BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF022F11

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006346222.1|  PREDICTED: polyadenylate-binding protein RBP...    160   1e-42   Solanum tuberosum [potatoes]
ref|XP_009795696.1|  PREDICTED: polyadenylate-binding protein RBP45     155   7e-41   Nicotiana sylvestris
ref|XP_009600135.1|  PREDICTED: polyadenylate-binding protein RBP45     154   1e-40   Nicotiana tomentosiformis
ref|XP_004244127.1|  PREDICTED: polyadenylate-binding protein RBP45     154   1e-40   Solanum lycopersicum
sp|Q9LEB4.1|RBP45_NICPL  RecName: Full=Polyadenylate-binding prot...    153   4e-40   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDP05748.1|  unnamed protein product                                144   2e-37   Coffea canephora [robusta coffee]
ref|XP_011097972.1|  PREDICTED: polyadenylate-binding protein RBP...    143   8e-37   
emb|CBI26626.3|  unnamed protein product                                139   2e-36   Vitis vinifera
emb|CAN83958.1|  hypothetical protein VITISV_039907                     139   5e-35   Vitis vinifera
ref|XP_002280601.1|  PREDICTED: polyadenylate-binding protein RBP...    139   6e-35   Vitis vinifera
gb|EYU33637.1|  hypothetical protein MIMGU_mgv1a007175mg                138   1e-34   Erythranthe guttata [common monkey flower]
ref|XP_006452313.1|  hypothetical protein CICLE_v10008440mg             134   4e-33   Citrus clementina [clementine]
ref|XP_006452314.1|  hypothetical protein CICLE_v10008440mg             134   4e-33   
ref|XP_010911059.1|  PREDICTED: polyadenylate-binding protein RBP...    130   1e-32   
ref|XP_008806741.1|  PREDICTED: polyadenylate-binding protein RBP45     132   2e-32   Phoenix dactylifera
ref|XP_002522953.1|  nuclear acid binding protein, putative             129   2e-31   Ricinus communis
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...    127   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...    126   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010923889.1|  PREDICTED: polyadenylate-binding protein RBP...    124   5e-30   
ref|XP_010240455.1|  PREDICTED: polyadenylate-binding protein RBP...    122   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45     123   1e-29   Elaeis guineensis
ref|XP_010278708.1|  PREDICTED: polyadenylate-binding protein RBP...    124   2e-29   Nelumbo nucifera [Indian lotus]
ref|XP_003580589.1|  PREDICTED: polyadenylate-binding protein RBP...    121   3e-29   Brachypodium distachyon [annual false brome]
ref|XP_008792645.1|  PREDICTED: polyadenylate-binding protein RBP...    122   3e-29   Phoenix dactylifera
ref|XP_010278711.1|  PREDICTED: polyadenylate-binding protein RBP...    122   9e-29   Nelumbo nucifera [Indian lotus]
dbj|BAK03410.1|  predicted protein                                      119   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009406502.1|  PREDICTED: polyadenylate-binding protein RBP...    120   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406503.1|  PREDICTED: polyadenylate-binding protein RBP...    120   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...    119   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010062999.1|  PREDICTED: polyadenylate-binding protein RBP45C    119   2e-28   Eucalyptus grandis [rose gum]
gb|KHN33037.1|  Polyadenylate-binding protein RBP45                     119   3e-28   Glycine soja [wild soybean]
gb|EEE68172.1|  hypothetical protein OsJ_26296                          117   3e-28   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001168324.1|  hypothetical protein                               116   3e-28   Zea mays [maize]
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g             120   4e-28   Phaseolus vulgaris [French bean]
dbj|BAE71244.1|  putative DNA binding protein                           120   4e-28   Trifolium pratense [peavine clover]
gb|EEE61728.1|  hypothetical protein OsJ_16246                          118   5e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45     116   5e-28   
ref|XP_006652855.1|  PREDICTED: polyadenylate-binding protein RBP...    117   5e-28   Oryza brachyantha
dbj|BAD05744.1|  putative RNA Binding Protein 45                        117   6e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447134.1|  hypothetical protein SORBIDRAFT_06g029180          117   7e-28   
ref|XP_003573391.1|  PREDICTED: polyadenylate-binding protein RBP...    116   8e-28   Brachypodium distachyon [annual false brome]
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...    119   9e-28   Glycine max [soybeans]
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45     116   1e-27   Phoenix dactylifera
ref|NP_001053941.1|  Os04g0625800                                       116   1e-27   
emb|CAE04743.3|  OSJNBb0060E08.6                                        116   1e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EAY95645.1|  hypothetical protein OsI_17510                          116   1e-27   Oryza sativa Indica Group [Indian rice]
gb|EAY95631.1|  hypothetical protein OsI_17488                          116   2e-27   Oryza sativa Indica Group [Indian rice]
gb|EEC75600.1|  hypothetical protein OsI_12307                          114   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170          114   2e-27   Sorghum bicolor [broomcorn]
gb|EAZ27535.1|  hypothetical protein OsJ_11490                          114   2e-27   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97193.1|  RNA recognition motif family protein, expressed         114   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...    118   2e-27   Glycine max [soybeans]
gb|AAG59664.1|AC084319_22  putative RNA binding protein                 114   2e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EMS60206.1|  RNA-binding post-transcriptional regulator csx1         117   2e-27   Triticum urartu
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                    117   3e-27   Medicago truncatula
ref|NP_001050516.1|  Os03g0569900                                       113   3e-27   
gb|EMT04468.1|  RNA-binding post-transcriptional regulator csx1         117   3e-27   
ref|XP_003529629.1|  PREDICTED: polyadenylate-binding protein RBP45     117   4e-27   Glycine max [soybeans]
gb|KHN35750.1|  Polyadenylate-binding protein RBP45                     117   4e-27   Glycine soja [wild soybean]
ref|XP_008676816.1|  PREDICTED: uncharacterized protein LOC100273...    114   5e-27   Zea mays [maize]
gb|AFW61056.1|  hypothetical protein ZEAMMB73_234884                    114   5e-27   
ref|XP_008661406.1|  PREDICTED: uncharacterized protein LOC100193...    114   5e-27   
ref|XP_004982540.1|  PREDICTED: polyadenylate-binding protein RBP...    114   5e-27   Setaria italica
ref|NP_001141359.1|  uncharacterized protein LOC100273450               113   5e-27   Zea mays [maize]
ref|NP_001131852.1|  uncharacterized protein LOC100193230               114   6e-27   Zea mays [maize]
