLFTAGLEGYARP+VD++D ++ F  RLYRPST STEYR+HVKDLSC+SKDL 
Sbjct  162  LGGFADLVLFTAGLEGYARPLVDRIDEENRFSLRLYRPSTISTEYRDHVKDLSCLSKDLR  221

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            R+V+VDNNPFSFLLQP NGIPC+PFSAGQPHD QLL+VILPLLEHLSQQ DVRPVLYE F
Sbjct  222  RVVIVDNNPFSFLLQPQNGIPCIPFSAGQPHDSQLLDVILPLLEHLSQQNDVRPVLYERF  281

Query  424  HMPEWFQKHGIPA  386
            HMPEWFQKHGIP 
Sbjct  282  HMPEWFQKHGIPT  294



>ref|XP_002309143.2| hypothetical protein POPTR_0006s10170g [Populus trichocarpa]
 gb|EEE92666.2| hypothetical protein POPTR_0006s10170g [Populus trichocarpa]
Length=325

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++ +FADL+LFTAGLEGYARP+ D++DV++ F  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  187  QIGEFADLILFTAGLEGYARPLFDRIDVENQFSQRLYRPSTVSTEYREHVKDLSCLSKDL  246

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR+V+VDNNPFSFLLQPLNGIPCVPFSA  P+DEQLL+V+LPLL++LS QKDVRPVLYE 
Sbjct  247  SRVVIVDNNPFSFLLQPLNGIPCVPFSARLPYDEQLLDVLLPLLKNLSLQKDVRPVLYER  306

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQ HGIPAS
Sbjct  307  FHMPEWFQMHGIPAS  321



>ref|XP_009344958.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Pyrus x bretschneideri]
Length=301

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S+FA+LVLFTAGLEGYARP+VD++DVD+LF  RLYRPSTTSTEYREHVKDLS +SKD+
Sbjct  164  QVSQFAELVLFTAGLEGYARPLVDRIDVDNLFSCRLYRPSTTSTEYREHVKDLSGLSKDM  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQP NGIPC+PFSAGQ HD QLL+V+LPLL+ LS QKDVRP LYE 
Sbjct  224  RRIVIVDNNPFSFLLQPSNGIPCIPFSAGQTHDTQLLDVLLPLLKQLSLQKDVRPALYER  283

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIP++
Sbjct  284  FHMPEWFQKQGIPST  298



>gb|KJB74327.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=308

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F HRLYRPST  TE+REHVKDLSC+SK+L
Sbjct  170  QLSEFAELVLFTAGLEGYARPLVDRIDAENRFSHRLYRPSTICTEFREHVKDLSCLSKNL  229

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQPLNGIPC+PFSAGQPHD QLL+V+LPLL+HLS QKDVRP LY+ 
Sbjct  230  CRTVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDTQLLDVLLPLLKHLSLQKDVRPFLYDR  289

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIP+S
Sbjct  290  FHMPEWFQKQGIPSS  304



>ref|XP_002528087.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34266.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S+FADLVLFTAGLEGYARP+VD++D ++ F  RLYRPST STEYREH+KDLSC+SKDL
Sbjct  141  QISEFADLVLFTAGLEGYARPIVDRIDTENRFSLRLYRPSTISTEYREHMKDLSCLSKDL  200

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VD+NPFSFLLQPLNGIPC+PFSAGQP+D QLL+V+LPLL+HLS QKDVRPVL E 
Sbjct  201  CRIVIVDDNPFSFLLQPLNGIPCMPFSAGQPYDNQLLDVLLPLLKHLSLQKDVRPVLLEM  260

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQ +GIPAS
Sbjct  261  FHMPEWFQMNGIPAS  275



>ref|XP_008374036.1| PREDICTED: CTD small phosphatase-like protein [Malus domestica]
Length=301

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S+FA+LVLFTAGLEGYARP+VD++DVD+LF  RLYRPSTTSTEYREHVKDLS +SKD+
Sbjct  164  QVSQFAELVLFTAGLEGYARPLVDRIDVDNLFSCRLYRPSTTSTEYREHVKDLSGLSKDM  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQP NGIPC+PFSAGQ HD QLL+V+LPLL+ LS QKDVRP LYE 
Sbjct  224  RRIVIVDNNPFSFLLQPSNGIPCIPFSAGQTHDTQLLDVLLPLLKQLSLQKDVRPALYER  283

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIP++
Sbjct  284  FHMPEWFQKQGIPSN  298



>ref|XP_009385548.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=313

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S+FADLVLFTAGLE YARP+VDK+DV++ F  RLYRP+T STEYR+HVKDLSC+SKDL
Sbjct  164  QISEFADLVLFTAGLEDYARPLVDKIDVENRFSLRLYRPATVSTEYRDHVKDLSCLSKDL  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR V+VDNNPFSFLLQPLNGIPCVPFSAGQP+DEQL+ VILPLL+HLS +KDVRP LYE 
Sbjct  224  SRTVIVDNNPFSFLLQPLNGIPCVPFSAGQPYDEQLMGVILPLLKHLSVEKDVRPALYER  283

Query  427  FHMPEWFQKHGIPASRAMNEG  365
            FHMPEWFQ HGI +S   + G
Sbjct  284  FHMPEWFQNHGIHSSDGTSLG  304



>ref|XP_004307664.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Fragaria 
vesca subsp. vesca]
Length=297

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  775  FADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIV  596
            FADLVLFTAGLEGYARP+VD++DV++ F  RLYRPSTTSTEYREHVKDLS +SKDL RIV
Sbjct  164  FADLVLFTAGLEGYARPLVDRIDVENRFSFRLYRPSTTSTEYREHVKDLSGLSKDLGRIV  223

Query  595  MVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFHMP  416
            +VDNNPFSFLLQPLNGIPC+PFSAGQ HD QLL+V+LPLL+HLS QKDVRPVLYE FHMP
Sbjct  224  LVDNNPFSFLLQPLNGIPCIPFSAGQLHDTQLLDVLLPLLKHLSLQKDVRPVLYERFHMP  283

Query  415  EWFQKHGIPAS  383
            EWFQK GIP++
Sbjct  284  EWFQKQGIPST  294



>gb|KHG26952.1| ctdspl2 [Gossypium arboreum]
Length=302

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F  RLYRPST STEYREHVKDL+CI KDL
Sbjct  164  QLSEFAELVLFTAGLEGYARPLVDRIDAENRFSLRLYRPSTVSTEYREHVKDLTCIFKDL  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP+NGIPC+PFSAGQPHD QLL V+LPLL+HLSQ+KDVRPVLY+ 
Sbjct  224  CRTVIVDNNPFSFLLQPVNGIPCIPFSAGQPHDTQLLGVLLPLLKHLSQEKDVRPVLYDR  283

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWFQK GIP+S
Sbjct  284  FRMPEWFQKQGIPSS  298



>tpg|DAA56990.1| TPA: hypothetical protein ZEAMMB73_478385 [Zea mays]
Length=171

 Score =   199 bits (507),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD++DV + F  RLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  35   SEFADLILFTAGLEGYARPLVDRIDVHNRFRLRLYRPSTVTTEYREHVKDLSCVSKDFGR  94

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF+LQPLNGIPCVPFSAGQ  D+QL+ VI PLL+HLS QKDVRPVL+E FH
Sbjct  95   IVIVDNNPFSFILQPLNGIPCVPFSAGQHSDDQLMMVIFPLLKHLSLQKDVRPVLHERFH  154

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  155  MPEWFQKHGIPQT  167



>ref|XP_011019112.1| PREDICTED: CTD small phosphatase-like protein isoform X3 [Populus 
euphratica]
Length=281

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++ +FADL+LFTAGLEGYARP+ D++DV++ F  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  143  QIGEFADLILFTAGLEGYARPLFDRIDVENRFSQRLYRPSTVSTEYREHVKDLSCLSKDL  202

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR+V+VDNNPFSFLLQPLNGIPCVPFSA  P+DEQLL+V+LPLL++LS QKDVRPVLYE 
Sbjct  203  SRVVIVDNNPFSFLLQPLNGIPCVPFSARLPYDEQLLDVLLPLLKNLSLQKDVRPVLYER  262

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWFQ HGIPAS
Sbjct  263  FRMPEWFQMHGIPAS  277



>ref|XP_008805436.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Phoenix dactylifera]
Length=291

 Score =   203 bits (516),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 114/135 (84%), Gaps = 10/135 (7%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S FADLVLFTAGLEGYARP+VD++D+++ F  RLYRP+T STEYREHVKDL+C+SKDL
Sbjct  163  QISDFADLVLFTAGLEGYARPLVDRIDIENRFSLRLYRPATVSTEYREHVKDLTCLSKDL  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQPLNGIPCVPFSAGQP+D           +HLS QKDVRPVL+E 
Sbjct  223  CRTVLVDNNPFSFLLQPLNGIPCVPFSAGQPYD----------EQHLSLQKDVRPVLHER  272

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQKHGIP S
Sbjct  273  FHMPEWFQKHGIPPS  287



>ref|XP_011019111.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Populus euphratica]
Length=323

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++ +FADL+LFTAGLEGYARP+ D++DV++ F  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  185  QIGEFADLILFTAGLEGYARPLFDRIDVENRFSQRLYRPSTVSTEYREHVKDLSCLSKDL  244

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR+V+VDNNPFSFLLQPLNGIPCVPFSA  P+DEQLL+V+LPLL++LS QKDVRPVLYE 
Sbjct  245  SRVVIVDNNPFSFLLQPLNGIPCVPFSARLPYDEQLLDVLLPLLKNLSLQKDVRPVLYER  304

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWFQ HGIPAS
Sbjct  305  FRMPEWFQMHGIPAS  319



>ref|XP_011019110.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Populus euphratica]
Length=324

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++ +FADL+LFTAGLEGYARP+ D++DV++ F  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  186  QIGEFADLILFTAGLEGYARPLFDRIDVENRFSQRLYRPSTVSTEYREHVKDLSCLSKDL  245

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR+V+VDNNPFSFLLQPLNGIPCVPFSA  P+DEQLL+V+LPLL++LS QKDVRPVLYE 
Sbjct  246  SRVVIVDNNPFSFLLQPLNGIPCVPFSARLPYDEQLLDVLLPLLKNLSLQKDVRPVLYER  305

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWFQ HGIPAS
Sbjct  306  FRMPEWFQMHGIPAS  320



>ref|XP_010920860.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Elaeis guineensis]
Length=303

 Score =   203 bits (516),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++SKFA+LVLFTAGLEGYA P+VD++DVD+ F  RLYR ST STEYREHVKDLSC+SKDL
Sbjct  165  QISKFANLVLFTAGLEGYASPLVDRIDVDNKFSLRLYRSSTVSTEYREHVKDLSCMSKDL  224

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPC+PFSAGQP DEQL+ V+LPLL+HLS Q+DVRP+LYE 
Sbjct  225  CRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPCDEQLMGVLLPLLKHLSIQRDVRPILYEK  284

Query  427  FHMPEWFQKHGIP  389
            FHMPEWF++HGIP
Sbjct  285  FHMPEWFRQHGIP  297



>gb|AFK34480.1| unknown [Lotus japonicus]
Length=292

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D D+LF  RLYRPST STE+REHVKDL+CISKDL
Sbjct  157  QLSEFADLVLFTAGLEGYARPLVDRIDSDNLFSLRLYRPSTISTEHREHVKDLTCISKDL  216

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQP NGIPC+ FSAGQP D QLL+VILPLL+HLS +KDVR VLYE 
Sbjct  217  CRIVIVDNNPFSFLLQPDNGIPCISFSAGQPCDTQLLDVILPLLKHLSAEKDVRHVLYEQ  276

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIPAS
Sbjct  277  FHMPEWFQKQGIPAS  291



>ref|XP_009377758.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Pyrus x bretschneideri]
Length=297

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            + +FADLVLFTAGLE YARP+VD++DV++LF  RLYRPST STE+REHVKDLSC+SKD S
Sbjct  163  VCEFADLVLFTAGLEDYARPLVDRIDVENLFKLRLYRPSTVSTEFREHVKDLSCLSKDFS  222

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            RIV+VDNNPFSFLLQPLNGIPCVPFSAGQP+D+QLLEV+ PLL+ LS QKDVRP+L+E F
Sbjct  223  RIVIVDNNPFSFLLQPLNGIPCVPFSAGQPYDDQLLEVLHPLLKQLSLQKDVRPMLHERF  282

Query  424  HMPEWFQKHGIPAS  383
            HMPEWFQ HG P S
Sbjct  283  HMPEWFQMHGFPVS  296



>ref|XP_007218742.1| hypothetical protein PRUPE_ppa009189mg [Prunus persica]
 gb|EMJ19941.1| hypothetical protein PRUPE_ppa009189mg [Prunus persica]
Length=303

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S+FA+LVLFTAGLEGYARP+VD++DVD+LF  RLYRPSTTSTEYREHVKDLS ++KD+
Sbjct  166  QVSQFAELVLFTAGLEGYARPLVDRIDVDNLFSCRLYRPSTTSTEYREHVKDLSGLAKDM  225

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPC+ FSAGQ HD QLL+V+LPLL+HLS QKDVRPVLYE 
Sbjct  226  RRIVIVDNNPFSFLLQPLNGIPCIAFSAGQTHDTQLLDVLLPLLKHLSLQKDVRPVLYER  285

Query  427  FHMPEWFQKHGIPAS  383
            FHM EWFQK GIP++
Sbjct  286  FHMLEWFQKQGIPST  300



>ref|XP_010101420.1| CTD small phosphatase-like protein [Morus notabilis]
 gb|EXB88392.1| CTD small phosphatase-like protein [Morus notabilis]
Length=307

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D  +LF  RLYRPST STE+REHVKDLSCISKD+
Sbjct  166  QLSEFADLVLFTAGLEGYARPLVDRIDEGNLFSLRLYRPSTISTEFREHVKDLSCISKDM  225

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP+NGIPC+PFSAGQPHD QLL+V+LPLL+ LS QKDVRP+L+E 
Sbjct  226  CRSVIVDNNPFSFLLQPVNGIPCIPFSAGQPHDTQLLDVLLPLLKDLSLQKDVRPMLHER  285

Query  427  FHMPEWFQKHGIP  389
            FHMPEWFQK GIP
Sbjct  286  FHMPEWFQKQGIP  298



>ref|XP_002265560.1| PREDICTED: CTD small phosphatase-like protein [Vitis vinifera]
 emb|CBI22795.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S+FA+LVLFTA LEGYARP+VDK+D  + F  RLYRPST ST+YREHVKDLSC+SKDL
Sbjct  184  QISEFAELVLFTAALEGYARPLVDKIDAGNRFSKRLYRPSTVSTKYREHVKDLSCLSKDL  243

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPCVPFSA QP+D+QLLEV+LPLL+HLS QKDVRPVLYE 
Sbjct  244  RRIVIVDNNPFSFLLQPLNGIPCVPFSAEQPNDKQLLEVLLPLLKHLSLQKDVRPVLYER  303

Query  427  FHMPEWFQKHGIPAS  383
            FHMP+WFQ HGIPAS
Sbjct  304  FHMPDWFQMHGIPAS  318



>ref|XP_006646453.1| PREDICTED: CTD small phosphatase-like protein 2-like, partial 
[Oryza brachyantha]
Length=282

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S FADL+LFTAGLEGYARP+VD++DV ++F  RLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  146  SDFADLILFTAGLEGYARPLVDRIDVHNIFKLRLYRPSTVTTEYREHVKDLSCVSKDFCR  205

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            +V+VDNNPFSF+LQPLNGIPCVPFSAGQ +D+QL+EVI PLL+HLS Q+DVRP LYE FH
Sbjct  206  VVIVDNNPFSFILQPLNGIPCVPFSAGQHNDDQLMEVIFPLLKHLSLQRDVRPALYERFH  265

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  266  MPEWFQKHGIPQT  278



>ref|XP_008370102.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Malus domestica]
Length=297

 Score =   200 bits (509),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            + +FADLVLFTAGLE YARP+VD++DV++LF  RLYRPST STE+REHVKDLSC+SKD S
Sbjct  163  VCEFADLVLFTAGLEDYARPLVDRIDVENLFKLRLYRPSTVSTEFREHVKDLSCLSKDFS  222

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            RIV+VDNNPFSFLLQPLNGIPCVPFSAGQP+D+QLLEV+ PLL  LS QKDVRP+L+E F
Sbjct  223  RIVIVDNNPFSFLLQPLNGIPCVPFSAGQPYDDQLLEVLHPLLMQLSLQKDVRPMLHEKF  282

Query  424  HMPEWFQKHGIPAS  383
             MPEWFQ HG P S
Sbjct  283  QMPEWFQMHGFPVS  296



>ref|NP_001044710.1| Os01g0833100 [Oryza sativa Japonica Group]
 dbj|BAD73773.1| NLI interacting factor (NIF) family protein-like [Oryza sativa 
Japonica Group]
 dbj|BAF06624.1| Os01g0833100 [Oryza sativa Japonica Group]
 dbj|BAG91176.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55630.1| hypothetical protein OsJ_03971 [Oryza sativa Japonica Group]
Length=312

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD++DV + F  RLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  176  SEFADLILFTAGLEGYARPLVDRIDVHNRFKLRLYRPSTVTTEYREHVKDLSCVSKDFCR  235

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            +V+VDNNPFSF+LQPLNGIPCVPFSAGQ +D QL+EVI PLL+HLS Q+DVRP LYE FH
Sbjct  236  VVIVDNNPFSFILQPLNGIPCVPFSAGQHNDNQLMEVIFPLLKHLSIQRDVRPALYERFH  295

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  296  MPEWFQKHGIPQT  308



>ref|XP_004961795.1| PREDICTED: CTD small phosphatase-like protein 2-like [Setaria 
italica]
Length=300

 Score =   200 bits (509),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADLVLFTAGLEGYA+P+VD++D  + FIHRLYRPST +TEYR+HVKDLSC+SKD  R
Sbjct  164  SEFADLVLFTAGLEGYAKPLVDRIDAHNRFIHRLYRPSTVTTEYRDHVKDLSCLSKDFQR  223

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNP+SFLLQPLNGIPC+ FSAGQP D+QL+  I PLL+HLS QKDVRP LYETFH
Sbjct  224  IVLVDNNPYSFLLQPLNGIPCITFSAGQPIDDQLMGTIFPLLKHLSLQKDVRPALYETFH  283

Query  421  MPEWFQKHGIP  389
            MPEWFQ  GIP
Sbjct  284  MPEWFQGQGIP  294



>ref|XP_002439933.1| hypothetical protein SORBIDRAFT_09g022940 [Sorghum bicolor]
 gb|EES18363.1| hypothetical protein SORBIDRAFT_09g022940 [Sorghum bicolor]
Length=295