gb|EMS52025.1|  RNA-binding post-transcriptional regulator csx1         115   6e-27   Triticum urartu
gb|AFW59516.1|  hypothetical protein ZEAMMB73_768040                    114   7e-27   
ref|XP_006659900.1|  PREDICTED: polyadenylate-binding protein RBP...    114   9e-27   
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...    116   1e-26   Nicotiana tomentosiformis
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...    115   1e-26   Cicer arietinum [garbanzo]
ref|XP_004976877.1|  PREDICTED: polyadenylate-binding protein RBP...    113   2e-26   Setaria italica
ref|XP_011096085.1|  PREDICTED: polyadenylate-binding protein RBP...    115   2e-26   Sesamum indicum [beniseed]
ref|XP_009776429.1|  PREDICTED: polyadenylate-binding protein RBP...    115   2e-26   Nicotiana sylvestris
ref|XP_008349306.1|  PREDICTED: polyadenylate-binding protein RBP...    114   2e-26   
gb|AFK41944.1|  unknown                                                 114   3e-26   Medicago truncatula
ref|XP_003610417.1|  RNA-binding protein                                114   3e-26   Medicago truncatula
gb|AEW68341.1|  putative nuclear acid binding protein                   114   4e-26   Medicago sativa [alfalfa]
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                    114   4e-26   Glycine soja [wild soybean]
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...    113   1e-25   Nicotiana sylvestris
ref|XP_004972673.1|  PREDICTED: polyadenylate-binding protein RBP...    107   1e-25   
ref|XP_004972674.1|  PREDICTED: polyadenylate-binding protein RBP...    107   1e-25   Setaria italica
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...    112   1e-25   Cicer arietinum [garbanzo]
ref|XP_010675694.1|  PREDICTED: polyadenylate-binding protein RBP45     109   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011096084.1|  PREDICTED: polyadenylate-binding protein RBP...    112   2e-25   Sesamum indicum [beniseed]
ref|XP_007211969.1|  hypothetical protein PRUPE_ppa006617mg             112   3e-25   Prunus persica
ref|XP_010327241.1|  PREDICTED: polyadenylate-binding protein RBP...    111   4e-25   Solanum lycopersicum
gb|KCW76953.1|  hypothetical protein EUGRSUZ_D01313                     110   4e-25   Eucalyptus grandis [rose gum]
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...    109   5e-25   Eucalyptus grandis [rose gum]
ref|XP_002518499.1|  nuclear acid binding protein, putative             111   6e-25   Ricinus communis
ref|XP_006352617.1|  PREDICTED: polyadenylate-binding protein RBP...    111   6e-25   Solanum tuberosum [potatoes]
ref|NP_001168401.1|  hypothetical protein                               107   6e-25   Zea mays [maize]
ref|XP_010092144.1|  Polyadenylate-binding protein RBP45                112   7e-25   
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...    110   8e-25   Solanum lycopersicum
ref|XP_004232721.1|  PREDICTED: polyadenylate-binding protein RBP45     110   1e-24   Solanum lycopersicum
gb|ABR18422.1|  unknown                                                 105   1e-24   Picea sitchensis
ref|XP_009412453.1|  PREDICTED: polyadenylate-binding protein RBP45     108   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...    110   1e-24   Solanum tuberosum [potatoes]
ref|XP_006348103.1|  PREDICTED: polyadenylate-binding protein RBP...    110   2e-24   Solanum tuberosum [potatoes]
emb|CBI19566.3|  unnamed protein product                                108   2e-24   Vitis vinifera
ref|XP_006858185.1|  hypothetical protein AMTR_s00062p00161920          103   2e-24   
ref|XP_006370698.1|  hypothetical protein POPTR_0001s45000g             105   2e-24   
ref|XP_011010320.1|  PREDICTED: polyadenylate-binding protein RBP...    105   2e-24   Populus euphratica
ref|XP_011010322.1|  PREDICTED: polyadenylate-binding protein RBP...    105   2e-24   Populus euphratica
ref|XP_003634360.1|  PREDICTED: polyadenylate-binding protein RBP...    108   3e-24   Vitis vinifera
ref|XP_008226922.1|  PREDICTED: polyadenylate-binding protein RBP45C    104   4e-24   Prunus mume [ume]
emb|CAN81343.1|  hypothetical protein VITISV_008697                     109   5e-24   Vitis vinifera
gb|EYU20972.1|  hypothetical protein MIMGU_mgv1a018561mg                103   5e-24   Erythranthe guttata [common monkey flower]
ref|XP_009372712.1|  PREDICTED: polyadenylate-binding protein RBP...    103   5e-24   Pyrus x bretschneideri [bai li]
gb|KDP39118.1|  hypothetical protein JCGZ_00875                         108   6e-24   Jatropha curcas
ref|XP_008385660.1|  PREDICTED: polyadenylate-binding protein RBP...    103   7e-24   
ref|XP_009789022.1|  PREDICTED: polyadenylate-binding protein RBP...    108   7e-24   Nicotiana sylvestris
emb|CAC85246.1|  salt tolerance protein 6                               107   7e-24   Beta vulgaris [beet]
ref|XP_007213954.1|  hypothetical protein PRUPE_ppa006577mg             103   9e-24   Prunus persica
ref|XP_009352469.1|  PREDICTED: polyadenylate-binding protein RBP...    103   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_008365193.1|  PREDICTED: polyadenylate-binding protein RBP...    103   1e-23   Malus domestica [apple tree]
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...    105   1e-23   Glycine max [soybeans]
gb|ABK25253.1|  unknown                                                 102   1e-23   Picea sitchensis
ref|XP_006354957.1|  PREDICTED: polyadenylate-binding protein RBP...    106   1e-23   Solanum tuberosum [potatoes]
ref|XP_008441150.1|  PREDICTED: polyadenylate-binding protein RBP...    107   1e-23   Cucumis melo [Oriental melon]
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...    107   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011030800.1|  PREDICTED: polyadenylate-binding protein RBP...    106   2e-23   Populus euphratica
ref|XP_008441163.1|  PREDICTED: polyadenylate-binding protein RBP...    106   2e-23   Cucumis melo [Oriental melon]
ref|XP_002316998.2|  RNA-binding protein 45                             106   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009595795.1|  PREDICTED: polyadenylate-binding protein RBP...    106   3e-23   Nicotiana tomentosiformis
gb|KJB59840.1|  hypothetical protein B456_009G275200                    105   4e-23   Gossypium raimondii
ref|XP_010041417.1|  PREDICTED: polyadenylate-binding protein RBP...    102   5e-23   Eucalyptus grandis [rose gum]
gb|KCW44364.1|  hypothetical protein EUGRSUZ_L02167                     102   8e-23   Eucalyptus grandis [rose gum]
ref|XP_004153241.1|  PREDICTED: polyadenylate-binding protein RBP...    101   8e-23   
ref|XP_008224810.1|  PREDICTED: polyadenylate-binding protein RBP...    103   9e-23   Prunus mume [ume]
gb|EEE69858.1|  hypothetical protein OsJ_29658                          104   9e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008441138.1|  PREDICTED: polyadenylate-binding protein RBP...    104   1e-22   Cucumis melo [Oriental melon]