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADLVLFTAGLEGYA+P+VD++D  + F HRLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  159  SEFADLVLFTAGLEGYAKPLVDRIDAHNRFTHRLYRPSTVTTEYREHVKDLSCLSKDFQR  218

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNP+SFLLQPLNGIPC+ FSAGQP D+QL+  I PLLEHL+ QKDVRP LYETFH
Sbjct  219  IVLVDNNPYSFLLQPLNGIPCITFSAGQPVDDQLMGTIFPLLEHLALQKDVRPALYETFH  278

Query  421  MPEWFQKHGIPAS  383
            MPEWFQ+ GIP +
Sbjct  279  MPEWFQRQGIPQT  291



>gb|EPS72976.1| hypothetical protein M569_01780, partial [Genlisea aurea]
Length=307

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS++ADLVLFTAGLEGYARP+VD++D  +LF  RLYRPST +T YR+HVKDLSC+SKDL
Sbjct  172  QLSEYADLVLFTAGLEGYARPLVDRIDASNLFTQRLYRPSTVTTPYRDHVKDLSCLSKDL  231

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SRIV+VDNNPFSFLLQP NGIPCVPFSA QP D+QL+EVILPLL+ LS Q+DVRPVLY+ 
Sbjct  232  SRIVIVDNNPFSFLLQPSNGIPCVPFSAAQPRDDQLMEVILPLLKQLSVQRDVRPVLYDK  291

Query  427  FHMPEWFQKHGIP  389
            F MPEWF+KHGIP
Sbjct  292  FRMPEWFKKHGIP  304



>gb|ACG32959.1| CTD small phosphatase-like protein [Zea mays]
 tpg|DAA56988.1| TPA: CTD small phosphatase-like protein [Zea mays]
Length=311

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD++DV + F  RLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  175  SEFADLILFTAGLEGYARPLVDRIDVHNRFRLRLYRPSTVTTEYREHVKDLSCVSKDFGR  234

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF+LQPLNGIPCVPFSAGQ  D+QL+ VI PLL+HLS QKDVRPVL+E FH
Sbjct  235  IVIVDNNPFSFILQPLNGIPCVPFSAGQHSDDQLMMVIFPLLKHLSLQKDVRPVLHERFH  294

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  295  MPEWFQKHGIPQT  307



>ref|XP_007205648.1| hypothetical protein PRUPE_ppa009333mg [Prunus persica]
 gb|EMJ06847.1| hypothetical protein PRUPE_ppa009333mg [Prunus persica]
Length=297

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++ +FADLVLFTAG+E YARP+VD++DV++LF  RLYRPST STE REHVKDLSC+SKDL
Sbjct  159  QVYEFADLVLFTAGVEDYARPLVDRIDVENLFKLRLYRPSTVSTECREHVKDLSCLSKDL  218

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQPLNGIPCVPFSAGQP+D+QLLEV+LP L+ LS QKDVRPVLYE 
Sbjct  219  CRTVIVDNNPFSFLLQPLNGIPCVPFSAGQPNDDQLLEVLLPHLKQLSLQKDVRPVLYER  278

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQ HG P S
Sbjct  279  FHMPEWFQMHGFPVS  293



>ref|XP_003616639.1| CTD small phosphatase-like protein [Medicago truncatula]
 gb|AES99597.1| NLI interacting factor-like phosphatase [Medicago truncatula]
Length=305

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD +D ++ F  RLYRPST STE+REHVKDL+CISKDL
Sbjct  167  KLSEFADLVLFTAGLEGYARPLVDIIDKENRFSLRLYRPSTISTEHREHVKDLTCISKDL  226

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSF+LQP+NGIPC+PFSAG PHD QLL+VILPLL+ LS+Q DVRP+LYE 
Sbjct  227  DRIVIVDNNPFSFVLQPVNGIPCIPFSAGHPHDTQLLDVILPLLKQLSEQNDVRPLLYEK  286

Query  427  FHMPEWFQKHGIPAS  383
            FHM +WFQK GIPAS
Sbjct  287  FHMTDWFQKQGIPAS  301



>gb|EEC71746.1| hypothetical protein OsI_04315 [Oryza sativa Indica Group]
Length=312

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD++DV + F  RLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  176  SEFADLILFTAGLEGYARPLVDRIDVHNRFKLRLYRPSTVTTEYREHVKDLSCVSKDFCR  235

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            +V+VDNNPFSF+LQPLNGIPCVPFSAGQ +D+QL+EVI PLL+HLS Q+DVRP LYE FH
Sbjct  236  VVIVDNNPFSFILQPLNGIPCVPFSAGQHNDDQLMEVIFPLLKHLSIQRDVRPALYERFH  295

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  296  MPEWFQKHGIPQT  308



>ref|XP_002458718.1| hypothetical protein SORBIDRAFT_03g038910 [Sorghum bicolor]
 gb|EES03838.1| hypothetical protein SORBIDRAFT_03g038910 [Sorghum bicolor]
Length=314

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD++DV + F  RLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  178  SEFADLILFTAGLEGYARPLVDRIDVHNRFRLRLYRPSTVTTEYREHVKDLSCVSKDFGR  237

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF+LQPLNGIPCVPFSAGQ  D+QL+ VI PLL+HLS QKDVRPVL+E FH
Sbjct  238  IVIVDNNPFSFILQPLNGIPCVPFSAGQHSDDQLMTVIFPLLKHLSLQKDVRPVLHERFH  297

Query  421  MPEWFQKHGIP  389
            MPEWFQKHGIP
Sbjct  298  MPEWFQKHGIP  308



>ref|XP_004491033.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cicer arietinum]
Length=311

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD +D ++ F  RLYRPST STEYREHVKDL+CISKDL
Sbjct  173  QLSEFADLVLFTAGLEGYARPLVDIIDKENRFSLRLYRPSTISTEYREHVKDLTCISKDL  232

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSF+LQP+NGIPC+PFSAG P+D QLL+VILPLL+ LS+Q DVRP+L E 
Sbjct  233  DRIVIVDNNPFSFVLQPVNGIPCIPFSAGHPNDTQLLDVILPLLKQLSKQSDVRPLLCEK  292

Query  427  FHMPEWFQKHGIPAS  383
            FHMP+WFQK GIPAS
Sbjct  293  FHMPDWFQKQGIPAS  307



>ref|XP_004302575.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=295

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            + +FADLVLFTAGLEGYARP+VD++DV++ F  RLYRPST +TE R+HVKD+SCISKDL 
Sbjct  161  IGEFADLVLFTAGLEGYARPLVDRIDVENRFKFRLYRPSTVTTEKRDHVKDISCISKDLC  220

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            RIV+VDNNPFSFLLQPLNG+PC+PFSAG P+D+QLLEV+LPLL+HL QQKDVRPVLYE F
Sbjct  221  RIVIVDNNPFSFLLQPLNGVPCIPFSAGHPYDDQLLEVLLPLLKHLGQQKDVRPVLYERF  280

Query  424  HMPEWFQKHGIPAS  383
            HMPEWFQ HGI  S
Sbjct  281  HMPEWFQMHGITVS  294



>ref|XP_009416286.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Musa acuminata 
subsp. malaccensis]
Length=310

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADLVLFTAGLEGYA PV+D++DVD+  IHRLYRP+T STEYREHVKDLSC+SKDLSR
Sbjct  174  SEFADLVLFTAGLEGYASPVIDRIDVDNKLIHRLYRPATVSTEYREHVKDLSCVSKDLSR  233

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
             V+VDNNP+SFLLQPLNGIPC+PF A QP DEQL+ VILPLL+HLS QKDVR VLYE FH
Sbjct  234  TVIVDNNPYSFLLQPLNGIPCMPFFAAQPCDEQLMGVILPLLKHLSLQKDVRSVLYEKFH  293

Query  421  MPEWFQKHGIPASRA  377
            MPEWF++ GIP  ++
Sbjct  294  MPEWFEQQGIPTVKS  308



>ref|NP_001136647.1| uncharacterized protein LOC100216776 [Zea mays]
 gb|ACF82332.1| unknown [Zea mays]
 tpg|DAA56987.1| TPA: CTD small phosphatase-like protein [Zea mays]
Length=364

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD++DV + F  RLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  175  SEFADLILFTAGLEGYARPLVDRIDVHNRFRLRLYRPSTVTTEYREHVKDLSCVSKDFGR  234

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF+LQPLNGIPCVPFSAGQ  D+QL+ VI PLL+HLS QKDVRPVL+E FH
Sbjct  235  IVIVDNNPFSFILQPLNGIPCVPFSAGQHSDDQLMMVIFPLLKHLSLQKDVRPVLHERFH  294

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  295  MPEWFQKHGIPQT  307



>ref|XP_008672265.1| PREDICTED: uncharacterized protein LOC100216776 isoform X1 [Zea 
mays]
Length=360

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD++DV + F  RLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  175  SEFADLILFTAGLEGYARPLVDRIDVHNRFRLRLYRPSTVTTEYREHVKDLSCVSKDFGR  234

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF+LQPLNGIPCVPFSAGQ  D+QL+ VI PLL+HLS QKDVRPVL+E FH
Sbjct  235  IVIVDNNPFSFILQPLNGIPCVPFSAGQHSDDQLMMVIFPLLKHLSLQKDVRPVLHERFH  294

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  295  MPEWFQKHGIPQT  307



>gb|KDP24445.1| hypothetical protein JCGZ_25009 [Jatropha curcas]
Length=316

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++++FADLVLFTAGLEGYARP+VD++DV++ F  RLYRPST STEYREHVKDLSCI KDL
Sbjct  178  QINEFADLVLFTAGLEGYARPLVDRIDVENRFKLRLYRPSTVSTEYREHVKDLSCIMKDL  237

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPCVPFSA QP+D QLL+ +LPL++HLS QKDVR  L E 
Sbjct  238  HRIVIVDNNPFSFLLQPLNGIPCVPFSAAQPYDNQLLDYLLPLIKHLSLQKDVRTELQER  297

Query  427  FHMPEWFQKHGIPA  386
            FHMPEWFQ HGIPA
Sbjct  298  FHMPEWFQMHGIPA  311



>ref|XP_010044096.1| PREDICTED: CTD small phosphatase-like protein [Eucalyptus grandis]
 gb|KCW86104.1| hypothetical protein EUGRSUZ_B02803 [Eucalyptus grandis]
Length=333

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            + +FA+L+LFTAGLE YARP+VD++D D+L   RLYRPST STEYREHVKDLS +SKDL 
Sbjct  196  VGEFANLILFTAGLEDYARPLVDRIDKDNLIGERLYRPSTVSTEYREHVKDLSSLSKDLC  255

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            RIV+VDNNPFSFLLQPLNGIPCVPFSAGQP+D+QLLEV+LPLL+HLS Q+DVRPVLYE F
Sbjct  256  RIVIVDNNPFSFLLQPLNGIPCVPFSAGQPYDDQLLEVLLPLLKHLSLQRDVRPVLYERF  315

Query  424  HMPEWFQKHGIPAS  383
            HMPEWFQ HGIPAS
Sbjct  316  HMPEWFQMHGIPAS  329



>ref|XP_008793248.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Phoenix dactylifera]
Length=303

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++S+FA+LVLFTAGLEGYA P+VD++DVD+ F   LYR ST STEYREHVKDLSC+SKDL
Sbjct  165  QISEFANLVLFTAGLEGYASPLVDRIDVDNKFSLHLYRSSTVSTEYREHVKDLSCVSKDL  224

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQPLNGIPC+PFSAGQP D+QL+ V+LPLL+HLS QKDVRP+LYE 
Sbjct  225  CRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPCDDQLMGVLLPLLKHLSIQKDVRPILYEK  284

Query  427  FHMPEWFQKHGIP  389
            FHMPEWF++HGIP
Sbjct  285  FHMPEWFKQHGIP  297



>ref|XP_003564541.1| PREDICTED: CTD small phosphatase-like protein [Brachypodium distachyon]
Length=312

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD +D  + F  RLYRPST +TEYREHVKDLSCISK+ SR
Sbjct  176  SEFADLILFTAGLEGYARPLVDTIDAHNRFKLRLYRPSTVTTEYREHVKDLSCISKEFSR  235

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF+LQPLNGIPCVPFSAGQ  D+QL+EVI PLL+ LS Q+DVRP LYE FH
Sbjct  236  IVIVDNNPFSFILQPLNGIPCVPFSAGQHSDDQLMEVIFPLLKRLSLQRDVRPALYERFH  295

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  296  MPEWFQKHGIPQT  308



>gb|EMS66920.1| CTD small phosphatase-like protein 2 [Triticum urartu]
Length=232

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD +D  + F  RLYRPST +TEYREHVKDLSC+SKD SR
Sbjct  96   SEFADLILFTAGLEGYARPLVDIIDAHNRFKLRLYRPSTVTTEYREHVKDLSCLSKDFSR  155

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF++QPLNGIPCVPFSAGQ  D+QL+EVI PLL+HLS Q+DVRP LYE FH
Sbjct  156  IVIVDNNPFSFIVQPLNGIPCVPFSAGQHSDDQLMEVIFPLLKHLSVQRDVRPALYERFH  215

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  216  MPEWFQKHGIPRT  228



>gb|EAY98360.1| hypothetical protein OsI_20271 [Oryza sativa Indica Group]
Length=326

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYA+P+VD++D  + F HRLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  190  SEFADLILFTAGLEGYAKPLVDRIDAHNRFCHRLYRPSTVTTEYREHVKDLSCLSKDFHR  249

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNP+SFLLQPLNGIPC+ FSAGQP D+QL+ VI PLL+HLS Q DVRP LYETFH
Sbjct  250  IVLVDNNPYSFLLQPLNGIPCLTFSAGQPVDDQLMGVIFPLLKHLSLQNDVRPALYETFH  309

Query  421  MPEWFQKHGIP  389
            MPEWFQ+HGIP
Sbjct  310  MPEWFQRHGIP  320



>ref|XP_004970462.1| PREDICTED: CTD small phosphatase-like protein 2-like [Setaria 
italica]
Length=312

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD++DV + F  RLYRPST +TE+REHVKDLSC+SKD  R
Sbjct  176  SEFADLILFTAGLEGYARPLVDRIDVHNRFRLRLYRPSTVTTEFREHVKDLSCVSKDFCR  235

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF+LQPLNGIPCVPFSAGQ  D+QL+ VI PLL+HLS QKDVRPVL+E FH
Sbjct  236  IVIVDNNPFSFILQPLNGIPCVPFSAGQHSDDQLMTVIFPLLKHLSLQKDVRPVLHERFH  295

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  296  MPEWFQKHGIPQT  308



>ref|XP_008243657.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Prunus mume]
Length=297

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++ +FADLVLFTAG+E YARP+VD++DV++LF  RLYRPST STE REHVKDLSC+SKDL
Sbjct  159  QVYEFADLVLFTAGVEDYARPLVDRIDVENLFKLRLYRPSTVSTECREHVKDLSCLSKDL  218

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQPLNGIPCVPFSAGQP D+QLLEV+LP L+ LS QKDVRPVLY+ 
Sbjct  219  CRTVIVDNNPFSFLLQPLNGIPCVPFSAGQPKDDQLLEVLLPHLKQLSLQKDVRPVLYDR  278

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQ HG P S
Sbjct  279  FHMPEWFQMHGFPVS  293



>ref|XP_003600913.1| CTD small phosphatase-like protein [Medicago truncatula]
 gb|AES71164.1| NLI interacting factor-like phosphatase [Medicago truncatula]
Length=276

 Score =   197 bits (501),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAG+EGYARP+VD++D ++ F  RLYRPST  TE+RE+VKDL+CISKDL
Sbjct  141  QLSEFADLVLFTAGVEGYARPLVDRIDTENWFSLRLYRPSTIRTEHREYVKDLTCISKDL  200

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
              IV+VDNNP+SFLLQP NGIPCVPFSAGQPHD QLL+VILP+L+ LS QKDVR VLYE 
Sbjct  201  CNIVIVDNNPYSFLLQPDNGIPCVPFSAGQPHDTQLLDVILPILKDLSDQKDVRHVLYEK  260

Query  427  FHMPEWFQKHGIPA  386
            +HMPEWFQ+HGIPA
Sbjct  261  YHMPEWFQQHGIPA  274



>gb|EEE64021.1| hypothetical protein OsJ_18850 [Oryza sativa Japonica Group]
Length=326

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYA+P+VD++D  + F HRLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  190  SEFADLILFTAGLEGYAKPLVDRIDAHNRFCHRLYRPSTVTTEYREHVKDLSCLSKDFHR  249

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNP+SFLLQPLNGIPC+ FSAGQP D+QL+ VI PLL+HLS Q DVRP LYETFH
Sbjct  250  IVLVDNNPYSFLLQPLNGIPCLTFSAGQPVDDQLMGVIFPLLKHLSLQNDVRPALYETFH  309

Query  421  MPEWFQKHGIP  389
            MPEWFQ+HGIP
Sbjct  310  MPEWFQRHGIP  320



>ref|XP_009392189.1| PREDICTED: CTD nuclear envelope phosphatase 1-like [Musa acuminata 
subsp. malaccensis]
Length=308

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADLVLFTAGLEGYA PV+D++DVD+   HRLYRP+T  TE+REHVKDLSC+SKDLSR
Sbjct  172  SEFADLVLFTAGLEGYASPVIDRIDVDNKLTHRLYRPATVITEHREHVKDLSCVSKDLSR  231

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSFLLQPLNGIPCVPFSA QP D+QL+ VILPLL+HLS QKDVR VLY+ FH
Sbjct  232  IVIVDNNPFSFLLQPLNGIPCVPFSASQPCDDQLMGVILPLLKHLSLQKDVRTVLYDKFH  291

Query  421  MPEWFQKHGIPA  386
            MPEWF++ GIP 
Sbjct  292  MPEWFKQQGIPT  303



>gb|EMT13698.1| CTD small phosphatase-like protein 2 [Aegilops tauschii]
Length=314

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD +D  + F  RLYRPST +TEYREHVKDLSC+SKD SR
Sbjct  178  SEFADLILFTAGLEGYARPLVDIIDAHNRFKLRLYRPSTVTTEYREHVKDLSCLSKDFSR  237

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF++QPLNGIPCVPFSAGQ  D+QL+EVI PLL+HLS Q+DVRP LYE FH
Sbjct  238  IVIVDNNPFSFIVQPLNGIPCVPFSAGQHSDDQLMEVIFPLLKHLSVQRDVRPALYERFH  297

Query  421  MPEWFQKHGIP  389
            MPEWFQKHGIP
Sbjct  298  MPEWFQKHGIP  308



>emb|CDM84840.1| unnamed protein product [Triticum aestivum]
Length=313

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD +D  + F  RLYRPST +TEYREHVKDLSC+SKD SR
Sbjct  177  SEFADLILFTAGLEGYARPLVDIIDAHNRFKLRLYRPSTVTTEYREHVKDLSCLSKDFSR  236

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF++QPLNGIPCVPFSAGQ  D+QL+EVI PLL+HLS Q+DVRP LYE FH
Sbjct  237  IVIVDNNPFSFIVQPLNGIPCVPFSAGQHSDDQLMEVIFPLLKHLSVQRDVRPALYERFH  296

Query  421  MPEWFQKHGIP  389
            MPEWFQKHGIP
Sbjct  297  MPEWFQKHGIP  307



>dbj|BAJ91589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD +D  + F  RLYRPST +TEYREHVKDLSC+SK  SR
Sbjct  177  SEFADLILFTAGLEGYARPLVDIIDAHNRFKLRLYRPSTVTTEYREHVKDLSCLSKQFSR  236

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF+LQPLNGIPCVPFSAGQ  D+QL+EVI PLL+HLS Q+DVRP LYE FH
Sbjct  237  IVIVDNNPFSFILQPLNGIPCVPFSAGQHSDDQLMEVIFPLLKHLSVQRDVRPALYERFH  296

Query  421  MPEWFQKHGIPAS  383
            MPEWFQKHGIP +
Sbjct  297  MPEWFQKHGIPQT  309



>ref|XP_006655392.1| PREDICTED: CTD small phosphatase-like protein 2-like, partial 
[Oryza brachyantha]
Length=279

 Score =   194 bits (494),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYA+P+VD++D  +   +RLYRPST +TEYREHVKDLSC+SKD  R
Sbjct  143  SEFADLILFTAGLEGYAKPLVDRIDAHNRLRNRLYRPSTVTTEYREHVKDLSCLSKDFRR  202

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNP+SFLLQPLNGIPC+ FSAGQP D+QL+ VI PLL+HLS Q DVRP LYETFH
Sbjct  203  IVIVDNNPYSFLLQPLNGIPCLTFSAGQPVDDQLMGVIFPLLKHLSLQNDVRPALYETFH  262

Query  421  MPEWFQKHGIP  389
            MPEWFQ+HGIP
Sbjct  263  MPEWFQRHGIP  273



>ref|XP_008442416.1| PREDICTED: CTD small phosphatase-like protein 2 [Cucumis melo]
 gb|ADN33794.1| hypothetical protein [Cucumis melo subsp. melo]
Length=301

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            + ++FA+L+LFTAGLEGYA+P+VD++D +  F HRLYRPST STEYREHVKDLSCI +DL
Sbjct  169  QAAEFAELILFTAGLEGYAKPLVDRIDTEGRFSHRLYRPSTVSTEYREHVKDLSCIQRDL  228

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR+V++DNNPFSFLLQP+NGIPC+PFS  QP D QLLEV+LPLL+HL+ +KDVRP+LYE 
Sbjct  229  SRVVIIDNNPFSFLLQPMNGIPCIPFSPAQPADNQLLEVLLPLLKHLALEKDVRPILYER  288

Query  427  FHMPEWFQKHGIP  389
            FHMPEWFQ HGIP
Sbjct  289  FHMPEWFQIHGIP  301



>ref|XP_004137719.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 ref|XP_004168574.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 gb|KGN58757.1| hypothetical protein Csa_3G731190 [Cucumis sativus]
Length=301

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            + ++FADL+LFTAGLEGYA+P+VD++D +  F HRLYRPST STEYREHVKDLSCI +DL
Sbjct  169  QAAEFADLILFTAGLEGYAKPLVDRIDTEGRFSHRLYRPSTVSTEYREHVKDLSCIQRDL  228

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR+V++DNNPFSFLLQP NGIPC+PFS  QP D QLLEV+LPLL+HL+ +KDVRP+LYE 
Sbjct  229  SRVVIIDNNPFSFLLQPTNGIPCLPFSPAQPADNQLLEVLLPLLKHLALEKDVRPILYER  288

Query  427  FHMPEWFQKHGIP  389
            FHMPEWFQ HGIP
Sbjct  289  FHMPEWFQIHGIP  301



>ref|XP_010095241.1| CTD small phosphatase-like protein 2 [Morus notabilis]
 gb|EXB59009.1| CTD small phosphatase-like protein 2 [Morus notabilis]
Length=234

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++ +FA LVLFTAGLEGYARP+VD++D ++ F  RLYRPST STEYREHVKDLS +SKDL
Sbjct  96   QIGEFAVLVLFTAGLEGYARPLVDRIDAENRFSLRLYRPSTVSTEYREHVKDLSNLSKDL  155

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR+V+VDNNPFSFLLQP NGIPC+PFSAGQP+D+QLLEV+LPLL+HLS+QKDVRPVL + 
Sbjct  156  SRVVIVDNNPFSFLLQPSNGIPCIPFSAGQPYDDQLLEVLLPLLKHLSKQKDVRPVLCDR  215

Query  427  FHMPEWFQKHGIPA  386
            F MPEWFQ HGIP 
Sbjct  216  FRMPEWFQMHGIPV  229



>ref|NP_001148462.1| LOC100282077 [Zea mays]
 gb|ACG31578.1| CTD small phosphatase-like protein [Zea mays]
 gb|AFW84679.1| CTD small phosphatase-like protein isoform 1 [Zea mays]
 gb|AFW84680.1| CTD small phosphatase-like protein isoform 2 [Zea mays]
Length=311

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYARP+VD++DV + F  RLYRPST +TEYREHVKDL+ +SKD  R
Sbjct  175  SEFADLILFTAGLEGYARPLVDRIDVHNRFRIRLYRPSTVTTEYREHVKDLTRVSKDFGR  234

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSF+LQPLNGIPCVPFSAGQ  D+QL+ VI PLL+HLS QKDVRPVL E FH
Sbjct  235  IVIVDNNPFSFILQPLNGIPCVPFSAGQHSDDQLMTVIFPLLKHLSLQKDVRPVLRERFH  294

Query  421  MPEWFQKHGIP  389
            MPEWFQ HGIP
Sbjct  295  MPEWFQNHGIP  305



>ref|XP_002323581.2| hypothetical protein POPTR_0016s12400g [Populus trichocarpa]
 gb|EEF05342.2| hypothetical protein POPTR_0016s12400g [Populus trichocarpa]
Length=292

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++ +FADL+LFTAG+EGYA P+ D++DV++ F  RL+RPST STEYRE VKDLSC+SKDL
Sbjct  154  QIGEFADLILFTAGIEGYASPLFDRIDVENQFSQRLFRPSTVSTEYRELVKDLSCLSKDL  213

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR+V+VDNNPFSFLLQ LNGIPCVPFSAG P+D+QLL+V+LPLL++LS QKDVRPVL++ 
Sbjct  214  SRVVIVDNNPFSFLLQTLNGIPCVPFSAGLPYDDQLLDVLLPLLKNLSLQKDVRPVLHKR  273

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQ HGIPAS
Sbjct  274  FHMPEWFQMHGIPAS  288



>ref|XP_010534600.1| PREDICTED: CTD small phosphatase-like protein [Tarenaya hassleriana]
Length=311

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D  +LF  RLYRPST ST+YR+HVKDL+C S ++
Sbjct  173  QLSRFANLVLFTAGLEGYARPLVDRIDTGNLFSLRLYRPSTVSTQYRDHVKDLTCTSDNM  232

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQPLNGIPC+PFSAGQP+D QLL+VILPLL HLS+Q+DVRP+L++ 
Sbjct  233  FRTVIVDNNPFSFLLQPLNGIPCIPFSAGQPNDTQLLDVILPLLTHLSEQEDVRPILHDR  292

Query  427  FHMPEWFQKHGIPAS  383
            FHM EWF+K GIP++
Sbjct  293  FHMAEWFEKQGIPST  307



>ref|XP_010535319.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Tarenaya hassleriana]
 ref|XP_010535391.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Tarenaya hassleriana]
Length=307

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D  + F  RLYRPST ST+YR+HVKDLSC S ++
Sbjct  172  QLSQFANLVLFTAGLEGYARPLVDRIDTRNAFSLRLYRPSTVSTQYRDHVKDLSCTSNNM  231

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQPLNGIPC+PFSAGQ +D QLL+VILPLL+HLS+Q+D+RP+LY+ 
Sbjct  232  CRTVIVDNNPFSFLLQPLNGIPCIPFSAGQANDTQLLDVILPLLKHLSEQEDIRPILYDR  291

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GI A+
Sbjct  292  FHMPEWFEKQGISAT  306



>ref|XP_009406928.1| PREDICTED: CTD nuclear envelope phosphatase 1-like [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADLVLFTAGLEGYARPV+D++D+D+   HRLYRP+T ST+YREHVKDLSC+S+ LSR
Sbjct  171  SEFADLVLFTAGLEGYARPVIDRIDIDNKLTHRLYRPATVSTKYREHVKDLSCVSQHLSR  230

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNPFSFLLQPLNGIPC+PF A QP D+QL+ VILPLL+HLS  KDVRP+L E FH
Sbjct  231  IVIVDNNPFSFLLQPLNGIPCMPFFAAQPCDDQLMGVILPLLKHLSLHKDVRPILNEKFH  290

Query  421  MPEWFQKHGIP  389
            M EWF++ GIP
Sbjct  291  MREWFEQQGIP  301



>gb|EMT12311.1| CTD small phosphatase-like protein 2 [Aegilops tauschii]
Length=350

 Score =   189 bits (479),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYA+P+VD++D  + F  RLYRPST +TEYR+HVKDLSC+SKD  R
Sbjct  185  SEFADLILFTAGLEGYAKPLVDRIDAHNRFCRRLYRPSTVTTEYRDHVKDLSCLSKDFRR  244

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            IV+VDNNP+SFLLQPLNGIPC+ FSAGQP D+QL+ VI PLL+ LS Q DVRP L++ FH
Sbjct  245  IVLVDNNPYSFLLQPLNGIPCLTFSAGQPMDDQLMRVIFPLLKRLSLQNDVRPALHDAFH  304

Query  421  MPEWFQKHGIP  389
            MPEWFQ++GIP
Sbjct  305  MPEWFQRNGIP  315



>emb|CDX93216.1| BnaC04g46800D [Brassica napus]
Length=304

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+L++FTAGLE YARP+VDK+D  H+   RLYRP T ST+YR+HVKDL C SK++
Sbjct  164  KLSQFANLIVFTAGLEDYARPLVDKIDTKHVLNERLYRPCTVSTQYRDHVKDLLCTSKNM  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+SFLLQPLNGIPCVPFSA QPHD QLL++ILPLL+ LS+++DVR  LY+ 
Sbjct  224  CRTVIVDNNPYSFLLQPLNGIPCVPFSAEQPHDTQLLDIILPLLKKLSEEEDVRGALYDR  283

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  284  FHMPEWFEKQGIPRS  298



>dbj|BAK00193.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00947.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FADL+LFTAGLEGYA+P++D++D  + F  RLYRPST +TEYR+HVKDLSC+SKD  R
Sbjct  164  SEFADLILFTAGLEGYAKPLIDRIDAHNRFYRRLYRPSTVTTEYRDHVKDLSCLSKDFRR  223

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
            +V+VDNNP+SFLLQPLNGIPC  FSAGQP D+QL+ VI PLL+HLS Q DVRP L + FH
Sbjct  224  VVLVDNNPYSFLLQPLNGIPCHTFSAGQPMDDQLMRVIFPLLKHLSLQNDVRPALRDAFH  283

Query  421  MPEWFQKHGIP  389
            MPEWFQ +GIP
Sbjct  284  MPEWFQSNGIP  294



>ref|XP_004500494.1| PREDICTED: probable C-terminal domain small phosphatase-like 
[Cicer arietinum]
Length=275

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D ++ F  RLYRPST ST++REHVKDL CISKDL
Sbjct  140  QLSEFADLVLFTAGLEGYARPLVDRIDTENRFSLRLYRPSTVSTKHREHVKDLRCISKDL  199

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             RIV+VDNNPFSFLLQP NGIPC  FSA +PHD QLL+VILPLL++LS QKDVR VL E 
Sbjct  200  CRIVLVDNNPFSFLLQPDNGIPCTSFSAWKPHDTQLLDVILPLLKNLSDQKDVRHVLNEK  259

Query  427  FHMPEWFQKHGIPA  386
            +HMPEWF++ G P 
Sbjct  260  YHMPEWFKQQGTPV  273



>ref|XP_009103976.1| PREDICTED: CTD small phosphatase-like protein [Brassica rapa]
Length=296

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST+YR+HVKDL   SK++
Sbjct  158  QLSHFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNM  217

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR V+VDNNPFSFLLQP NGIPCV FSAGQP+D QLL+VILPLL+ LS+++DVR  LY+ 
Sbjct  218  SRTVIVDNNPFSFLLQPSNGIPCVAFSAGQPNDTQLLDVILPLLKQLSEEEDVRRTLYDR  277

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  278  FHMPEWFEKQGIPPS  292



>emb|CDY46516.1| BnaC06g15690D [Brassica napus]
Length=303

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST+YR+HVKDL   S ++
Sbjct  165  QLSHFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSTNM  224

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR V+VDNNPFSFLLQP NGIPCV FSAGQP+D QLL+VILPLL+ LS+++DVR  LY+ 
Sbjct  225  SRTVIVDNNPFSFLLQPSNGIPCVAFSAGQPNDTQLLDVILPLLKQLSEEEDVRRTLYDR  284

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWFQK GIP S
Sbjct  285  FHMPEWFQKQGIPTS  299



>emb|CDX72186.1| BnaC08g26880D [Brassica napus]
Length=295

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST YR+HVKDL   SK++
Sbjct  157  QLSQFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTPYRDHVKDLLTTSKNM  216

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS+++DVRP LY+ 
Sbjct  217  SRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEEDVRPTLYDR  276

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  277  FRMPEWFEKQGIPPS  291



>emb|CDY27252.1| BnaA09g35500D [Brassica napus]
Length=295

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST YR+HVKDL   SK++
Sbjct  157  KLSQFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTPYRDHVKDLLTTSKNM  216

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS+++DVRP LY+ 
Sbjct  217  SRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEEDVRPTLYDR  276

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  277  FRMPEWFEKQGIPPS  291



>ref|XP_009141872.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Brassica rapa]
Length=304

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L++FTAGLE YARP+VDK+D  H+   RLYRP T ST+YR+HVKDL C SK++
Sbjct  164  KLSQFAHLIVFTAGLEDYARPLVDKIDTKHVLNERLYRPCTVSTQYRDHVKDLLCTSKNM  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+SFLLQPLNGIPCVPFSA QPHD QLL++ILPLL+ LS+++DVR  LY+ 
Sbjct  224  CRTVIVDNNPYSFLLQPLNGIPCVPFSAEQPHDTQLLDIILPLLKQLSEEEDVRGALYDR  283

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  284  FHMPEWFEKQGIPRS  298



>ref|XP_009116289.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Brassica 
rapa]
Length=291

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST YR+HVKDL   SK++
Sbjct  153  KLSQFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTPYRDHVKDLLTTSKNM  212

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS+++DVRP LY+ 
Sbjct  213  SRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEEDVRPTLYDR  272

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  273  FRMPEWFEKQGIPPS  287



>ref|XP_009116288.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Brassica 
rapa]
Length=292

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST YR+HVKDL   SK++
Sbjct  154  KLSQFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTPYRDHVKDLLTTSKNM  213

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS+++DVRP LY+ 
Sbjct  214  SRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEEDVRPTLYDR  273

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  274  FRMPEWFEKQGIPPS  288



>ref|XP_006403042.1| hypothetical protein EUTSA_v10006119mg [Eutrema salsugineum]
 gb|ESQ44495.1| hypothetical protein EUTSA_v10006119mg [Eutrema salsugineum]
Length=305

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST+YR+HVKDL   SK++
Sbjct  167  QLSQFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNM  226

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS++ DVRP LY+ 
Sbjct  227  CRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDR  286

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  287  FRMPEWFEKQGIPPS  301



>gb|KFK34835.1| hypothetical protein AALP_AA5G199300 [Arabis alpina]
Length=301

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D  ++  +RLYRPST ST+YR+HVKDL   SK++
Sbjct  163  KLSQFADLVLFTAGLEGYARPLVDRIDTRNVLSNRLYRPSTVSTQYRDHVKDLLSTSKNM  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS++ DVRP LY+ 
Sbjct  223  CRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDR  282

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  283  FRMPEWFEKQGIPPS  297



>ref|NP_191155.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Arabidopsis thaliana]
 emb|CAB87850.1| putative protein [Arabidopsis thaliana]
 gb|AAM20657.1| putative protein [Arabidopsis thaliana]
 gb|AAM61626.1| unknown [Arabidopsis thaliana]
 gb|AAN15623.1| putative protein [Arabidopsis thaliana]
 gb|AEE79461.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Arabidopsis thaliana]
Length=305

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADL+LFTAGLEGYARP+VD++D   +  +RLYRPST ST+YR+HVKDL   SK++
Sbjct  167  QLSEFADLILFTAGLEGYARPLVDRIDTRKVLTNRLYRPSTVSTQYRDHVKDLLSTSKNM  226

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS++ DVRP LY+ 
Sbjct  227  CRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDR  286

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  287  FRMPEWFEKQGIPPS  301



>ref|XP_010427400.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=301

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST+YR+HVKDL   SK++
Sbjct  163  KLSEFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNM  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS+++DVRP LY+ 
Sbjct  223  CRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEEDVRPTLYDR  282

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  283  FRMPEWFEKQGIPPS  297



>ref|XP_002878054.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54313.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST+YR+HVKDL   SK++
Sbjct  166  QLSEFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNM  225

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS++ DVRP LY+ 
Sbjct  226  CRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDR  285

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  286  FRMPEWFEKQGIPPS  300



>emb|CDX67629.1| BnaA07g16690D [Brassica napus]
Length=296

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST+YR+HVKDL   S ++
Sbjct  158  QLSHFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSTNM  217

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
            SR V+VDNNPFSFLLQP NGIPCV FSAGQP+D QLL+VILPLL+ LS+++DVR  LY+ 
Sbjct  218  SRTVIVDNNPFSFLLQPSNGIPCVAFSAGQPNDTQLLDVILPLLKQLSEEEDVRRTLYDR  277