dbj|BAD33940.1|  putative nucleic acid binding protein                  103   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006283830.1|  hypothetical protein CARUB_v10004931mg             104   1e-22   Capsella rubella
ref|XP_006413118.1|  hypothetical protein EUTSA_v10025342mg             104   1e-22   Eutrema salsugineum [saltwater cress]
ref|XP_007020874.1|  RNA-binding family protein                       99.8    1e-22   
ref|XP_006280607.1|  hypothetical protein CARUB_v10026566mg           99.4    1e-22   Capsella rubella
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g             104   1e-22   Phaseolus vulgaris [French bean]
ref|XP_002510266.1|  nuclear acid binding protein, putative             103   1e-22   Ricinus communis
dbj|BAG87507.1|  unnamed protein product                                103   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...    104   1e-22   Phaseolus vulgaris [French bean]
gb|EEC84714.1|  hypothetical protein OsI_31675                          104   1e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_011013053.1|  PREDICTED: polyadenylate-binding protein RBP...    104   1e-22   Populus euphratica
ref|XP_008441142.1|  PREDICTED: polyadenylate-binding protein RBP...    103   2e-22   Cucumis melo [Oriental melon]
gb|ABK24911.1|  unknown                                               98.2    2e-22   Picea sitchensis
gb|KHN12758.1|  Polyadenylate-binding protein RBP47C                    103   2e-22   Glycine soja [wild soybean]
ref|XP_009137630.1|  PREDICTED: polyadenylate-binding protein RBP...    103   2e-22   Brassica rapa
ref|XP_011017227.1|  PREDICTED: polyadenylate-binding protein RBP...    103   2e-22   Populus euphratica
emb|CDY46671.1|  BnaA03g48370D                                          103   2e-22   Brassica napus [oilseed rape]
ref|XP_010443072.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    2e-22   Camelina sativa [gold-of-pleasure]
gb|KJB13665.1|  hypothetical protein B456_002G088100                  98.6    2e-22   Gossypium raimondii
gb|KJB13666.1|  hypothetical protein B456_002G088100                  98.6    3e-22   Gossypium raimondii
gb|KJB13664.1|  hypothetical protein B456_002G088100                  98.6    3e-22   Gossypium raimondii
gb|KJB81764.1|  hypothetical protein B456_013G160200                  98.6    3e-22   Gossypium raimondii
ref|XP_010448802.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...  98.6    3e-22   Tarenaya hassleriana [spider flower]
gb|KJB81761.1|  hypothetical protein B456_013G160200                  98.2    4e-22   Gossypium raimondii
gb|ACF83065.1|  unknown                                                 102   4e-22   Zea mays [maize]
dbj|BAJ87828.1|  predicted protein                                      100   4e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001063403.1|  Os09g0462700                                       103   4e-22   
ref|XP_008441139.1|  PREDICTED: polyadenylate-binding protein RBP...    102   4e-22   Cucumis melo [Oriental melon]
gb|EYU25396.1|  hypothetical protein MIMGU_mgv1a006186mg                103   4e-22   Erythranthe guttata [common monkey flower]
dbj|BAJ85753.1|  predicted protein                                      100   4e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010054589.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  99.8    4e-22   
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...    102   5e-22   Cucumis sativus [cucumbers]
ref|XP_010476096.1|  PREDICTED: polyadenylate-binding protein RBP...  97.4    5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010476097.1|  PREDICTED: polyadenylate-binding protein RBP...  97.4    5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...    102   6e-22   Glycine max [soybeans]
emb|CDP04387.1|  unnamed protein product                                100   6e-22   Coffea canephora [robusta coffee]
gb|KJB58432.1|  hypothetical protein B456_009G209600                    100   6e-22   Gossypium raimondii
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein            97.1    7e-22   Gossypium arboreum [tree cotton]
ref|XP_002302445.2|  RNA-binding protein 47                             102   7e-22   
dbj|BAB08769.1|  unnamed protein product                              98.6    7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568815.1|  RNA-binding protein 45A                             98.2    8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010098709.1|  Polyadenylate-binding protein RBP47C               100   8e-22   Morus notabilis
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...    101   8e-22   Nelumbo nucifera [Indian lotus]
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...    102   9e-22   Phaseolus vulgaris [French bean]
ref|XP_004145109.1|  PREDICTED: polyadenylate-binding protein RBP...    102   9e-22   Cucumis sativus [cucumbers]
ref|XP_010493089.1|  PREDICTED: polyadenylate-binding protein RBP...  96.7    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...    100   1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004294372.1|  PREDICTED: polyadenylate-binding protein RBP45C  96.3    1e-21   Fragaria vesca subsp. vesca
ref|XP_002864364.1|  hypothetical protein ARALYDRAFT_495572           96.3    1e-21   
ref|XP_010448184.1|  PREDICTED: polyadenylate-binding protein RBP...    102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010458570.1|  PREDICTED: polyadenylate-binding protein RBP45B  96.3    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g             101   1e-21   Phaseolus vulgaris [French bean]
gb|AGV54251.1|  RNA binding post-transcriptional regulator csx1 l...    101   1e-21   Phaseolus vulgaris [French bean]
ref|NP_001144988.1|  uncharacterized protein LOC100278143               101   1e-21   Zea mays [maize]
gb|ACF87959.1|  unknown                                                 101   2e-21   Zea mays [maize]
ref|NP_567764.1|  polyadenylate-binding protein RBP45C                  101   2e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36546.1|  putative DNA binding protein                           101   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb|KHG22988.1|  Polyadenylate-binding RBP45C -like protein            97.8    2e-21   Gossypium arboreum [tree cotton]
ref|XP_009142977.1|  PREDICTED: polyadenylate-binding protein RBP...    101   2e-21   Brassica rapa
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...    101   2e-21   Citrus sinensis [apfelsine]
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg             101   2e-21   Citrus clementina [clementine]
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg             101   2e-21   Citrus clementina [clementine]
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...    101   2e-21   Citrus sinensis [apfelsine]