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  278  FHMPEWFEKQGIPPS  292



>ref|XP_010516189.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=300

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST+YR+HVKDL   SK++
Sbjct  162  KLSEFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNM  221

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS++ DVRP LY+ 
Sbjct  222  CRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDR  281

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  282  FRMPEWFEKQGIPPS  296



>ref|XP_010504466.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=300

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADL+LFTAGLEGYARP+VD++D   +  +RLYRPST ST+YR+HVKDL   SK++
Sbjct  162  KLSEFADLILFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNM  221

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS++ DVRP LY+ 
Sbjct  222  CRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDR  281

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  282  FRMPEWFEKQGIPPS  296



>ref|XP_006291562.1| hypothetical protein CARUB_v10017717mg [Capsella rubella]
 gb|EOA24460.1| hypothetical protein CARUB_v10017717mg [Capsella rubella]
Length=303

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADLVLFTAGLEGYARP+VD++D   +  +RLYRPST ST+YR+HVKDL   SK++
Sbjct  165  KLSEFADLVLFTAGLEGYARPLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNM  224

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPFSFLLQP NGIPC+ FSAGQP+D QLL+VILPLL+ LS++ DVRP LY+ 
Sbjct  225  YRTVIVDNNPFSFLLQPSNGIPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDR  284

Query  427  FHMPEWFQKHGIPAS  383
            F MPEWF+K GIP S
Sbjct  285  FRMPEWFEKQGIPPS  299



>gb|KFK23193.1| hypothetical protein AALP_AAs48948U000100 [Arabis alpina]
Length=303

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L+LFTAGLE YARP+VD++D  ++   RLYRPST ST+Y +HVKDL   SK++
Sbjct  158  QLSQFAHLILFTAGLEDYARPLVDRIDAKNVLRDRLYRPSTVSTQYGDHVKDLLSASKNM  217

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+SF+LQPLNGIPCVPFSA QPHD QLL+ ILPLL+ +S+ +DVRP LYE 
Sbjct  218  HRTVIVDNNPYSFVLQPLNGIPCVPFSAEQPHDTQLLDFILPLLKQVSEVEDVRPALYER  277

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+KHGIP S
Sbjct  278  FHMPEWFEKHGIPRS  292



>ref|XP_006411263.1| hypothetical protein EUTSA_v10016941mg [Eutrema salsugineum]
 gb|ESQ52716.1| hypothetical protein EUTSA_v10016941mg [Eutrema salsugineum]
Length=320

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+L+LFTAGLE YARP+VD +D  H+   RLYRP T ST+YR+HVKDL C SK++
Sbjct  168  QLSQFANLILFTAGLEDYARPLVDIIDTKHVLDDRLYRPCTVSTQYRDHVKDLLCASKNM  227

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+SFLLQPLNGIPCVPF+A QP+D QLL++ILPLL+ LS+++DVR  LY+ 
Sbjct  228  CRTVIVDNNPYSFLLQPLNGIPCVPFTAEQPNDTQLLDIILPLLKQLSEEEDVRSALYDR  287

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  288  FHMPEWFEKQGIPRS  302



>emb|CDY07060.1| BnaA04g22550D [Brassica napus]
Length=304

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L++FTAGLE YARP+VDK+D  H+   RLYR  T ST+YR+HVKDL C SK++
Sbjct  164  KLSQFAHLIVFTAGLEDYARPLVDKIDTKHVLNERLYRHCTVSTQYRDHVKDLLCTSKNM  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+SFLLQPLNGIPCVPFSA QPHD QLL++ILPLL+ LS+++DVR  LY+ 
Sbjct  224  CRTVIVDNNPYSFLLQPLNGIPCVPFSAEQPHDTQLLDIILPLLKQLSEEEDVRGALYDR  283

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  284  FHMPEWFEKQGIPRS  298



>gb|KJB74328.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=294

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  GYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMVDNNPFSFLLQ  560
             YARP+VD++D ++ F HRLYRPST  TE+REHVKDLSC+SK+L R V+VDNNPFSFLLQ
Sbjct  172  SYARPLVDRIDAENRFSHRLYRPSTICTEFREHVKDLSCLSKNLCRTVIVDNNPFSFLLQ  231

Query  559  PLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFHMPEWFQKHGIPAS  383
            PLNGIPC+PFSAGQPHD QLL+V+LPLL+HLS QKDVRP LY+ FHMPEWFQK GIP+S
Sbjct  232  PLNGIPCIPFSAGQPHDTQLLDVLLPLLKHLSLQKDVRPFLYDRFHMPEWFQKQGIPSS  290



>ref|XP_006294652.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
 gb|EOA27550.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
Length=309

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+L+LFTA LE YARP+VD++D  H+  HRLYRPST +T+YR+HVKDL C+SK++
Sbjct  163  QLSQFANLILFTAALEDYARPLVDRIDTQHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNM  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNPF FLLQPLNGIPC  F+A QP+D QLL+V+LPLL+ LS+++DV+  LY+ 
Sbjct  223  YRTVIVDNNPFCFLLQPLNGIPCDSFTAEQPNDTQLLDVVLPLLKQLSEEEDVKLALYDR  282

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  283  FHMPEWFEKQGIPLS  297



>ref|XP_010508910.1| PREDICTED: probable C-terminal domain small phosphatase isoform 
X2 [Camelina sativa]
Length=310

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+FA L+LFTA LE YARP+VD++D  H+  HRLYRPSTTST YR+HVKDL C+SK++ 
Sbjct  164  LSQFAHLILFTAALEDYARPLVDRIDTKHVLNHRLYRPSTTSTHYRDHVKDLLCVSKNMY  223

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            R V+VDNNP+ FLLQP+NGIPC  FSA QP+D QLL+V+LPLL+ LS+++DVR  LY+ F
Sbjct  224  RTVIVDNNPYCFLLQPVNGIPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDRF  283

Query  424  HMPEWFQKHGIPAS  383
            HMPEWF+K GIP S
Sbjct  284  HMPEWFEKQGIPQS  297



>ref|XP_010505730.1| PREDICTED: CTD small phosphatase-like protein isoform X4 [Camelina 
sativa]
Length=309

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L+LFTA LE YARP+VD++D  H+  HRLYRPST +T+YR+HVKDL C+SK++
Sbjct  163  QLSQFAHLILFTAALEDYARPLVDRIDTHHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNM  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+ FLLQPLNGIPC  FSA QP+D QLL+V+LPLL+ LS+++DVR  LY+ 
Sbjct  223  CRTVIVDNNPYCFLLQPLNGIPCDSFSAEQPNDTQLLDVVLPLLKQLSEEEDVRVTLYDR  282

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  283  FHMPEWFEKQGIPRS  297



>ref|XP_010517420.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X4 [Camelina sativa]
Length=311

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L+LFTA LE YARP+VD++D   +  HRLYRPST ST+YR+HVKDL C+SK++
Sbjct  164  QLSQFAHLILFTAALEDYARPIVDRIDTKRVLNHRLYRPSTISTQYRDHVKDLLCVSKNM  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+ FLLQPLNGIPC  FSA QP+D QLL+V+LPLL+ LS+++DVR  LY+ 
Sbjct  224  CRTVIVDNNPYCFLLQPLNGIPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDR  283

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  284  FHMPEWFEKQGIPRS  298



>gb|KHG26951.1| putative phosphatase PSR2 [Gossypium arboreum]
Length=307

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F  RLYRPST STEYREHVKDL+CI KDL
Sbjct  164  QLSEFAELVLFTAGLEGYARPLVDRIDAENRFSLRLYRPSTVSTEYREHVKDLTCIFKDL  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYE  431
             R V+VDNNPFSFLLQP+NGIPC+PFSAGQPHD QLL V+LPLL+HLSQ+KDVRPVLY+
Sbjct  224  CRTVIVDNNPFSFLLQPVNGIPCIPFSAGQPHDTQLLGVLLPLLKHLSQEKDVRPVLYD  282



>ref|XP_010505729.1| PREDICTED: CTD small phosphatase-like protein isoform X3 [Camelina 
sativa]
Length=319

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L+LFTA LE YARP+VD++D  H+  HRLYRPST +T+YR+HVKDL C+SK++
Sbjct  163  QLSQFAHLILFTAALEDYARPLVDRIDTHHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNM  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+ FLLQPLNGIPC  FSA QP+D QLL+V+LPLL+ LS+++DVR  LY+ 
Sbjct  223  CRTVIVDNNPYCFLLQPLNGIPCDSFSAEQPNDTQLLDVVLPLLKQLSEEEDVRVTLYDR  282

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  283  FHMPEWFEKQGIPRS  297



>ref|XP_010505722.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505723.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505724.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505725.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
Length=325

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L+LFTA LE YARP+VD++D  H+  HRLYRPST +T+YR+HVKDL C+SK++
Sbjct  163  QLSQFAHLILFTAALEDYARPLVDRIDTHHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNM  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+ FLLQPLNGIPC  FSA QP+D QLL+V+LPLL+ LS+++DVR  LY+ 
Sbjct  223  CRTVIVDNNPYCFLLQPLNGIPCDSFSAEQPNDTQLLDVVLPLLKQLSEEEDVRVTLYDR  282

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  283  FHMPEWFEKQGIPRS  297



>ref|XP_010517419.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X3 [Camelina sativa]
Length=325

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L+LFTA LE YARP+VD++D   +  HRLYRPST ST+YR+HVKDL C+SK++
Sbjct  164  QLSQFAHLILFTAALEDYARPIVDRIDTKRVLNHRLYRPSTISTQYRDHVKDLLCVSKNM  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+ FLLQPLNGIPC  FSA QP+D QLL+V+LPLL+ LS+++DVR  LY+ 
Sbjct  224  CRTVIVDNNPYCFLLQPLNGIPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDR  283

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  284  FHMPEWFEKQGIPRS  298



>ref|XP_010517418.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X2 [Camelina sativa]
Length=333

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L+LFTA LE YARP+VD++D   +  HRLYRPST ST+YR+HVKDL C+SK++
Sbjct  164  QLSQFAHLILFTAALEDYARPIVDRIDTKRVLNHRLYRPSTISTQYRDHVKDLLCVSKNM  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+ FLLQPLNGIPC  FSA QP+D QLL+V+LPLL+ LS+++DVR  LY+ 
Sbjct  224  CRTVIVDNNPYCFLLQPLNGIPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDR  283

Query  427  FHMPEWFQKHGIPASRAMNEG*E*DYPPSEKQIFV  323
            FHMPEWF+K GIP S   +       P S  ++F+
Sbjct  284  FHMPEWFEKQGIPRSCWTSSSQVHQCPGSHVKVFI  318



>ref|XP_010517411.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517412.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517413.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517414.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517415.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517417.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
Length=341

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L+LFTA LE YARP+VD++D   +  HRLYRPST ST+YR+HVKDL C+SK++
Sbjct  164  QLSQFAHLILFTAALEDYARPIVDRIDTKRVLNHRLYRPSTISTQYRDHVKDLLCVSKNM  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+ FLLQPLNGIPC  FSA QP+D QLL+V+LPLL+ LS+++DVR  LY+ 
Sbjct  224  CRTVIVDNNPYCFLLQPLNGIPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDR  283

Query  427  FHMPEWFQKHGIPASRAMNEG*E*DYPPSEKQIFV  323
            FHMPEWF+K GIP S   +       P S  ++F+
Sbjct  284  FHMPEWFEKQGIPRSCWTSSSQVHQCPGSHVKVFI  318



>ref|XP_010505726.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Camelina 
sativa]
 ref|XP_010505728.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Camelina 
sativa]
Length=324

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L+LFTA LE YARP+VD++D  H+  HRLYRPST +T+YR+HVKDL C+SK++
Sbjct  163  QLSQFAHLILFTAALEDYARPLVDRIDTHHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNM  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
             R V+VDNNP+ FLLQPLNGIPC  FSA QP+D QLL+V+LPLL+ LS+++DVR  LY+ 
Sbjct  223  CRTVIVDNNPYCFLLQPLNGIPCDSFSAEQPNDTQLLDVVLPLLKQLSEEEDVRVTLYDR  282

Query  427  FHMPEWFQKHGIPAS  383
            FHMPEWF+K GIP S
Sbjct  283  FHMPEWFEKQGIPRS  297



>ref|XP_010508909.1| PREDICTED: CTD small phosphatase-like protein 2-B isoform X1 
[Camelina sativa]
Length=385

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+FA L+LFTA LE YARP+VD++D  H+  HRLYRPSTTST YR+HVKDL C+SK++ 
Sbjct  164  LSQFAHLILFTAALEDYARPLVDRIDTKHVLNHRLYRPSTTSTHYRDHVKDLLCVSKNMY  223

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            R V+VDNNP+ FLLQP+NGIPC  FSA QP+D QLL+V+LPLL+ LS+++DVR  LY+ F
Sbjct  224  RTVIVDNNPYCFLLQPVNGIPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDRF  283

Query  424  HMPEWFQKHGIPAS  383
            HMPEWF+K GIP S
Sbjct  284  HMPEWFEKQGIPQS  297



>gb|AAT58765.1| unknown protein, contains NLI interacting factor-like phosphatase, 
PF03031 [Oryza sativa Japonica Group]
 gb|AAT58787.1| unknown protein, contains NLI interacting factor-like phosphatase, 
PF03031 [Oryza sativa Japonica Group]
Length=278

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMV  590
            D+   +A    YA+P+VD++D  + F HRLYRPST +TEYREHVKDLSC+SKD  RIV+V
Sbjct  146  DMECISAEKARYAKPLVDRIDAHNRFCHRLYRPSTVTTEYREHVKDLSCLSKDFHRIVLV  205

Query  589  DNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFHMPEW  410
            DNNP+SFLLQPLNGIPC+ FSAGQP D+QL+ VI PLL+HLS Q DVRP LYETFHMPEW
Sbjct  206  DNNPYSFLLQPLNGIPCLTFSAGQPVDDQLMGVIFPLLKHLSLQNDVRPALYETFHMPEW  265

Query  409  FQKHGIP  389
            FQ+HGIP
Sbjct  266  FQRHGIP  272



>gb|KDO68955.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=276

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FADL+LFTAGLEGYARP+VD++D ++LF  RLYRPSTTSTEYREHVKDLSC+SKDL
Sbjct  164  QLSEFADLILFTAGLEGYARPLVDRIDGENLFSLRLYRPSTTSTEYREHVKDLSCLSKDL  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
             R ++VDNNPFSFLLQPLNGIPC+PFSAGQPHD
Sbjct  224  CRTLIVDNNPFSFLLQPLNGIPCIPFSAGQPHD  256



>ref|XP_002315157.2| NLI interacting factor family protein [Populus trichocarpa]
 gb|EEF01328.2| NLI interacting factor family protein [Populus trichocarpa]
Length=258

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F  RLYRPST+STEYREHVKDLSCISKD 
Sbjct  157  QLSEFAELVLFTAGLEGYARPLVDRIDTENRFSLRLYRPSTSSTEYREHVKDLSCISKDP  216

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
             RIV+VDNNPFSFLLQPLNGIPCVPFSAGQPHD
Sbjct  217  CRIVIVDNNPFSFLLQPLNGIPCVPFSAGQPHD  249



>gb|KCW65681.1| hypothetical protein EUGRSUZ_G03062 [Eucalyptus grandis]
Length=252

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L +FADLVLFTAGLEGYA+P+VD +DV++ F  RLYRPST STEYREHVKDLSC+SKDL
Sbjct  151  QLHEFADLVLFTAGLEGYAKPLVDTIDVENRFSLRLYRPSTISTEYREHVKDLSCLSKDL  210

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            SRIV+VDNNPFSFLLQP+NGIPC+PF+AGQPHD
Sbjct  211  SRIVIVDNNPFSFLLQPVNGIPCIPFTAGQPHD  243



>ref|XP_006843565.1| hypothetical protein AMTR_s00007p00087260 [Amborella trichopoda]
 gb|ERN05240.1| hypothetical protein AMTR_s00007p00087260 [Amborella trichopoda]
Length=254

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+L+LFTAGLE YARP+VD++D+++ F HRLYRPSTTST+YREHVKDLSC+SKDL
Sbjct  158  KLSEFAELILFTAGLEAYARPLVDRIDLENRFSHRLYRPSTTSTKYREHVKDLSCLSKDL  217

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
             RIV+VDNNPFSFLLQPLNGIPC+PFSAGQP+D
Sbjct  218  CRIVIVDNNPFSFLLQPLNGIPCLPFSAGQPND  250



>ref|XP_008370103.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Malus domestica]
Length=275

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            + +FADLVLFTAGLE YARP+VD++DV++LF  RLYRPST STE+REHVKDLSC+SKD S
Sbjct  163  VCEFADLVLFTAGLEDYARPLVDRIDVENLFKLRLYRPSTVSTEFREHVKDLSCLSKDFS  222

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDV  449
            RIV+VDNNPFSFLLQPLNGIPCVPFSAGQP+D+QLLEV+ PLL  LS QKDV
Sbjct  223  RIVIVDNNPFSFLLQPLNGIPCVPFSAGQPYDDQLLEVLHPLLMQLSLQKDV  274



>ref|XP_002312160.2| NLI interacting factor family protein [Populus trichocarpa]
 gb|EEE89527.2| NLI interacting factor family protein [Populus trichocarpa]
Length=307

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+LVLFTAGLEGYARP+VD++D ++ F  RLYRPSTTSTEY+EHVKDLSCIS D 
Sbjct  158  QLSEFAELVLFTAGLEGYARPLVDRIDTENRFSLRLYRPSTTSTEYQEHVKDLSCISNDP  217

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
             RIV+VDNNPFSFLLQPLNGIPCVPFSAGQPHD
Sbjct  218  CRIVIVDNNPFSFLLQPLNGIPCVPFSAGQPHD  250



>ref|XP_002990146.1| hypothetical protein SELMODRAFT_131171, partial [Selaginella 
moellendorffii]
 gb|EFJ08706.1| hypothetical protein SELMODRAFT_131171, partial [Selaginella 
moellendorffii]
Length=206

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +S+FA+LVLFTAGLEGYARP+VD++D ++    RLYRP+T  T YREH+KDLS + +DL 
Sbjct  69   VSQFAELVLFTAGLEGYARPLVDRIDPENRISARLYRPATLVTCYREHIKDLSRLGRDLR  128

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            R V++DNNP SF+LQP NGIPCVPF+A  P+D QLL+V+LPLLE L+ Q+DVRP L + +
Sbjct  129  RTVIIDNNPCSFILQPSNGIPCVPFTAENPNDSQLLDVLLPLLELLAAQEDVRPTLKDRY  188

Query  424  HMPEWFQKHGIPASR  380
             M  WF   GI  +R
Sbjct  189  EMAAWFHSRGILVTR  203



>ref|XP_002992543.1| hypothetical protein SELMODRAFT_135380, partial [Selaginella 
moellendorffii]
 gb|EFJ06481.1| hypothetical protein SELMODRAFT_135380, partial [Selaginella 
moellendorffii]
Length=206

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSR  602
            S+FA+LVLFTAGLEGYARP+VD++D ++    RLYRP+T  T YREH+KDLS + +DL R
Sbjct  70   SQFAELVLFTAGLEGYARPLVDRIDPENRISARLYRPATLVTCYREHIKDLSRLGRDLRR  129

Query  601  IVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFH  422
             V++DNNP SF+LQP NGIPCVPF+A  P+D QLL+V+LPLLE L+ Q+DVRP L + + 
Sbjct  130  TVIIDNNPCSFILQPSNGIPCVPFTAENPNDSQLLDVLLPLLELLAAQEDVRPTLKDRYE  189

Query  421  MPEWFQKHGIPASR  380
            M  WF   GI  +R
Sbjct  190  MAAWFHSRGILVTR  203



>gb|AAW22871.1| hypothetical protein 56B23-g1 [Solanum lycopersicum]
Length=98

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = -2

Query  655  EYREHVKDLSCISKDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilp-l  479
            EYREHVKDL CISKDLSRIV+VDNNPFSFLLQPLNGIPC+PFSAGQPHD Q L  ++  L
Sbjct  1    EYREHVKDLVCISKDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDIQQLLEVILPL  60

Query  478  lehLSQQKDVRPVLYETFHMPEWFQKHGIPASRAMNE  368
            L+HLS+QKDVRP LY+ FHMPE  QKHGIPAS   +E
Sbjct  61   LKHLSKQKDVRPELYDRFHMPECLQKHGIPASALTSE  97



>ref|XP_009609474.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM50-like, partial [Nicotiana tomentosiformis]
Length=95

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  655  EYREHVKDLSCISKDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpll  476
            E+REHVKDLS IS DL RIV+VDNNPFSFLLQPLNGIPC+PFS GQPHDEQLLEVILPLL
Sbjct  1    EFREHVKDLSSISTDLCRIVIVDNNPFSFLLQPLNGIPCIPFSPGQPHDEQLLEVILPLL  60

Query  475  ehLSQQKDVRPVLYETFHMPEWFQKHGIPASRAMN  371
            +HLS+QKDVRPVL+E F MPEWFQ HGIPA R M+
Sbjct  61   KHLSEQKDVRPVLHERFQMPEWFQNHGIPAYRFMD  95



>ref|XP_006294651.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
 gb|EOA27549.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
Length=272

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA+L+LFTA LE YARP+VD++D  H+  HRLYRPST +T+YR+HVKDL C+SK++
Sbjct  163  QLSQFANLILFTAALEDYARPLVDRIDTQHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNM  222

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
             R V+VDNNPF FLLQPLNGIPC  F+A QP+D
Sbjct  223  YRTVIVDNNPFCFLLQPLNGIPCDSFTAEQPND  255



>ref|XP_009762549.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM50-like [Nicotiana sylvestris]
Length=134

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  655  EYREHVKDLSCISKDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpll  476
            E+REHVKDLS ISKDL RIV+VDNNPFSFLLQPLNGIPC+PFS GQP DEQLLEVILPLL
Sbjct  40   EFREHVKDLSSISKDLCRIVIVDNNPFSFLLQPLNGIPCIPFSPGQPDDEQLLEVILPLL  99

Query  475  ehLSQQKDVRPVLYETFHMPEWFQKHGIPASRAM  374
            +HLS+QKDVRP+L+E F MPEWFQ HGIPA R M
Sbjct  100  KHLSEQKDVRPMLHERFQMPEWFQNHGIPAYRFM  133



>ref|XP_010517421.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X5 [Camelina sativa]
Length=273

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +LS+FA L+LFTA LE YARP+VD++D   +  HRLYRPST ST+YR+HVKDL C+SK++
Sbjct  164  QLSQFAHLILFTAALEDYARPIVDRIDTKRVLNHRLYRPSTISTQYRDHVKDLLCVSKNM  223

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
             R V+VDNNP+ FLLQPLNGIPC  FSA QP+D
Sbjct  224  CRTVIVDNNPYCFLLQPLNGIPCESFSAEQPND  256



>ref|XP_010231274.1| PREDICTED: uncharacterized protein LOC100829084 [Brachypodium 
distachyon]
Length=268

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 93/133 (70%), Gaps = 28/133 (21%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            + ++FADL+LFTAGLEGYARP+VD++D  + F HRLYRPST +T                
Sbjct  158  QTTEFADLILFTAGLEGYARPLVDRIDAHNRFCHRLYRPSTVTT----------------  201

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYET  428
                        FLLQPLNGIPC+ FSAGQP D+QL+ V+ PLL+HLS QKDVRP LY+T
Sbjct  202  ------------FLLQPLNGIPCLTFSAGQPMDDQLMGVVFPLLKHLSLQKDVRPALYDT  249

Query  427  FHMPEWFQKHGIP  389
            FHMPEWFQ+HGIP
Sbjct  250  FHMPEWFQRHGIP  262



>gb|AFW82277.1| hypothetical protein ZEAMMB73_719646 [Zea mays]
Length=295

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -2

Query  655  EYREHVKDLSCISKDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpll  476
            EYREHVKDLSC+SKD  RIV+VDNNP+SFLLQPLNGIPCV FSAGQP D+QL+  + PLL
Sbjct  201  EYREHVKDLSCLSKDFQRIVLVDNNPYSFLLQPLNGIPCVTFSAGQPVDDQLMGTMFPLL  260

Query  475  ehLSQQKDVRPVLYETFHMPEWFQKHGIP  389
            +HL+ QKDVRP LYE FHMPEWFQ+ GIP
Sbjct  261  KHLALQKDVRPALYEAFHMPEWFQRQGIP  289



>ref|XP_005648282.1| hypothetical protein COCSUDRAFT_63263 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23738.1| hypothetical protein COCSUDRAFT_63263 [Coccomyxa subellipsoidea 
C-169]
Length=209

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDH-LFIHRLYRPSTTSTEYREHVKDLSCISKD  611
             L++FA+L+LFTAG  GYA+ V++ LD D+ LF  +LYRP T  T  +++VKDL  + + 
Sbjct  60   SLAEFAELILFTAGHPGYAQLVIEMLDPDNRLFAAKLYRPETVRTHMQDYVKDLRRVGRC  119

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYE  431
            LSR V+VDN+PFS LLQP N +P  PF  G PHD QL+  +LP L  LS   DVRP L E
Sbjct  120  LSRTVLVDNDPFSGLLQPCNVVPARPFY-GDPHDRQLMRDLLPFLRGLSTLPDVRPTLAE  178

Query  430  TFHMPEWFQKHG  395
            +F++PE+F +HG
Sbjct  179  SFNVPEYFSRHG  190



>emb|CDP11904.1| unnamed protein product [Coffea canephora]
 emb|CDP04240.1| unnamed protein product [Coffea canephora]
Length=108

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -2

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            RI++ DNNPFSFLLQPLNGIPC+PFSAGQP DEQLLEVILPLL+HLSQQKDVRPVLYE F
Sbjct  24   RIILGDNNPFSFLLQPLNGIPCIPFSAGQPQDEQLLEVILPLLKHLSQQKDVRPVLYERF  83

Query  424  HMPEWFQKHGIPASRAMN  371
            HMPE FQ+HGIPAS   N
Sbjct  84   HMPEGFQRHGIPASWWGN  101



>ref|XP_001699661.1| hypothetical protein CHLREDRAFT_111940 [Chlamydomonas reinhardtii]
 gb|EDP07357.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=202

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCISKD  611
            EL+ FA++++FTAGLE YA+P++D +D  + LF HR+YR  T  T+Y + VKD++ +++D
Sbjct  67   ELATFAEVIIFTAGLEDYAKPIIDAIDPSNRLFAHRIYREGTLRTDYYQCVKDMARLNRD  126

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYE  431
            L R V+VD+ P +FL QP NG+P + F  G P D  LLE +LPL++ L+++ DVR  L  
Sbjct  127  LRRTVLVDDTPLAFLHQPDNGVPVLGFR-GDPDDRLLLEAVLPLMQVLAKEGDVRHTLQR  185

Query  430  TFHMPEWFQKHGIPAS  383
             F M  WF+++  P +
Sbjct  186  RFDMTTWFRRNNFPIT  201



>ref|XP_002501116.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO62374.1| predicted protein, partial [Micromonas sp. RCC299]
Length=144

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIH-RLYRPSTTSTEYREHVKDLSCISKD  611
            +L+ FA++ +FTAG+EGYA+P++D +D     IH RLYR +   T  R+HVKD+S + +D
Sbjct  18   QLATFAEVCVFTAGMEGYAKPLLDAIDPAGDSIHHRLYRQACVKTPIRDHVKDISRLGRD  77

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            LS  V+VDNNPFSFLLQP NGIP V F+ G P D
Sbjct  78   LSATVIVDNNPFSFLLQPHNGIPIVSFT-GDPGD  110



>ref|XP_002956598.1| hypothetical protein VOLCADRAFT_36131 [Volvox carteri f. nagariensis]
 gb|EFJ42365.1| hypothetical protein VOLCADRAFT_36131 [Volvox carteri f. nagariensis]
Length=119

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCISKD  611
            EL+ FA++V+FTAGLE YA+P++D LD    LF HR+YR  T  TE+ + VKD++ + +D
Sbjct  20   ELASFAEVVIFTAGLEDYAKPIIDALDPSGKLFAHRIYREGTLRTEFYQCVKDMARVGRD  79

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPFSA  524
            L++ V+VD+ P +FL QP NG+P + F  
Sbjct  80   LAKTVLVDDTPLAFLHQPDNGVPVLGFRG  108



>ref|XP_011401617.1| CTD small phosphatase-like protein, partial [Auxenochlorella 
protothecoides]
 gb|KFM28581.1| CTD small phosphatase-like protein, partial [Auxenochlorella 
protothecoides]
Length=185

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 77/126 (61%), Gaps = 3/126 (2%)
 Frame = -2

Query  778  KFADLVLFTAGLEGYARPVVDKLDVDH--LFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            + A++VLFTAGL  YA P+ D+L+  +   F HRLYRP+T  +     VKDL+ + + L 
Sbjct  61   RCAEVVLFTAGLAEYAVPICDELEARYPACFHHRLYRPATVPSADYPCVKDLARLGRPLG  120

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            R V+VD+ P +F  QP NGIP + F  G   D  L E + PL+E L+   DVR VL+  F
Sbjct  121  RTVLVDDTPLAFSFQPDNGIPVLQFR-GDVDDRLLNEALAPLIETLAAAHDVRSVLHARF  179

Query  424  HMPEWF  407
            +M  WF
Sbjct  180  NMRAWF  185



>ref|XP_005647998.1| hypothetical protein COCSUDRAFT_62990 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23454.1| hypothetical protein COCSUDRAFT_62990 [Coccomyxa subellipsoidea 
C-169]
Length=561

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD--VDHLFIHRLYRPSTTSTEYREHVKDLSCISK  614
            +L KFA++VLFTAGLE YA+P++D+LD   + +F +RLYRP+T +      +KDLS + +
Sbjct  468  QLCKFAEVVLFTAGLEDYAKPILDELDRRYNGVFEYRLYRPATVACSAYPCLKDLSRLGR  527

Query  613  DLSRIVMVDNNPFSFLLQPLNGIPCVPF  530
            DL R V+VD+ P +FL QP NGIP   F
Sbjct  528  DLRRTVLVDDTPLAFLRQPDNGIPIFNF  555



>ref|XP_002985448.1| hypothetical protein SELMODRAFT_5502, partial [Selaginella moellendorffii]
 gb|EFJ13578.1| hypothetical protein SELMODRAFT_5502, partial [Selaginella moellendorffii]
Length=146

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYRE-HVKDLSCISKD  611
            +++K  ++V+FTA ++ YA  ++DKLD + L  HRLYR S  S +  E  +KDLS + +D
Sbjct  60   DMAKLYEIVVFTAAMQYYADKILDKLDPEGLITHRLYRDSCVSCDGGETMIKDLSRLGRD  119

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPF  530
            L R+V+VD+NP SF LQP NGIP   F
Sbjct  120  LKRVVIVDDNPHSFSLQPRNGIPIPAF  146



>ref|XP_002979786.1| hypothetical protein SELMODRAFT_5501, partial [Selaginella moellendorffii]
 gb|EFJ19188.1| hypothetical protein SELMODRAFT_5501, partial [Selaginella moellendorffii]
Length=146

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYRE-HVKDLSCISKD  611
            +++K  ++V+FTA ++ YA  ++DKLD + L  HRLYR S  S +  E  +KDLS + +D
Sbjct  60   DMAKLYEIVVFTAAMQYYADKILDKLDPEGLITHRLYRDSCVSCDGGETMIKDLSRLGRD  119

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPF  530
            L R+V+VD+NP SF LQP NGIP   F
Sbjct  120  LKRVVIVDDNPHSFSLQPRNGIPIPAF  146



>ref|XP_008614870.1| hypothetical protein SDRG_10647 [Saprolegnia diclina VS20]
 gb|EQC31863.1| hypothetical protein SDRG_10647 [Saprolegnia diclina VS20]
Length=227

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 77/131 (59%), Gaps = 4/131 (3%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCISKD  611
            E S+  DL +FTAGLE Y +P++D LD  + LF  R +R S T  +    +KDL  I  D
Sbjct  93   EASQHFDLYVFTAGLEIYGKPILDALDPTNTLFKGRFFRTSCTQ-KSGFFMKDLRSIRSD  151

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYE  431
            LS++V+VDNNP SFL QP NGIP VP      HD+ L  +   ++   +   DVRP L++
Sbjct  152  LSKVVLVDNNPVSFLPQPSNGIP-VPSFYDDVHDKTLESLTKVVMTLRNVT-DVRPRLHQ  209

Query  430  TFHMPEWFQKH  398
             F + +   +H
Sbjct  210  LFRLADLLAEH  220



>gb|KDO32623.1| hypothetical protein SPRG_02324 [Saprolegnia parasitica CBS 223.65]
Length=227

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 78/131 (60%), Gaps = 4/131 (3%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCISKD  611
            E S+  DL +FTAGLE Y +P++D LD  + LF  R +R S T  +    +KDL  I  D
Sbjct  93   EASQHFDLYVFTAGLEIYGKPILDALDPTNTLFKGRFFRTSCTQ-KSGFFMKDLRSIRSD  151

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYE  431
            LS++V+VDNNP SFL QP NGIP VP      HD + LE +  ++  L    DVRP L++
Sbjct  152  LSKVVLVDNNPVSFLPQPSNGIP-VPSFYDDVHD-KTLESLTKVVMTLRDVTDVRPRLHQ  209

Query  430  TFHMPEWFQKH  398
             F + +   +H
Sbjct  210  LFRLADLLAEH  220



>gb|KFK44809.1| hypothetical protein AALP_AA1G305500 [Arabis alpina]
Length=197

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            + K   + +FTAGL  YA  V+DK+D + +   RLYR S T T  R + KDLS ++KDL 
Sbjct  77   IGKKYRVAVFTAGLPEYASQVLDKMDKNRVISQRLYRDSCTETNGR-YAKDLSLVAKDLG  135

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPF  530
             +++VD+NPFS+ LQP NG+P  PF
Sbjct  136  SVLIVDDNPFSYSLQPDNGVPIKPF  160



>ref|XP_009538580.1| hypothetical protein PHYSODRAFT_551168 [Phytophthora sojae]
 gb|AAV63948.1| putative nuclear LIM interactor-interacting protein [Phytophthora 
sojae]
 gb|EGZ05719.1| hypothetical protein PHYSODRAFT_551168 [Phytophthora sojae]
Length=237

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 9/134 (7%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCI-SK  614
            E +K  D+ +FTAGLE Y +P++D LD   +LF  R +R S    +    +KDLS +   
Sbjct  103  EAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGM-FLKDLSVVRGG  161

Query  613  DLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQ--KDVRPV  440
            DLSR+++VDNNP SFL+QP NGIP   F      D     +        S Q  +DVRP 
Sbjct  162  DLSRVILVDNNPVSFLMQPSNGIPVPSFY----DDANDRTLESLSKVLASLQDVEDVRPR  217

Query  439  LYETFHMPEWFQKH  398
            L++ F + +   +H
Sbjct  218  LHQLFRLADLLAEH  231



>ref|XP_008895497.1| hypothetical protein PPTG_04907 [Phytophthora parasitica INRA-310]
 gb|ETL85190.1| hypothetical protein L917_15170 [Phytophthora parasitica]
 gb|ETN19675.1| hypothetical protein PPTG_04907 [Phytophthora parasitica INRA-310]
 gb|ETP36286.1| hypothetical protein F442_15739 [Phytophthora parasitica P10297]
Length=237

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 9/134 (7%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCI-SK  614
            E +K  D+ +FTAGLE Y +P++D LD   +LF  R +R S    +    +KDLS +   
Sbjct  103  EAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGM-FLKDLSVVRGG  161

Query  613  DLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQ--KDVRPV  440
            DLSR+++VDNNP SFL+QP NGIP   F      D     +        S Q  +DVRP 
Sbjct  162  DLSRVILVDNNPVSFLMQPSNGIPVPSFY----DDANDRTLESLTKVLASLQDVEDVRPR  217

Query  439  LYETFHMPEWFQKH  398
            L++ F + +   +H
Sbjct  218  LHQLFRLADLLAEH  231



>gb|KJB66868.1| hypothetical protein B456_010G161800 [Gossypium raimondii]
Length=286

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            E+SK  ++V+FTAGLE YA  V+DKLD   L  +RLYR S    E +  VKDLS + +DL
Sbjct  155  EISKKHEVVVFTAGLEQYASQVLDKLDPKGLISYRLYRDSCKEMEEK-MVKDLSEMGRDL  213

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
             ++V+VD+NP ++ LQP N IP  PF
Sbjct  214  GKVVIVDDNPNAYTLQPENAIPIPPF  239



>gb|KIZ04779.1| hypothetical protein MNEG_3173 [Monoraphidium neglectum]
Length=669