ref|XP_004250947.1|  PREDICTED: polyadenylate-binding protein RBP...    101   2e-21   Solanum lycopersicum
gb|KHN46301.1|  Polyadenylate-binding protein RBP47C                    100   2e-21   Glycine soja [wild soybean]
ref|XP_010313279.1|  PREDICTED: polyadenylate-binding protein RBP...    101   2e-21   Solanum lycopersicum
ref|XP_010433418.1|  PREDICTED: polyadenylate-binding protein RBP45C    100   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004501589.1|  PREDICTED: polyadenylate-binding protein RBP...    100   2e-21   Cicer arietinum [garbanzo]
ref|XP_004957865.1|  PREDICTED: polyadenylate-binding protein RBP...  98.6    2e-21   Setaria italica
ref|XP_010438672.1|  PREDICTED: polyadenylate-binding protein RBP45C    100   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004499084.1|  PREDICTED: polyadenylate-binding protein RBP...    100   2e-21   Cicer arietinum [garbanzo]
ref|XP_010482899.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009772575.1|  PREDICTED: polyadenylate-binding protein RBP...    100   3e-21   Nicotiana sylvestris
ref|XP_004957864.1|  PREDICTED: polyadenylate-binding protein RBP...  98.2    3e-21   
ref|XP_006307499.1|  hypothetical protein CARUB_v10009124mg           95.1    3e-21   
ref|XP_010546929.1|  PREDICTED: polyadenylate-binding protein RBP45B  97.1    3e-21   Tarenaya hassleriana [spider flower]
ref|XP_002867529.1|  hypothetical protein ARALYDRAFT_913848             100   3e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_009772574.1|  PREDICTED: polyadenylate-binding protein RBP...    100   3e-21   Nicotiana sylvestris
gb|EPS64177.1|  hypothetical protein M569_10604                         100   3e-21   Genlisea aurea
gb|KJB22074.1|  hypothetical protein B456_004G028000                  96.7    3e-21   Gossypium raimondii
ref|XP_001777334.1|  predicted protein                                94.0    3e-21   
ref|XP_009109155.1|  PREDICTED: polyadenylate-binding protein RBP...    100   3e-21   Brassica rapa
emb|CDY14290.1|  BnaA08g14210D                                          100   3e-21   Brassica napus [oilseed rape]
ref|XP_004238180.1|  PREDICTED: polyadenylate-binding protein RBP...  98.6    4e-21   Solanum lycopersicum
ref|XP_006361746.1|  PREDICTED: polyadenylate-binding protein RBP...    100   4e-21   Solanum tuberosum [potatoes]
ref|XP_006361747.1|  PREDICTED: polyadenylate-binding protein RBP...    100   4e-21   Solanum tuberosum [potatoes]
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...  99.8    4e-21   Glycine max [soybeans]
emb|CDX92786.1|  BnaC07g40440D                                          100   4e-21   
ref|XP_002305583.2|  RNA-binding protein 45                             100   4e-21   Populus trichocarpa [western balsam poplar]
ref|XP_011037670.1|  PREDICTED: polyadenylate-binding protein RBP...    100   5e-21   Populus euphratica
ref|XP_009631417.1|  PREDICTED: polyadenylate-binding protein RBP...  99.8    5e-21   
emb|CDY66423.1|  BnaAnng22220D                                          100   5e-21   Brassica napus [oilseed rape]
ref|XP_007017333.1|  RNA-binding protein 47C isoform 5                97.8    5e-21   
ref|XP_004507696.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    6e-21   
ref|XP_009765294.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    6e-21   Nicotiana sylvestris
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...    100   6e-21   Phoenix dactylifera
gb|KFK43438.1|  hypothetical protein AALP_AA1G125300                  94.4    6e-21   Arabis alpina [alpine rockcress]
ref|XP_009629702.1|  PREDICTED: polyadenylate-binding protein RBP...  97.4    6e-21   Nicotiana tomentosiformis
ref|XP_001784132.1|  predicted protein                                92.8    7e-21   
ref|XP_010525621.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    8e-21   Tarenaya hassleriana [spider flower]
ref|XP_004141245.1|  PREDICTED: polyadenylate-binding protein RBP...  99.4    9e-21   Cucumis sativus [cucumbers]
gb|KJB69303.1|  hypothetical protein B456_011G015300                  99.0    1e-20   Gossypium raimondii
ref|XP_010539063.1|  PREDICTED: polyadenylate-binding protein RBP...  99.0    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_009605325.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    1e-20   Nicotiana tomentosiformis
ref|XP_007136663.1|  hypothetical protein PHAVU_009G063200g           97.4    1e-20   Phaseolus vulgaris [French bean]
gb|KJB69301.1|  hypothetical protein B456_011G015300                  98.2    1e-20   Gossypium raimondii
gb|AAM64532.1|  putative DNA binding protein                          95.1    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29206.1|  hypothetical protein AALP_AA7G103000                  98.6    1e-20   Arabis alpina [alpine rockcress]
ref|XP_007017330.1|  RNA-binding protein 47C isoform 2                96.3    1e-20   
ref|XP_007017331.1|  RNA-binding protein 47C isoform 3                96.3    1e-20   
ref|NP_172630.1|  polyadenylate-binding protein RBP45B                95.1    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006374988.1|  RNA-binding protein 47                           94.7    2e-20   
ref|XP_007017329.1|  RNA-binding protein 47C isoform 1                96.3    2e-20   
ref|XP_009631415.1|  PREDICTED: polyadenylate-binding protein RBP...  98.2    2e-20   Nicotiana tomentosiformis
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...  94.4    2e-20   Phoenix dactylifera
ref|XP_004234481.1|  PREDICTED: polyadenylate-binding protein RBP...  98.2    2e-20   Solanum lycopersicum
ref|XP_008452518.1|  PREDICTED: polyadenylate-binding protein RBP...  98.2    2e-20   Cucumis melo [Oriental melon]
gb|KDO35913.1|  hypothetical protein CISIN_1g029152mg                 94.7    2e-20   Citrus sinensis [apfelsine]
ref|XP_009631416.1|  PREDICTED: polyadenylate-binding protein RBP...  98.2    2e-20   Nicotiana tomentosiformis
ref|XP_006343293.1|  PREDICTED: polyadenylate-binding protein RBP...  98.2    2e-20   Solanum tuberosum [potatoes]
gb|KDP20762.1|  hypothetical protein JCGZ_21233                       98.2    2e-20   Jatropha curcas
gb|KHG16958.1|  Polyadenylate-binding RBP45B -like protein            99.0    2e-20   Gossypium arboreum [tree cotton]
ref|XP_004295261.2|  PREDICTED: polyadenylate-binding protein RBP45B  98.2    2e-20   Fragaria vesca subsp. vesca
ref|XP_010101438.1|  Polyadenylate-binding protein RBP45B             97.8    2e-20   
ref|XP_006417333.1|  hypothetical protein EUTSA_v10007819mg           92.4    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    3e-20   Brachypodium distachyon [annual false brome]
gb|EYU27806.1|  hypothetical protein MIMGU_mgv1a007668mg              97.8    3e-20   Erythranthe guttata [common monkey flower]
gb|EMS62393.1|  Uncharacterized RNA-binding protein C23E6.01c         97.4    3e-20   Triticum urartu
ref|XP_007026047.1|  RNA-binding family protein                       97.8    3e-20   Theobroma cacao [chocolate]
ref|XP_008782322.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    3e-20   
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47   96.3    3e-20   Elaeis guineensis
gb|ADE77364.1|  unknown                                               95.1    3e-20   Picea sitchensis
gb|ACL54800.1|  unknown                                               97.1    3e-20   Zea mays [maize]
ref|XP_006401513.1|  hypothetical protein EUTSA_v10013710mg           97.4    4e-20   Eutrema salsugineum [saltwater cress]
ref|XP_004291135.1|  PREDICTED: polyadenylate-binding protein RBP...  95.5    4e-20   Fragaria vesca subsp. vesca
ref|XP_002889883.1|  ATRBP45B                                         93.6    4e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_003560152.2|  PREDICTED: polyadenylate-binding protein RBP...  94.7    4e-20   Brachypodium distachyon [annual false brome]
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...  97.4    4e-20   Zea mays [maize]
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...  97.8    4e-20   Elaeis guineensis
gb|EMT16295.1|  Putative RNA-binding protein                          97.1    4e-20   
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...  95.5    4e-20   Prunus mume [ume]
ref|XP_010327242.1|  PREDICTED: polyadenylate-binding protein RBP...  96.7    5e-20   
ref|XP_006307520.1|  hypothetical protein CARUB_v10009143mg           97.4    5e-20   Capsella rubella
gb|KDO35916.1|  hypothetical protein CISIN_1g029152mg                 94.0    5e-20   Citrus sinensis [apfelsine]
dbj|BAJ85879.1|  predicted protein                                    96.7    5e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...  95.1    6e-20   Prunus mume [ume]
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...  97.1    6e-20   Setaria italica
ref|XP_006658612.1|  PREDICTED: polyadenylate-binding protein RBP...  91.3    6e-20   
gb|KDO35910.1|  hypothetical protein CISIN_1g029152mg                 94.4    6e-20   
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454           94.4    6e-20   
gb|KJB58433.1|  hypothetical protein B456_009G209600                  94.0    7e-20   
ref|XP_008361011.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    7e-20   
ref|XP_008393835.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    7e-20   
ref|XP_003558701.1|  PREDICTED: polyadenylate-binding protein RBP...  96.3    8e-20   
gb|KDP38389.1|  hypothetical protein JCGZ_04314                       94.4    8e-20   
ref|XP_009370171.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    8e-20   
ref|XP_008357395.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    8e-20   
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    8e-20   
ref|XP_009370172.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    9e-20   
ref|XP_008357394.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    9e-20   
gb|EMS68577.1|  Uncharacterized RNA-binding protein C23E6.01c         95.5    9e-20   
ref|XP_002468416.1|  hypothetical protein SORBIDRAFT_01g045570        92.4    1e-19   
gb|KJB63805.1|  hypothetical protein B456_010G017300                  93.6    1e-19   
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                  96.3    1e-19   
gb|ACR34003.1|  unknown                                               92.0    1e-19   
ref|XP_004985527.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    1e-19   
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...  87.4    1e-19   
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...  87.4    1e-19   
ref|XP_006473363.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    1e-19   
emb|CDY29263.1|  BnaC01g19150D                                        95.9    1e-19   
ref|XP_006434827.1|  hypothetical protein CICLE_v10001214mg           94.4    1e-19   
dbj|BAJ85933.1|  predicted protein                                    92.4    1e-19   
ref|NP_001152183.1|  LOC100285821                                     92.0    1e-19   
ref|XP_007017332.1|  RNA-binding protein 47C isoform 4                92.8    1e-19   
emb|CDX89287.1|  BnaA01g16060D                                        95.9    1e-19   
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg           93.6    2e-19   
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...  90.9    2e-19   
gb|KCW68769.1|  hypothetical protein EUGRSUZ_F02369                   93.6    2e-19   
gb|KDO35914.1|  hypothetical protein CISIN_1g029152mg                 93.2    2e-19   
ref|XP_006401514.1|  hypothetical protein EUTSA_v10013710mg           95.1    2e-19   
ref|XP_003603009.1|  RNA-binding protein                              92.8    2e-19   
ref|XP_010500273.1|  PREDICTED: polyadenylate-binding protein RBP...  95.9    2e-19   
gb|KCW68770.1|  hypothetical protein EUGRSUZ_F02369                   93.6    2e-19   
ref|NP_001049124.1|  Os03g0174100                                     93.6    2e-19   
gb|ABF94248.1|  RNA recognition motif family protein, expressed       93.2    2e-19   
emb|CDP18029.1|  unnamed protein product                              95.5    3e-19   
ref|XP_010061775.1|  PREDICTED: polyadenylate-binding protein RBP...  93.2    3e-19   
ref|XP_002863750.1|  hypothetical protein ARALYDRAFT_331131           94.7    3e-19   
gb|EEC74608.1|  hypothetical protein OsI_10216                        93.2    3e-19   
ref|XP_010668311.1|  PREDICTED: polyadenylate-binding protein RBP...  95.5    3e-19   
gb|KJB09397.1|  hypothetical protein B456_001G139100                  94.4    4e-19   
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...  94.0    4e-19   
gb|ABY75165.1|  RNA binding protein                                   90.9    4e-19   
gb|KJB09398.1|  hypothetical protein B456_001G139100                  94.4    4e-19   
ref|XP_009764865.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    4e-19   
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...  93.2    4e-19   
ref|XP_009118182.1|  PREDICTED: polyadenylate-binding protein RBP...  87.8    4e-19   
emb|CDY34639.1|  BnaC08g41980D                                        87.4    4e-19   
emb|CBI16387.3|  unnamed protein product                              92.8    4e-19   
ref|XP_009118181.1|  PREDICTED: polyadenylate-binding protein RBP...  87.8    4e-19   
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    5e-19   
emb|CDY34835.1|  BnaA09g47610D                                        87.8    5e-19   
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    5e-19   
ref|NP_001047180.1|  Os02g0567900                                     93.2    5e-19   
emb|CDP01376.1|  unnamed protein product                              94.4    5e-19   
ref|XP_010479152.1|  PREDICTED: polyadenylate-binding protein RBP...  94.7    5e-19   