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIH-RLYRPSTTSTEYREHVKDLSCISKD  611
            EL+ FA++V+FTAGL+ YA P++D +D    ++  R+YR  TT T++ + VKD+  + + 
Sbjct  518  ELAAFAEVVVFTAGLQEYAAPIIDAIDPGSKYVAARVYREGTTRTDHYQCVKDMRRVGRA  577

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            LSR V+VD+ P +FL QP NG+P + F  G P D
Sbjct  578  LSRTVLVDDTPLAFLHQPSNGVPVLGFR-GDPED  610



>ref|XP_011085316.1| PREDICTED: CTD small phosphatase-like protein [Sesamum indicum]
Length=295

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LSK  ++V+FTAG+E YA  V+D+LD   L  HRLYR S    + R  VKDLS I ++L+
Sbjct  168  LSKKFEIVVFTAGIEEYASLVLDRLDWRRLISHRLYRDSCKEVDGR-FVKDLSEIGRELN  226

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFS  527
            R+V+VD+NP S+  QP N IP  PF+
Sbjct  227  RVVIVDDNPNSYQFQPDNAIPIKPFT  252



>gb|AAV63941.1| putative nuclear LIM factor interactor-interacting protein hyphal 
form [Phytophthora infestans]
Length=237

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 76/132 (58%), Gaps = 5/132 (4%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCI-SK  614
            E +K  D+ +FTAGLE Y +P++D LD   +LF  R +R S    +    +KDL+ +   
Sbjct  103  EAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGM-FLKDLNVVRGG  161

Query  613  DLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLY  434
            DLSR+++VDNNP SFL+QP NGIP VP      +D  L  +   L      + DVRP L+
Sbjct  162  DLSRVILVDNNPVSFLMQPSNGIP-VPSFYDDANDRTLESLSKVLASLQDDE-DVRPRLH  219

Query  433  ETFHMPEWFQKH  398
            + F + +   +H
Sbjct  220  QLFRLADLLAEH  231



>ref|XP_002906966.1| CTD small phosphatase-like protein, putative [Phytophthora infestans 
T30-4]
 ref|XP_002909873.1| CTD small phosphatase-like protein, putative [Phytophthora infestans 
T30-4]
 gb|EEY59479.1| CTD small phosphatase-like protein, putative [Phytophthora infestans 
T30-4]
 gb|EEY66367.1| CTD small phosphatase-like protein, putative [Phytophthora infestans 
T30-4]
Length=237

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 9/134 (7%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCI-SK  614
            E +K  D+ +FTAGLE Y +P++D LD   +LF  R +R S    +    +KDL+ +   
Sbjct  103  EAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGM-FLKDLNVVRGG  161

Query  613  DLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQ--KDVRPV  440
            DLSR+++VDNNP SFL+QP NGIP   F      D     +        S Q  +DVRP 
Sbjct  162  DLSRVILVDNNPVSFLMQPSNGIPVPSFY----DDANDRTLESLSKVLASLQDVEDVRPR  217

Query  439  LYETFHMPEWFQKH  398
            L++ F + +   +H
Sbjct  218  LHQLFRLADLLAEH  231



>gb|ETI38295.1| hypothetical protein F443_15895 [Phytophthora parasitica P1569]
 gb|ETK78533.1| hypothetical protein L915_15448 [Phytophthora parasitica]
 gb|ETL31971.1| hypothetical protein L916_15343 [Phytophthora parasitica]
 gb|ETM38354.1| hypothetical protein L914_15308 [Phytophthora parasitica]
 gb|ETP08221.1| hypothetical protein F441_15730 [Phytophthora parasitica CJ01A1]
Length=237

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 73/134 (54%), Gaps = 9/134 (7%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCI-SK  614
            E  K  D+ +FTAGLE Y +P++D LD   +LF  R +R S    +    +KDLS +   
Sbjct  103  EAVKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGM-FLKDLSVVRGG  161

Query  613  DLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQ--KDVRPV  440
            DLSR+++VDNNP SFL+QP NGIP   F      D     +        S Q  +DVRP 
Sbjct  162  DLSRVILVDNNPVSFLMQPSNGIPVPSFY----DDANDRTLESLTKVLASLQDVEDVRPR  217

Query  439  LYETFHMPEWFQKH  398
            L++ F + +   +H
Sbjct  218  LHQLFRLADLLAEH  231



>gb|ETO67065.1| hypothetical protein F444_15879 [Phytophthora parasitica P1976]
Length=237

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 73/134 (54%), Gaps = 9/134 (7%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCI-SK  614
            E  K  D+ +FTAGLE Y +P++D LD   +LF  R +R S    +    +KDLS +   
Sbjct  103  EAVKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGM-FLKDLSVVRGG  161

Query  613  DLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQ--KDVRPV  440
            DLSR+++VDNNP SFL+QP NGIP   F      D     +        S Q  +DVRP 
Sbjct  162  DLSRVILVDNNPVSFLMQPSNGIPVPSFY----DDANDRTLESLTKVLASLQDVEDVRPR  217

Query  439  LYETFHMPEWFQKH  398
            L++ F + +   +H
Sbjct  218  LHQLFRLADLLAEH  231



>ref|XP_008388217.1| PREDICTED: uncharacterized protein LOC103450630 [Malus domestica]
Length=216

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  577  FSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETFHMPEWFQKH  398
            F FLLQPLNGIPCVPFSAGQP+D+ LLEV+LPLL+ LS QKDVRP L E FHM EWFQ H
Sbjct  151  FRFLLQPLNGIPCVPFSAGQPYDDLLLEVLLPLLKQLSLQKDVRPTLQERFHMAEWFQMH  210

Query  397  G  395
            G
Sbjct  211  G  211



>ref|XP_007025282.1| Haloacid dehalogenase hydrolase domain-containing protein [Theobroma 
cacao]
 gb|EOY27904.1| Haloacid dehalogenase hydrolase domain-containing protein [Theobroma 
cacao]
Length=304

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +SK  +LV+FTAG   YA  V+D LD   L  HRLYR S      R  VKDLS + +DL 
Sbjct  184  ISKKYELVVFTAGHVAYASKVLDTLDPKGLISHRLYRDSCKQVRGR-FVKDLSRLGRDLR  242

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            + V+VD+NP SF LQP NGIP  PF   Q  D
Sbjct  243  KTVIVDDNPKSFALQPKNGIPIKPFVGDQLWD  274



>ref|XP_004309632.1| PREDICTED: CTD small phosphatase-like protein [Fragaria vesca 
subsp. vesca]
Length=355

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L++  ++V FTAG+  YA  V+D+LD      HRLYR S     Y + VKDLS + +DL
Sbjct  132  KLAEKYEVVAFTAGMREYASLVLDRLDSQGFISHRLYRDSCKEV-YGKFVKDLSGLGRDL  190

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
             R+V+VD+NP S+ LQP NGIP  PF
Sbjct  191  RRVVIVDDNPNSYFLQPDNGIPVRPF  216



>gb|KJB69665.1| hypothetical protein B456_011G036100 [Gossypium raimondii]
Length=317

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            E+SK  ++V+FTAGL+ YA  V+DKLD   L  HRLYR S      +  VKDLS + +DL
Sbjct  184  EISKKHEVVVFTAGLKQYASQVLDKLDPKGLISHRLYRDSCKELNGK-FVKDLSEMGRDL  242

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
             RIV+VD+NP ++ LQP N +P  PF
Sbjct  243  GRIVIVDDNPNAYSLQPENAVPIRPF  268



>ref|XP_005537320.1| mitochondrial presequence translocase subunit Tim50 [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM81284.1| mitochondrial presequence translocase subunit Tim50 [Cyanidioschyzon 
merolae strain 10D]
Length=404

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 63/94 (67%), Gaps = 5/94 (5%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYRE--HVKDLSCISKD  611
            +++F ++V+FT+ L GYA P++D++D +    HRLYR     T+YR+  H+KDL+ +++D
Sbjct  183  MAQFYEIVVFTSALPGYADPILDRMDPNGYITHRLYR---HETKYRDGLHMKDLAKLNRD  239

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            L R +++DN+P  F LQ  NGI   P++   P D
Sbjct  240  LRRTIIIDNDPRVFALQSENGIEIAPWNGTDPDD  273



>gb|EPS60408.1| hypothetical protein M569_14397, partial [Genlisea aurea]
Length=243

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS   ++ +FTAG+E YA  VVD LD   L  HRLYR S    +  + VKDLS I ++L 
Sbjct  132  LSSRYEVAVFTAGIEEYASLVVDGLDRRKLISHRLYRDSCREMDG-QFVKDLSEIGRELK  190

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFS  527
            R+V+VD+NPFS+  QP N +P  PF+
Sbjct  191  RVVIVDDNPFSYRFQPENAVPIKPFT  216



>gb|KDP21150.1| hypothetical protein JCGZ_21621 [Jatropha curcas]
Length=296

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMV  590
            +LV+FTAGL+ YA  V+DKLDV  L  HRLYR S    + +  VKDLS + +D+ RIV++
Sbjct  176  ELVVFTAGLKEYASLVLDKLDVKGLISHRLYRDSCKEVDGK-FVKDLSEMGRDMKRIVII  234

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NP  +  QP N IP  PF
Sbjct  235  DDNPNCYSFQPENAIPVRPF  254



>ref|XP_009593846.1| PREDICTED: probable C-terminal domain small phosphatase [Nicotiana 
tomentosiformis]
Length=295

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+  ++V+FTAGL+ YA  V+D++D   L  HRLYR S    + +  VKDLS + +D+ 
Sbjct  167  LSEKFEVVVFTAGLKEYASLVLDRIDRKGLISHRLYRDSCKEVDGK-FVKDLSDMGRDMK  225

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFS  527
            R+V+VD+NP S+L QP N IP  PF+
Sbjct  226  RVVIVDDNPNSYLFQPENAIPIRPFT  251



>ref|XP_010538232.1| PREDICTED: probable C-terminal domain small phosphatase [Tarenaya 
hassleriana]
Length=255

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -2

Query  766  LVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCI-SKDLSRIVMV  590
            + +FTAG+  YA  V+DKLD+ H+   RLYR S       ++VKDLS +   DL  ++MV
Sbjct  139  VAIFTAGISEYASQVLDKLDMKHVISQRLYRDSCKEVVTGKYVKDLSLVEGNDLGNVLMV  198

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NPFSF L P NG+P  PF
Sbjct  199  DDNPFSFSLHPENGLPIKPF  218



>ref|XP_009776554.1| PREDICTED: probable C-terminal domain small phosphatase [Nicotiana 
sylvestris]
Length=294

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+  ++V+FTAGL+ YA  V+D++D   L  HRLYR S    + +  VKDLS + +D+ 
Sbjct  167  LSEKFEVVVFTAGLKEYASLVLDRIDRKGLISHRLYRDSCKEVDGK-FVKDLSDMGRDMK  225

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFS  527
            R+V+VD+NP S+L QP N IP  PF+
Sbjct  226  RVVIVDDNPNSYLFQPENAIPIRPFT  251



>ref|XP_009351769.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Pyrus x bretschneideri]
Length=288

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L    ++V+FTAGL  YA  V+D+LD      HRLYR +    + +  VKDLS + +DL
Sbjct  155  KLGAMYEVVVFTAGLREYASLVLDRLDRKRAISHRLYRDACKEVDGK-FVKDLSGLGRDL  213

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
            SR+V+VD+NP S+L QP N +P  PF
Sbjct  214  SRVVIVDDNPNSYLFQPENAVPVRPF  239



>ref|XP_007025284.1| Haloacid dehalogenase-like hydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY27906.1| Haloacid dehalogenase-like hydrolase superfamily protein, putative 
[Theobroma cacao]
Length=319

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            E+SK  ++V+FTAGL+ YA  V+DKLD   L  +RLYR S    E +  VKDLS + +DL
Sbjct  178  EISKKYEVVVFTAGLKQYASQVLDKLDPKGLISYRLYRDSCKQVEGK-FVKDLSEMGRDL  236

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
             ++V+VD+NP ++ LQP N +P  PF
Sbjct  237  GKVVIVDDNPNAYSLQPENAVPIRPF  262



>ref|XP_010549563.1| PREDICTED: probable C-terminal domain small phosphatase [Tarenaya 
hassleriana]
Length=252

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = -2

Query  766  LVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLS-CISKDLSRIVMV  590
            +V+FTAGLE YA  V+DKLD + +   RLYR S      + +VKDLS  + KDL  ++MV
Sbjct  136  VVVFTAGLEDYASQVLDKLDQNRVISQRLYRDSCKEVNGK-YVKDLSLVVGKDLGSVLMV  194

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NPFS+  QP NG+P  PF
Sbjct  195  DDNPFSYSFQPENGLPIKPF  214



>ref|XP_002983484.1| hypothetical protein SELMODRAFT_5512, partial [Selaginella moellendorffii]
 gb|EFJ15385.1| hypothetical protein SELMODRAFT_5512, partial [Selaginella moellendorffii]
Length=137

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +++K  ++V+FTA  + YA  ++DKLD + L  HRLYR S  S +    +KDLS + +DL
Sbjct  52   DMAKLYEIVVFTASKQYYADTILDKLDPEGLITHRLYRESCVSCDGETMIKDLSRLGRDL  111

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
             R+V+VD+ P  F LQP NGI    F
Sbjct  112  KRVVIVDDKPHYFSLQPRNGIQIPAF  137



>ref|XP_008371514.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Malus domestica]
Length=288

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L    ++V+FTAGL  YA  V+D+LD      HRLYR +    + +  VKDLS + +DL
Sbjct  155  KLGAMYEVVVFTAGLREYASLVLDRLDRKRAISHRLYRDACKEVDGK-FVKDLSGLGRDL  213

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
            SR+V+VD+NP S+L QP N +P  PF
Sbjct  214  SRVVIVDDNPNSYLFQPENAVPVRPF  239



>emb|CDO96877.1| unnamed protein product [Coffea canephora]
Length=293

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS   ++V+FTAG+E YA  V+D++D   L  HRLYR S    + +  VKDLS + +DL 
Sbjct  169  LSNKFEIVVFTAGIEEYASQVLDRIDGKGLVSHRLYRDSCKELDGK-FVKDLSELGRDLK  227

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPF  530
            R+V+VD+NP S++ QP N +P +PF
Sbjct  228  RVVIVDDNPNSYVFQPDNALPILPF  252



>ref|XP_002974008.1| hypothetical protein SELMODRAFT_5873, partial [Selaginella moellendorffii]
 gb|EFJ24963.1| hypothetical protein SELMODRAFT_5873, partial [Selaginella moellendorffii]
Length=137

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +++K  ++V+FTA  + YA  ++DKLD + L  HRLYR S  S +    +KDLS + +DL
Sbjct  52   DMAKLYEIVVFTASKQYYADTILDKLDPEGLITHRLYRESCVSCDGETMIKDLSRLGRDL  111

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
             R+V+VD+ P  F LQP NGI    F
Sbjct  112  RRVVIVDDKPHYFSLQPRNGIQIPAF  137



>ref|XP_007213826.1| hypothetical protein PRUPE_ppa009682mg [Prunus persica]
 gb|EMJ15025.1| hypothetical protein PRUPE_ppa009682mg [Prunus persica]
Length=282

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            L++  +LV+FTAGL  YA  V+D+LD + +  HRLYR +    + +  VKDLS + +DLS
Sbjct  152  LAEKYELVVFTAGLREYASLVLDRLDRNRVISHRLYRDACKEVDGK-LVKDLSGLGRDLS  210

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPF  530
            R V+VD+NP S+ LQP N +P  PF
Sbjct  211  RAVIVDDNPNSYSLQPENAVPVRPF  235



>ref|XP_010499496.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=283

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISK-DL  608
            +SK   + +FTAGL  YA  ++DK+D + +   RLYR S T    R + KDLS ++K DL
Sbjct  161  ISKNYRVAIFTAGLPEYASQILDKVDKNRVISQRLYRDSCTEMNGR-YAKDLSLVTKTDL  219

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
              +++VD+NPFS+ LQP NGIP +PF
Sbjct  220  GSVLLVDDNPFSYSLQPDNGIPIIPF  245



>ref|XP_004309622.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=293

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L +  ++V+FTAGL  YA  V+D+LD   +  HRL+R S    + +  VKDLS + +DL
Sbjct  158  KLGEKYEVVVFTAGLREYASLVLDRLDRKRVISHRLFRDSCKEVDGK-FVKDLSGLGRDL  216

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
             R+V+VD+NP S+ LQP NG+P  PF
Sbjct  217  RRVVIVDDNPNSYSLQPENGVPVRPF  242



>ref|XP_011462148.1| PREDICTED: CTD small phosphatase-like protein [Fragaria vesca 
subsp. vesca]
Length=352

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L++  ++V+FTAG+  YA  V+D+LD      HRLYR S     Y + VKDLS + +DL
Sbjct  133  KLAEKYEVVVFTAGMREYASLVLDRLDRQGFISHRLYRDSCKEV-YGKFVKDLSGLGRDL  191

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
             R+V+VD+NP S+ LQ  NGIP  PF
Sbjct  192  RRVVIVDDNPNSYFLQSENGIPVRPF  217



>ref|XP_008225241.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Prunus mume]
Length=284

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            L++  +LV+FTAGL  YA  V+D+LD + +  HRLYR +    + +  VKDLS + +DLS
Sbjct  152  LAEKYELVVFTAGLREYASLVLDRLDRNRVISHRLYRDACKEVDGK-LVKDLSGLGRDLS  210

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPF  530
            R V+VD+NP S+ LQP N +P  PF
Sbjct  211  RAVIVDDNPNSYSLQPENAVPVRPF  235



>ref|XP_010462980.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=281

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISK-DL  608
            +SK   + +FTAGL  YA  ++DK+D + +   RLYR S T    R + KDLS ++K DL
Sbjct  159  ISKNYRVAIFTAGLPEYASQILDKVDKNRVISQRLYRDSCTEMNGR-YAKDLSLVTKTDL  217

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
              +++VD+NPFS+ LQP NG+P +PF
Sbjct  218  GSVLLVDDNPFSYSLQPDNGVPIIPF  243



>emb|CEG65560.1| hypothetical protein RMATCC62417_02324 [Rhizopus microsporus]
Length=302

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 4/132 (3%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+F ++V+FT+     A P++DKLD     ++RLYR  T   + + +VKDLS +++DLS
Sbjct  58   LSQFYEIVVFTSQPAMNAAPILDKLDPYQYAMYRLYRDGTRYIDGK-YVKDLSYLNRDLS  116

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL--YE  431
            +++++D+NP SF LQP NGI   P+         L  +       L+   DVRPVL  +E
Sbjct  117  KVIIMDSNPESFSLQPENGIALKPWKGNADDKGLLEYIPFLEAVALTNPPDVRPVLKSFE  176

Query  430  TFHMP-EWFQKH  398
              ++P EW ++ 
Sbjct  177  GTYIPVEWAKRE  188



>ref|XP_006449562.1| hypothetical protein CICLE_v10016126mg [Citrus clementina]
 gb|ESR62802.1| hypothetical protein CICLE_v10016126mg [Citrus clementina]
Length=292

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +SK  ++V+FTAGL+ YA  V+++LD D +  HRLYR S    + +  VKDLS + ++L 
Sbjct  165  ISKKYEVVVFTAGLKEYASLVLNRLDRDGVISHRLYRDSCKQIDGK-FVKDLSEMGRNLK  223

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            ++V+VD+NP +++ QP N IP  PF+ G P D
Sbjct  224  QVVIVDDNPNAYIFQPENAIPVKPFT-GDPSD  254



>ref|XP_002978918.1| hypothetical protein SELMODRAFT_418692 [Selaginella moellendorffii]
 gb|EFJ19875.1| hypothetical protein SELMODRAFT_418692 [Selaginella moellendorffii]
Length=218

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEY--REHVKDLSCIS  617
            E+SK  ++V+FT  ++ YA  ++D+LD   +LF HRLYR S ++ E   R+ VKDLS + 
Sbjct  90   EMSKIYEIVVFTRAVKPYADRILDRLDPAGNLFAHRLYRDSCSTKEVGGRKVVKDLSRLG  149

Query  616  KDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL  437
            +DL   V+VD+ P SF LQP NGI    F   + H    L+ I  LL+ +++ +DVR  L
Sbjct  150  RDLRHTVIVDDKPESFFLQPNNGIVIRAFKNRKGHKYDELKTISNLLKEIARVEDVRQAL  209



>ref|XP_009352935.1| PREDICTED: CTD small phosphatase-like protein [Pyrus x bretschneideri]
Length=283

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L    ++V+FTAGL  YA  V+D+LD   +  HRLYR + T    R  VKDLS + +DL
Sbjct  139  KLGNKYEVVVFTAGLREYATLVLDRLDRKRVISHRLYRDTCTEVNGR-FVKDLSGLGRDL  197

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
            SR+V+VD+NP ++  QP N +P  PF
Sbjct  198  SRLVIVDDNPNAYCFQPENAVPIRPF  223



>ref|XP_009352715.1| PREDICTED: CTD small phosphatase-like protein [Pyrus x bretschneideri]
Length=288

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMV  590
            ++V+FTAGL  YA  V+D+LD   +  HRLYR +    + +  VKDLS + +DLSR+V+V
Sbjct  161  EVVVFTAGLREYASLVLDRLDQKRVISHRLYRDACKEVDGK-FVKDLSRLGRDLSRVVIV  219

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NP S++ QP N +P  PF
Sbjct  220  DDNPNSYIFQPENAVPVRPF  239



>ref|NP_174270.1| haloacid dehalogenase-like hydrolase [Arabidopsis thaliana]
 gb|AAG10617.1|AC008030_17 Hypothetical protein [Arabidopsis thaliana]
 gb|AAT06423.1| At1g29770 [Arabidopsis thaliana]
 gb|AAT41825.1| At1g29770 [Arabidopsis thaliana]
 gb|AEE31127.1| haloacid dehalogenase-like hydrolase [Arabidopsis thaliana]
Length=278

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISK-D  611
             +SK   + +FTAGL  YA  V+DKLD + +   RLYR S T    R + KDLS ++K D
Sbjct  155  RISKNYRVAIFTAGLPEYASQVLDKLDKNRVISQRLYRDSCTEVNGR-YAKDLSLVAKND  213

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPF  530
            L  +++VD+NPFS+ LQP NG+P  PF
Sbjct  214  LGSVLLVDDNPFSYSLQPDNGVPIKPF  240



>ref|XP_008383597.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Malus domestica]
Length=288

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMV  590
            ++V+FTAGL  YA  V+D+LD   +  HRLYR +    + +  VKDLS + +DLSR+V+V
Sbjct  161  EVVVFTAGLREYASLVLDRLDQKRVISHRLYRDACKEVDGK-FVKDLSGLGRDLSRVVIV  219

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NP S++ QP N +P  PF
Sbjct  220  DDNPNSYVFQPDNAVPVRPF  239



>ref|XP_010478348.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=283

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISK-D  611
             +SK   + +FTAGL  YA  ++DKLD + +   RLYR S T    R + KDLS + K D
Sbjct  160  RISKNYRVAIFTAGLPEYASQILDKLDKNRVISQRLYRDSCTEMNGR-YAKDLSLVIKTD  218

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPF  530
            L  +++VD+NPFS+ LQP NG+P +PF
Sbjct  219  LGSVLLVDDNPFSYSLQPDNGVPIIPF  245



>ref|XP_001439574.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK72177.1| unnamed protein product [Paramecium tetraurelia]
Length=596

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            ++ K  ++V+FTAG++ YA  ++DK+DV ++  HRLYR  T S +    +KDLS + + L
Sbjct  469  QMGKHFEIVIFTAGIQSYADKIIDKIDVMNVVKHRLYRHHTFS-QGNVMLKDLSTLGRPL  527

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
            S+ ++VDNNP++F+LQP NGI    +
Sbjct  528  SKTIIVDNNPYNFVLQPHNGIKIKAW  553



>gb|KJB69664.1| hypothetical protein B456_011G036000 [Gossypium raimondii]
Length=346

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +SK  ++V+FTAGLE YA  ++D LD   L  HRLYR S      R   KDLS I +DL 
Sbjct  195  ISKKYEVVVFTAGLEQYASLLLDVLDPKGLISHRLYRDSCKPLVKRRFAKDLSTIGRDLE  254

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPF  530
             +V+VD+NP S+ LQP N IP   F
Sbjct  255  NVVIVDDNPRSYALQPANAIPIKRF  279



>ref|XP_002264996.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Vitis vinifera]
Length=285

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L +  ++V+FTAGL  YA  V+D+LD   +  HRLYR S    + +  VKDLS + +DL
Sbjct  158  KLGEKFEIVVFTAGLREYASLVLDRLDKKGMISHRLYRDSCKEIDGK-FVKDLSDLGRDL  216

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
             R+V+VD+NP ++ LQP N IP  PF
Sbjct  217  KRVVIVDDNPNAYFLQPENAIPMPPF  242



>ref|XP_006304077.1| hypothetical protein CARUB_v10009936mg [Capsella rubella]
 gb|EOA36975.1| hypothetical protein CARUB_v10009936mg [Capsella rubella]
Length=284

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = -2

Query  766  LVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISK-DLSRIVMV  590
            + +FTAGL  YA  ++DKLD +H+   RLYR S T    R + KDLS ++K DL  I++V
Sbjct  168  VAIFTAGLPEYASQILDKLDKNHVISRRLYRDSCTEMNGR-YAKDLSLVTKEDLGSILLV  226

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NPFS+ LQP NG+P + F
Sbjct  227  DDNPFSYSLQPENGVPIMRF  246



>ref|XP_005826001.1| hypothetical protein GUITHDRAFT_165068 [Guillardia theta CCMP2712]
 gb|EKX39021.1| hypothetical protein GUITHDRAFT_165068 [Guillardia theta CCMP2712]
Length=468

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            L +  ++V FT+GL  YA P++D+LD++ +  HRL+R  T   +   HVKDLS ++++L+
Sbjct  105  LGEKYEIVCFTSGLREYASPIIDQLDMNGIIAHRLFREHTCHLKGL-HVKDLSRLNRNLA  163

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPF  530
            + ++VDN+P S+L+QP N IP  PF
Sbjct  164  KTIIVDNSPESYLMQPENAIPIKPF  188



>emb|CEG65559.1| hypothetical protein RMATCC62417_02324 [Rhizopus microsporus]
Length=430

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 4/132 (3%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+F ++V+FT+     A P++DKLD     ++RLYR  T   + + +VKDLS +++DLS
Sbjct  186  LSQFYEIVVFTSQPAMNAAPILDKLDPYQYAMYRLYRDGTRYIDGK-YVKDLSYLNRDLS  244

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL--YE  431
            +++++D+NP SF LQP NGI   P+         L  +       L+   DVRPVL  +E
Sbjct  245  KVIIMDSNPESFSLQPENGIALKPWKGNADDKGLLEYIPFLEAVALTNPPDVRPVLKSFE  304

Query  430  TFHMP-EWFQKH  398
              ++P EW ++ 
Sbjct  305  GTYIPVEWAKRE  316



>gb|EYU43303.1| hypothetical protein MIMGU_mgv1a011086mg [Erythranthe guttata]
Length=293

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS   ++V+FTAG+E YA  V+DKLD   L  HRLYR S    + R +VKDLS   ++L 
Sbjct  171  LSDKFEIVVFTAGIEAYASLVLDKLDWRKLISHRLYRDSCKEVDGR-YVKDLSEFGRELD  229

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFS  527
            ++V+VD+NP S+  QP N IP   F+
Sbjct  230  KVVIVDDNPNSYQFQPDNAIPIKAFT  255



>emb|CEI87716.1| hypothetical protein RMCBS344292_02125 [Rhizopus microsporus]
Length=430

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 4/132 (3%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+F ++V+FT+     A P++DKLD     ++RLYR  T   + + +VKDLS +++DLS
Sbjct  186  LSQFYEIVIFTSQPAMNAAPILDKLDPYQYAMYRLYRDGTRYIDGK-YVKDLSYLNRDLS  244

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL--YE  431
            +++++D+NP SF LQP NGI   P+         L  +       L+   DVRPVL  +E
Sbjct  245  KVIIMDSNPESFSLQPENGIALKPWKGKADDKGLLEYIPFLEAVALTNPPDVRPVLKSFE  304

Query  430  TFHMP-EWFQKH  398
              ++P EW ++ 
Sbjct  305  GTYIPVEWAKRE  316



>ref|XP_010248403.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 2-like [Nelumbo nucifera]
Length=297

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMV  590
            ++V+FTAGL+ YA  V+DK+D   L  HRLYR S    + +  VKDLS + +DL R+V+V
Sbjct  169  EIVVFTAGLKEYASLVLDKIDPKGLISHRLYRDSCKEMDGK-FVKDLSEVGRDLKRVVIV  227

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NP +++ QP N +P  PF
Sbjct  228  DDNPNAYVFQPENALPVRPF  247



>gb|AAV63939.1| putative nuclear LIM factor interactor-interacting protein cleavage-specific 
form [Phytophthora infestans]
Length=325

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            E++KF ++V++TA L  YA P++DKLD + +  HRLYR      E   +VKDLS + +D+
Sbjct  205  EMAKFYEIVVYTASLSKYADPLLDKLDPEGVIRHRLYREHCVQYE-GSYVKDLSLLDRDI  263

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
            S+ +++DN P S++  P N I C  F
Sbjct  264  SQTIIIDNAPMSYIFHPRNAIGCSSF  289



>ref|XP_006415548.1| hypothetical protein EUTSA_v10009586mg [Eutrema salsugineum]
 gb|ESQ33901.1| hypothetical protein EUTSA_v10009586mg [Eutrema salsugineum]
Length=286

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISK-DL  608
            + K   + +FTAGL  YA  V+DKLD + +   RLYR S T    R + KDLS +++ DL
Sbjct  166  IGKNYRVAVFTAGLAEYASQVLDKLDKNRVISQRLYRDSCTEMSGR-YAKDLSLVARTDL  224

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
              +++VD+NPFS+ LQP NG+P  PF
Sbjct  225  GSVLLVDDNPFSYSLQPENGVPIKPF  250



>ref|XP_002890829.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67088.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=277

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISK-D  611
             +SK   + +FTAGL  YA  V+DKLD + +   RLYR S T    R + KDLS ++K D
Sbjct  154  RISKNYRVAIFTAGLPEYASQVLDKLDKNRVISQRLYRDSCTEMNGR-YAKDLSLVAKND  212

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPF  530
            L  +++VD+NPFS+  QP NG+P  PF
Sbjct  213  LGSVLLVDDNPFSYSFQPDNGVPIKPF  239



>ref|XP_002901996.1| NLI interacting factor-like phosphatase, putative [Phytophthora 
infestans T30-4]
 gb|EEY57386.1| NLI interacting factor-like phosphatase, putative [Phytophthora 
infestans T30-4]
Length=325

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            E++KF ++V++TA L  YA P++DKLD + +  HRLYR      E   +VKDLS + +D+
Sbjct  205  EMAKFYEIVVYTASLSKYADPLLDKLDPEGVIRHRLYREHCVQYEG-SYVKDLSLLDRDI  263

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
            S+ +++DN P S++  P N I C  F
Sbjct  264  SQTIIIDNAPMSYIFHPRNAIGCSSF  289



>ref|XP_006304661.1| hypothetical protein CARUB_v10011857mg [Capsella rubella]
 gb|EOA37559.1| hypothetical protein CARUB_v10011857mg [Capsella rubella]
Length=221

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 57/86 (66%), Gaps = 2/86 (2%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLS-CISKDL  608
            L++   +V+FTAGLE YA  V+DKLD +H+   RLYR S T    + +VKDLS  + KDL
Sbjct  102  LAESYKVVVFTAGLEDYASQVLDKLDKNHVISQRLYRDSCTEVNGK-YVKDLSLVVGKDL  160

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
               ++VD+NP S+ LQP NG+P   F
Sbjct  161  RSALIVDDNPSSYSLQPDNGVPIKAF  186



>gb|KJB66824.1| hypothetical protein B456_010G162100 [Gossypium raimondii]
Length=317

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +SK  ++V+FTAGLE YA  ++D LD   L  HRLYR S         +KDLS I +DL 
Sbjct  187  ISKKYEVVVFTAGLEPYASLLLDILDPKGLISHRLYRDSCKQLGRGRFIKDLSKIGRDLK  246

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFS  527
            ++V+VD+NP S+ LQP N IP   F 
Sbjct  247  QVVIVDDNPKSYTLQPANAIPIKRFE  272



>ref|XP_008383866.1| PREDICTED: CTD small phosphatase-like protein [Malus domestica]
Length=351

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMV  590
            ++V+FTAGL  YA  V+D+LD   +  HRLYR + T    R  VKDLS + +DLSR+V+V
Sbjct  146  EVVVFTAGLREYATLVLDRLDRKRVISHRLYRDTCTEINGR-FVKDLSGLGRDLSRLVIV  204

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NP ++  QP N +P  PF
Sbjct  205  DDNPNAYCFQPENAVPIRPF  224



>gb|KJB69663.1| hypothetical protein B456_011G035900 [Gossypium raimondii]
Length=306

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +SK  ++V+FTAG + YA  V+D LD   L  HR YR S      +  +KDLS I +DL 
Sbjct  184  ISKKYEVVVFTAGHKAYASKVIDTLDPKGLISHRFYRDSCKQVRGK-FIKDLSEIGRDLR  242

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            + V+VD+NP S+ LQP NGIP  PF   +  D
Sbjct  243  KTVIVDDNPKSYSLQPENGIPIKPFYGDELWD  274



>ref|XP_011039376.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Populus euphratica]
Length=292

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMV  590
            ++V+FTAGL+ YA  V+D++D   L  HRLYR S    + +  VKDLS + +DL R+V+V
Sbjct  169  EVVVFTAGLKEYASLVLDRIDTKGLISHRLYRDSCKEIDGK-FVKDLSEMGRDLRRVVIV  227

Query  589  DNNPFSFLLQPLNGIPCVPFS  527
            D+NP  ++ QP N IP  PF+
Sbjct  228  DDNPNCYIYQPKNAIPVKPFT  248



>emb|CEP17909.1| hypothetical protein [Parasitella parasitica]
Length=439

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 87/133 (65%), Gaps = 6/133 (5%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+F ++V+FT+     A P++DKLD     ++RLYR +T   + + +VKDLS +++DLS
Sbjct  192  LSQFYEIVIFTSQSSMNAMPLLDKLDPYQYAMYRLYREATRYVDGK-YVKDLSHLNRDLS  250

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevi-lpllehLSQQKDVRPVL--Y  434
            +++++D+NP SF LQP NGI   P+  GQ +D+ LLE I       L+  +D+RPVL  +
Sbjct  251  KVIIMDSNPDSFSLQPENGIALKPWK-GQVNDQGLLEYIPFLEAVALTTPEDIRPVLKSF  309

Query  433  ETFHMP-EWFQKH  398
            E  ++P EW ++ 
Sbjct  310  EGQYIPVEWAKRE  322



>ref|XP_002991478.1| hypothetical protein SELMODRAFT_133639, partial [Selaginella 
moellendorffii]
 gb|EFJ07400.1| hypothetical protein SELMODRAFT_133639, partial [Selaginella 
moellendorffii]
Length=219

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREH--VKDLSCIS  617
            E+SK  ++V+FT  ++ YA  ++D+LD V +LF HRLYR S  + E R    VKDLS + 
Sbjct  50   EMSKIYEIVVFTRVVKPYADRILDRLDPVGNLFTHRLYRDSCLTKEVRGRKVVKDLSRLG  109

Query  616  KDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL  437
            +DL   V+VD+ P SF LQP NGI    F   + H    L+ I  LL+ +++ +D+R  L
Sbjct  110  RDLRHTVIVDDKPESFCLQPNNGIVIRAFKNRKGHKYDELKTISNLLKEIARVEDIRQAL  169



>ref|XP_009805067.1| PREDICTED: CTD small phosphatase-like protein 2 isoform X2 [Nicotiana 
sylvestris]
Length=212

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTST  656
            +LSKFA+LVLFTAGLEGYARP+VDK+D ++ F HRLYRPST ST
Sbjct  165  QLSKFANLVLFTAGLEGYARPLVDKIDPENWFSHRLYRPSTIST  208



>gb|KJB66870.1| hypothetical protein B456_010G162000 [Gossypium raimondii]
Length=272

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +SK  ++++FTAGLE YA  ++D LD   L  HRLYR S         +KDLS I +DL 
Sbjct  142  ISKKYEVLVFTAGLEPYASLLLDILDPKGLISHRLYRDSCKQLGQGRFIKDLSKIGRDLK  201

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFS  527
            ++V+VD+NP S+ LQP N IP   F 
Sbjct  202  QVVIVDDNPKSYTLQPANAIPIKGFE  227



>ref|XP_011010921.1| PREDICTED: probable C-terminal domain small phosphatase, partial 
[Populus euphratica]
Length=138