ref|XP_008651136.1|  PREDICTED: hypothetical protein isoform X1       95.1    5e-19   
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...  91.7    5e-19   
ref|NP_001132004.1|  uncharacterized protein LOC100193409             94.4    5e-19   
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    5e-19   
ref|NP_001142233.1|  hypothetical protein                             94.7    5e-19   
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein           94.4    5e-19   
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    6e-19   
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...  92.0    6e-19   
gb|KJB09396.1|  hypothetical protein B456_001G139100                  94.4    6e-19   
ref|XP_008667046.1|  PREDICTED: uncharacterized protein LOC100191...  90.5    6e-19   
ref|NP_001130512.1|  uncharacterized protein LOC100191611             90.5    6e-19   
ref|XP_006648763.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    6e-19   
tpg|DAA62918.1|  TPA: hypothetical protein ZEAMMB73_604225            95.1    6e-19   
gb|EMS56663.1|  Uncharacterized RNA-binding protein C23E6.01c         90.9    6e-19   
gb|EEC73442.1|  hypothetical protein OsI_07730                        92.4    6e-19   
ref|XP_006393576.1|  hypothetical protein EUTSA_v10011476mg           94.4    7e-19   
ref|XP_004164285.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  92.0    7e-19   
ref|XP_009120017.1|  PREDICTED: polyadenylate-binding protein RBP45A  91.3    7e-19   
emb|CDY17286.1|  BnaA10g09200D                                        91.3    8e-19   
ref|XP_006845939.1|  hypothetical protein AMTR_s00157p00079360        90.9    8e-19   
gb|EEE57226.1|  hypothetical protein OsJ_07197                        92.4    8e-19   
gb|KFK27101.1|  hypothetical protein AALP_AA8G334500                  89.7    9e-19   
ref|XP_008444645.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    9e-19   
dbj|BAD17764.1|  putative nucleic acid binding protein                92.4    9e-19   
gb|EPS64859.1|  nucleic acid binding protein                          93.2    9e-19   
emb|CDY19874.1|  BnaC09g31400D                                        91.3    9e-19   
ref|XP_006452305.1|  hypothetical protein CICLE_v10010830mg           86.7    9e-19   
gb|KFK27100.1|  hypothetical protein AALP_AA8G334500                  89.7    9e-19   
ref|XP_006475165.1|  PREDICTED: polyadenylate-binding protein RBP...  86.7    1e-18   
ref|XP_004152729.1|  PREDICTED: polyadenylate-binding protein RBP...  92.4    1e-18   
ref|XP_006279885.1|  hypothetical protein CARUB_v100264670mg          92.4    1e-18   
ref|XP_007015035.1|  RNA-binding family protein isoform 3             93.6    1e-18   
ref|XP_007015034.1|  RNA-binding family protein isoform 2             93.6    1e-18   
ref|XP_002518798.1|  nuclear acid binding protein, putative           92.0    1e-18   
ref|XP_010461546.1|  PREDICTED: polyadenylate-binding protein RBP...  93.6    1e-18   
ref|XP_007015033.1|  RNA-binding family protein isoform 1             93.6    1e-18   
ref|XP_006452306.1|  hypothetical protein CICLE_v10010830mg           86.3    1e-18   
ref|XP_002446570.1|  hypothetical protein SORBIDRAFT_06g018280        93.2    1e-18   
gb|KFK36144.1|  hypothetical protein AALP_AA4G083000                  93.2    1e-18   
ref|XP_006452304.1|  hypothetical protein CICLE_v10010830mg           86.3    2e-18   
ref|XP_003523906.1|  PREDICTED: polyadenylate-binding protein RBP...  90.5    2e-18   
gb|ABR25993.1|  nucleic acid binding protein                          89.0    2e-18   
ref|XP_006475164.1|  PREDICTED: polyadenylate-binding protein RBP...  85.9    2e-18   
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...  90.5    2e-18   
ref|XP_006475163.1|  PREDICTED: polyadenylate-binding protein RBP...  85.9    2e-18   
gb|KHN04518.1|  Polyadenylate-binding protein RBP47C                  90.5    2e-18   
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...  90.1    2e-18   
ref|XP_011083821.1|  PREDICTED: polyadenylate-binding protein RBP...  90.9    2e-18   
ref|XP_004952707.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    2e-18   
ref|XP_006423054.1|  hypothetical protein CICLE_v10028454mg           92.8    3e-18   
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...  90.9    3e-18   
gb|KDO38218.1|  hypothetical protein CISIN_1g038175mg                 89.0    3e-18   
ref|XP_006480131.1|  PREDICTED: polyadenylate-binding protein RBP...  92.8    3e-18   
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...  86.7    3e-18   
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...  86.7    3e-18   
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...  86.7    3e-18   
gb|ABR25764.1|  nucleic acid binding protein                          88.6    3e-18   
ref|XP_011080284.1|  PREDICTED: polyadenylate-binding protein RBP...  91.3    3e-18   
gb|KDP23018.1|  hypothetical protein JCGZ_01681                       90.5    4e-18   
ref|XP_011092726.1|  PREDICTED: polyadenylate-binding protein RBP...  90.1    4e-18   
ref|XP_011092727.1|  PREDICTED: polyadenylate-binding protein RBP...  89.7    4e-18   
ref|XP_004975779.1|  PREDICTED: polyadenylate-binding protein RBP...  91.7    4e-18   
ref|XP_002452313.1|  hypothetical protein SORBIDRAFT_04g023540        92.0    4e-18   
gb|EMS47480.1|  Uncharacterized RNA-binding protein C23E6.01c         90.1    5e-18   
ref|XP_010031800.1|  PREDICTED: polyadenylate-binding protein RBP...  88.6    5e-18   
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...  89.7    5e-18   
gb|EMT27298.1|  Putative RNA-binding protein                          90.1    6e-18   
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...  88.6    6e-18   
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...  89.0    6e-18   
ref|XP_006649483.1|  PREDICTED: polyadenylate-binding protein RBP...  88.6    6e-18   
ref|XP_008797245.1|  PREDICTED: polyadenylate-binding protein RBP...  90.9    6e-18   
ref|XP_009794616.1|  PREDICTED: polyadenylate-binding protein RBP...  89.0    6e-18   
ref|XP_006442703.1|  hypothetical protein CICLE_v10022585mg           88.2    7e-18   
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47   89.7    8e-18   
ref|XP_009590296.1|  PREDICTED: polyadenylate-binding protein RBP47   89.7    8e-18   
ref|XP_010108648.1|  Polyadenylate-binding protein RBP47B'            88.6    8e-18   
ref|XP_006653468.1|  PREDICTED: polyadenylate-binding protein RBP...  90.9    8e-18   
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...  88.2    8e-18   
gb|EPS67039.1|  hypothetical protein M569_07737                       90.9    9e-18   
ref|XP_003575198.1|  PREDICTED: polyadenylate-binding protein RBP...  90.9    9e-18   
gb|AAB92518.1|  putative RNA binding protein                          89.4    9e-18   
gb|EPS57677.1|  hypothetical protein M569_17140                       90.9    9e-18   
ref|XP_009615947.1|  PREDICTED: polyadenylate-binding protein RBP...  90.5    1e-17   
ref|XP_009391347.1|  PREDICTED: polyadenylate-binding protein RBP...  89.0    1e-17   
ref|NP_001275480.1|  DNA binding protein ACBF-like                    89.4    1e-17   
ref|XP_010519119.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  88.6    1e-17   
ref|XP_011088289.1|  PREDICTED: polyadenylate-binding protein RBP47   90.5    1e-17   
ref|NP_175181.1|  RNA-binding protein 47C'                            90.5    1e-17   
ref|XP_009768585.1|  PREDICTED: polyadenylate-binding protein RBP...  90.5    1e-17   
gb|AFA36523.1|  nucleic acid binding protein                          87.0    1e-17   
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47   88.6    1e-17   
sp|Q9LEB3.1|RBP47_NICPL  RecName: Full=Polyadenylate-binding prot...  87.8    2e-17   
ref|XP_009628458.1|  PREDICTED: polyadenylate-binding protein RBP...  88.6    2e-17   
ref|XP_010327389.1|  PREDICTED: DNA-binding protein isoform X1        87.4    2e-17   
ref|XP_006349627.1|  PREDICTED: polyadenylate-binding protein RBP...  88.2    2e-17   
ref|NP_001234487.1|  DNA-binding protein                              87.4    2e-17   
ref|XP_010327390.1|  PREDICTED: DNA-binding protein isoform X2        87.4    2e-17   
gb|AFK35123.1|  unknown                                               89.7    2e-17   
gb|KEH40058.1|  polyadenylate-binding protein RBP47C                  89.7    2e-17   
ref|XP_006349628.1|  PREDICTED: polyadenylate-binding protein RBP...  88.2    2e-17   
emb|CDO97156.1|  unnamed protein product                              90.1    2e-17   
ref|NP_001275430.1|  DNA-binding protein-like                         87.8    2e-17   
ref|XP_008678713.1|  PREDICTED: polyadenylate-binding protein RBP...  89.7    2e-17   
ref|NP_001130489.1|  uncharacterized protein LOC100191587             89.7    2e-17   
ref|XP_009114049.1|  PREDICTED: polyadenylate-binding protein RBP...  89.7    2e-17   
emb|CBI32444.3|  unnamed protein product                              88.6    3e-17   
dbj|BAJ93453.1|  predicted protein                                    88.2    3e-17   
gb|EMS68789.1|  Uncharacterized RNA-binding protein C23E6.01c         87.8    3e-17   
gb|EEE61093.1|  hypothetical protein OsJ_14988                        89.0    3e-17   
ref|XP_006657388.1|  PREDICTED: polyadenylate-binding protein RBP...  87.4    3e-17   
emb|CDY52067.1|  BnaA09g53390D                                        89.4    3e-17   
ref|XP_006384437.1|  hypothetical protein POPTR_0004s15080g           87.4    3e-17   
ref|XP_006487135.1|  PREDICTED: uncharacterized protein LOC102626638  90.1    3e-17   
ref|NP_175180.1|  RNA-binding protein 47C                             89.4    3e-17   
ref|XP_002313840.2|  RNA-binding protein 47                           87.0    3e-17   
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                   89.4    3e-17   
emb|CDX95176.1|  BnaC09g16940D                                        89.4    4e-17   
gb|EAY94326.1|  hypothetical protein OsI_16094                        89.0    4e-17   
emb|CAH67097.1|  H0818E04.14                                          89.0    4e-17   
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...  88.6    4e-17   
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47   89.4    4e-17   
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...  81.3    4e-17   
ref|XP_002460777.1|  hypothetical protein SORBIDRAFT_02g034736        85.9    4e-17   
ref|NP_001052934.2|  Os04g0449900                                     88.6    4e-17   
ref|XP_011000065.1|  PREDICTED: polyadenylate-binding protein RBP47   86.7    4e-17   
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...  88.6    4e-17   
ref|XP_006850190.1|  hypothetical protein AMTR_s00022p00247520        89.4    4e-17   
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...  81.3    5e-17   
gb|EYU46265.1|  hypothetical protein MIMGU_mgv1a007107mg              86.3    5e-17   
emb|CAN74486.1|  hypothetical protein VITISV_029928                   88.2    6e-17   
ref|XP_011004995.1|  PREDICTED: polyadenylate-binding protein RBP...  88.2    6e-17   
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    6e-17   
ref|XP_010673626.1|  PREDICTED: polyadenylate-binding protein RBP...  84.3    8e-17   
ref|XP_002891364.1|  ATRBP47C                                         88.6    8e-17   
ref|XP_009783557.1|  PREDICTED: polyadenylate-binding protein RBP...  85.9    9e-17   
ref|XP_006446580.1|  hypothetical protein CICLE_v10017127mg           84.0    1e-16   
gb|EMT05029.1|  Putative RNA-binding protein                          85.1    1e-16   
ref|XP_009783555.1|  PREDICTED: polyadenylate-binding protein RBP...  85.9    1e-16   
gb|KDO49116.1|  hypothetical protein CISIN_1g013061mg                 87.8    1e-16   
ref|XP_006406535.1|  hypothetical protein EUTSA_v10020763mg           83.6    1e-16   
ref|XP_003579863.1|  PREDICTED: polyadenylate-binding protein RBP...  87.0    2e-16   
ref|XP_004168889.1|  PREDICTED: polyadenylate-binding protein RBP...  83.6    2e-16   
ref|XP_007209154.1|  hypothetical protein PRUPE_ppa005940mg           84.0    2e-16   
ref|XP_004145357.1|  PREDICTED: polyadenylate-binding protein RBP...  83.6    2e-16   
ref|XP_004294842.1|  PREDICTED: polyadenylate-binding protein RBP...  81.6    2e-16   
ref|XP_011461514.1|  PREDICTED: polyadenylate-binding protein RBP...  81.3    2e-16   
emb|CDY18570.1|  BnaA01g26250D                                        82.8    2e-16   
ref|XP_002963882.1|  hypothetical protein SELMODRAFT_80061            85.9    2e-16   
ref|XP_008238181.1|  PREDICTED: polyadenylate-binding protein RBP...  83.6    2e-16   
ref|XP_009112131.1|  PREDICTED: polyadenylate-binding protein RBP...  82.8    2e-16   
emb|CDX95462.1|  BnaC01g33540D                                        83.2    2e-16   
gb|ACN40970.1|  unknown                                               84.0    2e-16   
gb|ACN39849.1|  unknown                                               84.0    2e-16   
ref|XP_008236617.1|  PREDICTED: polyadenylate-binding protein RBP...  82.8    2e-16   
ref|XP_007199852.1|  hypothetical protein PRUPE_ppa005661mg           82.8    2e-16   
ref|XP_008236618.1|  PREDICTED: polyadenylate-binding protein RBP...  82.8    2e-16   
ref|XP_008377253.1|  PREDICTED: polyadenylate-binding protein RBP...  84.3    2e-16   
ref|XP_009112124.1|  PREDICTED: polyadenylate-binding protein RBP...  82.8    3e-16   
ref|XP_006423626.1|  hypothetical protein CICLE_v10030115mg           84.0    3e-16   
ref|XP_002988285.1|  hypothetical protein SELMODRAFT_447249           85.9    3e-16   
gb|KFK31830.1|  hypothetical protein AALP_AA6G163800                  86.7    3e-16   
gb|KFK31829.1|  hypothetical protein AALP_AA6G163800                  86.7    3e-16   