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMV  590
            ++V+FTAGL+ YA  V+D++D   +  HRLYR S    + +  VKDLS + +DL R+V+V
Sbjct  16   EVVVFTAGLKEYATLVLDRIDPKGVISHRLYRDSCKQVDGK-FVKDLSEMGRDLKRVVIV  74

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NP  ++ QP N IP  PF
Sbjct  75   DDNPSCYIYQPENAIPVKPF  94



>ref|XP_002984918.1| hypothetical protein SELMODRAFT_424005 [Selaginella moellendorffii]
 gb|EFJ14168.1| hypothetical protein SELMODRAFT_424005 [Selaginella moellendorffii]
Length=199

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEY--REHVKDLSCIS  617
            E+S+  ++V+FT  ++ YA  ++D+LD   +LF HRLYR S +  E   R+ VKDLS + 
Sbjct  75   EMSQIYEIVVFTRAVKPYADRILDRLDPAGNLFTHRLYRDSCSPKEVGGRKVVKDLSRLG  134

Query  616  KDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL  437
            +DL   V+VD+ P SF LQP NGI    F   + H    L+ I  LL+ +++ +DVR  L
Sbjct  135  RDLKHTVIVDDKPESFCLQPSNGIVIRAFKNRKGHKYDELKKISNLLKEIARVEDVRQAL  194



>dbj|GAN02241.1| HAD-like protein [Mucor ambiguus]
Length=429

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+F ++V+FT+     A P++DKLD     ++RLYR +T   + + +VKDLS +++DLS
Sbjct  184  LSQFYEIVIFTSQSSMNAMPLLDKLDPYQYAMYRLYREATRYVDGK-YVKDLSHLNRDLS  242

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL--YE  431
            +++++D+NP SF LQP NGI   P+         L  +       L+  +D+RPVL  +E
Sbjct  243  KVIIMDSNPDSFSLQPENGIALKPWKGEVKDQGLLEYIPFLEAVALTTPEDIRPVLKSFE  302

Query  430  TFHMP-EWFQKH  398
              ++P EW ++ 
Sbjct  303  GQYIPIEWAKRE  314



>ref|XP_009805066.1| PREDICTED: CTD small phosphatase-like protein 2 isoform X1 [Nicotiana 
sylvestris]
Length=226

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTST  656
            +LSKFA+LVLFTAGLEGYARP+VDK+D ++ F HRLYRPST ST
Sbjct  165  QLSKFANLVLFTAGLEGYARPLVDKIDPENWFSHRLYRPSTIST  208



>ref|XP_002522273.1| Carboxy-terminal domain RNA polymerase II polypeptide A small 
phosphatase, putative [Ricinus communis]
 gb|EEF40131.1| Carboxy-terminal domain RNA polymerase II polypeptide A small 
phosphatase, putative [Ricinus communis]
Length=300

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMV  590
            ++V+FTAGL+ YA  V+D+LD   L  HRLYR S    + +  VKDLS + +DL R+V+V
Sbjct  176  EVVVFTAGLKAYASLVLDRLDEKGLISHRLYRDSCREVDGK-FVKDLSEMGRDLKRVVIV  234

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NP  +  QP N IP  PF
Sbjct  235  DDNPNCYTFQPDNAIPIKPF  254



>ref|XP_004036743.1| NLI interacting factor-like phosphatase family protein, putative 
[Ichthyophthirius multifiliis]
 gb|EGR32757.1| NLI interacting factor-like phosphatase family protein, putative 
[Ichthyophthirius multifiliis]
Length=182

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            ++KF ++++FTA L  YA  ++D +DV     H+LYR  T  T    ++KDL+ I +DL+
Sbjct  39   MAKFYEIIIFTAALNDYANFILDIIDVKKSIAHKLYRQHTL-TYNGTYIKDLTVIGRDLN  97

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            +++++DN   +F LQP NGI C+    G P D
Sbjct  98   KVIIIDNTVENFQLQPENGI-CIQSWYGDPQD  128



>ref|XP_002984913.1| hypothetical protein SELMODRAFT_5868, partial [Selaginella moellendorffii]
 gb|EFJ14163.1| hypothetical protein SELMODRAFT_5868, partial [Selaginella moellendorffii]
Length=173

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEY--REHVKDLSCIS  617
            E+S+  ++V+FT  ++ YA  ++D+LD   +LF HRLYR S +  E   R+ VKDLS + 
Sbjct  50   EMSQIYEIVVFTRAVKPYADRILDRLDPAGNLFTHRLYRDSCSPKEVGGRKVVKDLSRLG  109

Query  616  KDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL  437
            +DL   V+VD+ P SF LQP NGI    F   + H    L+ I  LL+ +++ +DVR  L
Sbjct  110  RDLRHTVIVDDKPESFCLQPSNGIVIRAFKNRKGHKYDELKKISNLLKEIARVEDVRQAL  169



>ref|XP_005708391.1| mitochondrial presequence translocase subunit Tim50 [Galdieria 
sulphuraria]
 gb|EME31871.1| mitochondrial presequence translocase subunit Tim50 [Galdieria 
sulphuraria]
Length=364

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +S F ++V++T+ + GY  P+++KLD +    HRLYR   T  E   H+KDLS +++DL+
Sbjct  175  MSSFYEIVVYTSAMPGYGEPILEKLDPNGYISHRLYR-DATKYEKGVHLKDLSKLNRDLA  233

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSA  524
            R +++D++   F LQP NGI   PF+ 
Sbjct  234  RTIIIDDDANCFRLQPDNGIRIAPFTG  260



>gb|KJB66872.1| hypothetical protein B456_010G162300 [Gossypium raimondii]
Length=317

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +SK  ++V+FTAGLE YA  ++D LD   L  HRLYR S         +KDLS I +DL 
Sbjct  187  ISKKYEVVVFTAGLEPYASLLLDILDPKGLISHRLYRDSCKQLGRGRFIKDLSKIGRDLK  246

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFS  527
            ++V+VD+NP S+ LQP N IP   F 
Sbjct  247  QVVIVDDNPKSYTLQPENAIPIKRFE  272



>ref|XP_002984912.1| hypothetical protein SELMODRAFT_48489, partial [Selaginella moellendorffii]
 gb|EFJ14162.1| hypothetical protein SELMODRAFT_48489, partial [Selaginella moellendorffii]
Length=171

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEY--REHVKDLSCIS  617
            E+S+  ++V+FT  ++ YA  ++D+LD V +LF HRLYR S +  E   R+ VKDLS + 
Sbjct  49   EMSQIYEIVVFTRAVKPYADRILDRLDPVGNLFTHRLYRDSCSPKEVGGRKVVKDLSRLG  108

Query  616  KDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPH  512
            +DL   V+VD+ P SF LQP NGI    F   + H
Sbjct  109  RDLRHTVIVDDKPESFCLQPSNGIVIRAFKNRKGH  143



>ref|XP_007025283.1| Haloacid dehalogenase hydrolase domain-containing protein [Theobroma 
cacao]
 gb|EOY27905.1| Haloacid dehalogenase hydrolase domain-containing protein [Theobroma 
cacao]
Length=384

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 1/85 (1%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +SK  ++V+FTAGLE YA  ++D LD   L  HRLYR S      R  VKDL+ + +DL 
Sbjct  257  ISKKYEVVVFTAGLEPYASTLLDILDPKGLISHRLYRDSCKQVRGR-FVKDLAKMGRDLG  315

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPF  530
            ++VMVD+NP S+ LQP N IP   F
Sbjct  316  KVVMVDDNPKSYYLQPANAIPIKRF  340



>ref|XP_002440775.1| hypothetical protein SORBIDRAFT_09g006400 [Sorghum bicolor]
 gb|EES19205.1| hypothetical protein SORBIDRAFT_09g006400 [Sorghum bicolor]
Length=319

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVD-HLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVM  593
            D+V+FTAGL+ YA  V+D+LD D  +F HRLYR +         VKDL+   + L R V+
Sbjct  200  DVVVFTAGLQEYASLVLDRLDPDGEVFAHRLYRGACRDAGDGRLVKDLAATGRALDRAVI  259

Query  592  VDNNPFSFLLQPLNGIPCVPF  530
            VD+NP ++ LQP N +P  PF
Sbjct  260  VDDNPNAYALQPENAVPVAPF  280



>ref|XP_009834767.1| hypothetical protein H257_10034 [Aphanomyces astaci]
 gb|ETV75636.1| hypothetical protein H257_10034 [Aphanomyces astaci]
Length=229

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 74/129 (57%), Gaps = 4/129 (3%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            S+  D+ +FTAGLE Y RP+++ LD    LF    +R S T  +    +KDL  +  DLS
Sbjct  97   SQHFDVYVFTAGLEMYGRPILEALDPSKSLFKGHFFRTSCT-LKSGFFMKDLRSVRTDLS  155

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            ++V+VDNNP SFL QP NGIP VP      HD+ L  +   L+  L+   DVRP L++ F
Sbjct  156  KVVLVDNNPVSFLPQPSNGIP-VPSFYDDIHDKTLDSLTKVLMNLLNLS-DVRPRLHQLF  213

Query  424  HMPEWFQKH  398
             + +    H
Sbjct  214  RLSDLLADH  222



>gb|KIM68582.1| hypothetical protein SCLCIDRAFT_104632, partial [Scleroderma 
citrinum Foug A]
Length=168

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 5/94 (5%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDH-LFIHRLYRPSTTSTEYREHVKDLSCISKD  611
            ++S +  LV+FTA ++ YA PV+D LD  H +   RL+R S T      + KDLS + +D
Sbjct  46   KVSSWYTLVVFTASMQEYADPVIDWLDAGHGILTRRLFRESCTLLPNGSYTKDLSVVEQD  105

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            LSR+ +VDN+P S+ +   NGIP      G  HD
Sbjct  106  LSRVCLVDNSPISYRVNQANGIPI----EGWTHD  135



>ref|XP_002533382.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29000.1| conserved hypothetical protein [Ricinus communis]
Length=267

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEY  650
            +LS+FADLVLFTAGLEGYA+P+VD++D +++F HRLYRPST ST Y
Sbjct  171  QLSEFADLVLFTAGLEGYAKPLVDRIDTENVFSHRLYRPSTISTLY  216



>ref|XP_004960604.1| PREDICTED: probable C-terminal domain small phosphatase-like, 
partial [Setaria italica]
Length=250

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVD-HLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVM  593
            ++V+FTAGL+ YA  V+D+LD D  +F HRLYR +         VKDL+   + L R V+
Sbjct  131  EVVVFTAGLQEYASLVLDRLDPDGEVFAHRLYRGACRDAGDGRLVKDLAATGRALDRAVI  190

Query  592  VDNNPFSFLLQPLNGIPCVPF  530
            VD+NP ++ LQP N +P  PF
Sbjct  191  VDDNPNAYALQPENAVPVAPF  211



>ref|XP_008864818.1| hypothetical protein H310_02908 [Aphanomyces invadans]
 gb|ETW06743.1| hypothetical protein H310_02908 [Aphanomyces invadans]
Length=225

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 74/129 (57%), Gaps = 4/129 (3%)
 Frame = -2

Query  781  SKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            S+  D+ +FTAGLE Y RP+++ LD    LF    +R S T  +    +KDL  +  DLS
Sbjct  93   SQHFDVYVFTAGLEMYGRPILEALDPSKSLFKGHFFRTSCT-LKSGFFMKDLRSVRSDLS  151

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVLYETF  425
            ++V+VDNNP SFL QP NGIP VP      HD+ L  +   L+  L+   DVRP L++ F
Sbjct  152  KVVLVDNNPVSFLPQPSNGIP-VPSFYDDIHDKTLDSLTKVLMNLLNLS-DVRPRLHQLF  209

Query  424  HMPEWFQKH  398
             + +    H
Sbjct  210  RLSDLLADH  218



>ref|XP_006467590.1| PREDICTED: CTD small phosphatase-like protein-like [Citrus sinensis]
Length=292

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            +SK  ++V+FTAGL+ YA  ++++LD + +  HRLYR S    + +  VKDLS + ++L 
Sbjct  165  ISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGK-FVKDLSEMGRNLK  223

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            ++V+VD+NP +++ QP N IP  PF+ G P D
Sbjct  224  QVVIVDDNPNAYIFQPENAIPVKPFT-GDPSD  254



>emb|CDX90210.1| BnaA08g17740D [Brassica napus]
Length=281

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISK-D  611
             +SK   + +FTAGL  YA  V+DKLD + +   RLYR S T    R + KDLS ++K D
Sbjct  158  RISKNYRVAVFTAGLPEYASQVLDKLDTNRVITQRLYRDSCTDMNGR-YAKDLSLVAKTD  216

Query  610  LSRIVMVDNNPFSFLLQPLNGIPCVPF  530
            L  +++VD+NPFS+ LQP NG+   PF
Sbjct  217  LGSVLLVDDNPFSYSLQPDNGVHIKPF  243



>gb|EPB83424.1| hypothetical protein HMPREF1544_09808 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=428

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+F ++V+FT+     A P++DKLD     ++RLYR +T   + + +VKDLS +++DLS
Sbjct  184  LSQFYEIVIFTSQSSMNAMPLLDKLDPYQYAMYRLYREATRYVDGK-YVKDLSHLNRDLS  242

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL--YE  431
            +++++D+NP SF +QP NGI   P+         L  +       L+  +D+RPVL  +E
Sbjct  243  KVIIMDSNPDSFSMQPENGIALKPWKGEVKDQGLLEYIPFLEAVALTTPEDIRPVLKSFE  302

Query  430  TFHMP-EWFQKH  398
              ++P EW ++ 
Sbjct  303  GQYIPIEWAKRE  314



>emb|CDS03623.1| hypothetical protein LRAMOSA01025 [Absidia idahoensis var. thermophila]
Length=436

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 63/92 (68%), Gaps = 2/92 (2%)
 Frame = -2

Query  784  LSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLS  605
            LS+F ++V+FT+     A+P++D LD     ++RLYR +T   + + +VKDLS +++DLS
Sbjct  178  LSQFFEIVIFTSQTSFNAQPILDSLDPYQYAMYRLYREATRYVDGK-YVKDLSHLNRDLS  236

Query  604  RIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHD  509
            +++++D+NP SF LQP NGI   PF  G P D
Sbjct  237  KVIIMDSNPDSFSLQPENGIKLRPFK-GDPKD  267



>ref|XP_002984914.1| hypothetical protein SELMODRAFT_121036 [Selaginella moellendorffii]
 ref|XP_002984915.1| hypothetical protein SELMODRAFT_121271 [Selaginella moellendorffii]
 gb|EFJ14164.1| hypothetical protein SELMODRAFT_121036 [Selaginella moellendorffii]
 gb|EFJ14165.1| hypothetical protein SELMODRAFT_121271 [Selaginella moellendorffii]
Length=198

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEY--REHVKDLSCIS  617
            E+S+  ++V+FT  ++ YA  ++D+LD   +LF HRLYR S +  E   R+ VKDLS + 
Sbjct  74   EMSQIYEIVVFTRAVKPYADRILDRLDPAGNLFTHRLYRDSCSPKEVGGRKVVKDLSRLG  133

Query  616  KDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL  437
            +DL   V+VD+ P SF LQP NGI    F   + H    L+ I  LL+ +++ +DVR  L
Sbjct  134  RDLRHTVIVDDKPESFCLQPSNGIVIRAFKNRKGHKYDELKKISNLLKEIARVEDVRQAL  193



>ref|XP_002457958.1| hypothetical protein SORBIDRAFT_03g023470 [Sorghum bicolor]
 gb|EES03078.1| hypothetical protein SORBIDRAFT_03g023470 [Sorghum bicolor]
Length=252

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVD-HLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVM  593
            ++V+FTAGL+ YA  V+D+LD D  +F HRLYR +    +    VKDL+   + L R V+
Sbjct  133  EVVVFTAGLQEYASLVLDRLDPDREVFAHRLYRGACRDADDGRLVKDLAATGRALDRAVI  192

Query  592  VDNNPFSFLLQPLNGIPCVPF  530
            VD+NP ++ LQP N +P  PF
Sbjct  193  VDDNPNAYALQPENAVPVAPF  213



>emb|CAN66698.1| hypothetical protein VITISV_026605 [Vitis vinifera]
Length=880

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDL  608
            +L +  ++V+FTAGL  YA  V+D+LD   +  HRLYR S    + +  VKDLS + +DL
Sbjct  158  KLGEKFEIVVFTAGLREYASLVLDRLDKKGMISHRLYRDSCKEIDGK-FVKDLSDLGRDL  216

Query  607  SRIVMVDNNPFSFLLQPLNGIPCVPF  530
             R+V+VD+NP ++ LQP N IP  PF
Sbjct  217  KRVVIVDDNPNAYFLQPENAIPMPPF  242



>ref|XP_010105625.1| CTD small phosphatase-like protein [Morus notabilis]
 gb|EXC51209.1| CTD small phosphatase-like protein [Morus notabilis]
Length=295

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -2

Query  769  DLVLFTAGLEGYARPVVDKLDVDHLFIHRLYRPSTTSTEYREHVKDLSCISKDLSRIVMV  590
            ++V+FTAGL  YA  V+D+LD   L  HRLYR +    + R  VKDLS   +DL R+V+V
Sbjct  172  EVVVFTAGLREYASLVIDRLDRKSLIAHRLYRDACKEVDGR-LVKDLSESGRDLRRVVIV  230

Query  589  DNNPFSFLLQPLNGIPCVPF  530
            D+NP S+  QP N +P  PF
Sbjct  231  DDNPNSYSCQPENAVPVRPF  250



>ref|XP_002984910.1| hypothetical protein SELMODRAFT_121210 [Selaginella moellendorffii]
 gb|EFJ14160.1| hypothetical protein SELMODRAFT_121210 [Selaginella moellendorffii]
Length=198

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -2

Query  787  ELSKFADLVLFTAGLEGYARPVVDKLD-VDHLFIHRLYRPSTTSTEY--REHVKDLSCIS  617
            E+S+  ++V+FT  ++ YA  ++D+LD   +LF HRLYR S +  E   R+ VKDLS + 
Sbjct  74   EMSQIYEIVVFTRAVKLYADRILDRLDPAGNLFTHRLYRDSCSPKEVGGRKVVKDLSRLG  133

Query  616  KDLSRIVMVDNNPFSFLLQPLNGIPCVPFSAGQPHDeqllevilpllehLSQQKDVRPVL  437
            +DL   V+VD+ P SF LQP NGI    F   + H    L+ I  LL+ +++ +DVR  L
Sbjct  134  RDLKHTVIVDDKPESFCLQPSNGIVIRAFKNRKGHKYDELKKINNLLKEIARVEDVRQAL  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360