>ref|XP_006346222.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=414

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+EE +RQVFSPYGELVHVKIVA KRCGFVQF +R SAE ALSSL GAQLG Q++RLS
Sbjct  292  PSVAEEHLRQVFSPYGELVHVKIVAGKRCGFVQFGSRASAEQALSSLNGAQLGGQSIRLS  351

Query  469  WGRNPSNKQSDQT--qwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQ  296
            WGR+PSNKQSDQT      G G   Y    QGYDAYGYAPPPQDPNMYYG+YPGY NYQQ
Sbjct  352  WGRSPSNKQSDQTQWGGSAGGGAGAYYGYAQGYDAYGYAPPPQDPNMYYGNYPGYGNYQQ  411

Query  295  PQQ  287
            PQQ
Sbjct  412  PQQ  414



>ref|XP_009795696.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana sylvestris]
Length=409

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P V+EE +RQVFSPYGELVHVKIVA KRCGFVQF  R SAE ALSSL G QLG Q++RLS
Sbjct  291  PTVAEEHLRQVFSPYGELVHVKIVAGKRCGFVQFGTRASAEQALSSLNGTQLGGQSIRLS  350

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQ  290
            WGR+PS+KQ+DQT    G  G  Y    QGY+AYGYAPP QDPNMYYG+YPGYTNYQQPQ
Sbjct  351  WGRSPSSKQTDQT--QWGGSGGAYYGYGQGYEAYGYAPPAQDPNMYYGNYPGYTNYQQPQ  408

Query  289  Q  287
            Q
Sbjct  409  Q  409



>ref|XP_009600135.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana tomentosiformis]
Length=410

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P V+EE +RQVFSPYGELVHVKIVA KRCGFVQF  R SAE ALSSL G QLG Q++RLS
Sbjct  292  PTVAEEHLRQVFSPYGELVHVKIVAGKRCGFVQFGTRGSAEQALSSLNGTQLGGQSIRLS  351

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQ  290
            WGR+PS+KQ+DQT       G  Y    QGY+AYGYAPP QDPNMYYG+YPGYTNYQQPQ
Sbjct  352  WGRSPSSKQTDQT--QWSGSGGAYYGYGQGYEAYGYAPPAQDPNMYYGNYPGYTNYQQPQ  409

Query  289  Q  287
            Q
Sbjct  410  Q  410



>ref|XP_004244127.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=410

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+EE +RQVFSPYGELVHVKIVA KRCGFVQF +R SAE ALSSL G QLG Q++RLS
Sbjct  288  PSVAEEHLRQVFSPYGELVHVKIVAGKRCGFVQFGSRASAEQALSSLNGTQLGGQSIRLS  347

Query  469  WGRNPSNKQSDQT--qwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQ  296
            WGR+PSNKQSDQ       G G   Y    QGY+AYGYAPP QDPNMYYG+YPGY NYQQ
Sbjct  348  WGRSPSNKQSDQAQWGGSAGAGAGAYYGYAQGYEAYGYAPPAQDPNMYYGNYPGYGNYQQ  407

Query  295  PQQ  287
            PQQ
Sbjct  408  PQQ  410



>sp|Q9LEB4.1|RBP45_NICPL RecName: Full=Polyadenylate-binding protein RBP45; Short=Poly(A)-binding 
protein RBP45; AltName: Full=RNA-binding protein 
45; Short=NplRBP45 [Nicotiana plumbaginifolia]
 emb|CAC01237.1| RNA Binding Protein 45 [Nicotiana plumbaginifolia]
Length=409

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P V+EE +RQVFSPYGELVHVKIVA KRCGFVQF  R SAE ALSSL G QLG Q++RLS
Sbjct  291  PTVAEEHLRQVFSPYGELVHVKIVAGKRCGFVQFGTRASAEQALSSLNGTQLGGQSIRLS  350

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQ  290
            WGR+PS+KQ+DQT    G  G  Y    QGY+AYGYAPP QDPNMYYG+YPGY NYQQPQ
Sbjct  351  WGRSPSSKQTDQT--QWGGSGGAYYGYGQGYEAYGYAPPAQDPNMYYGNYPGYANYQQPQ  408

Query  289  Q  287
            Q
Sbjct  409  Q  409



>emb|CDP05748.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 91/121 (75%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E +RQVF  YGE+VHVKI A KRCGFVQF+NR  AE AL SL G QLG Q++RLS
Sbjct  200  PSVTDENLRQVFGRYGEVVHVKIPAGKRCGFVQFTNRACAEQALESLNGTQLGLQSIRLS  259

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQ  290
            WGR+PSNKQSDQ                QGYDAY YAPPPQDPN+YYG YPGYTNYQQPQ
Sbjct  260  WGRSPSNKQSDQ-----PPWNGGCYGYTQGYDAYAYAPPPQDPNVYYGGYPGYTNYQQPQ  314

Query  289  Q  287
            Q
Sbjct  315  Q  315



>ref|XP_011097972.1| PREDICTED: polyadenylate-binding protein RBP45-like [Sesamum 
indicum]
Length=376

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 91/121 (75%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ ++QVFS YGE+VHVKI   KRCGFVQF++R  AE ALS+L G  LG QN+RLS
Sbjct  261  PNVTDDHLKQVFSQYGEVVHVKIPVGKRCGFVQFADRSCAEQALSNLNGTLLGGQNIRLS  320

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQ  290
            WGRNPSNKQSDQ        GS Y    QGY++YG   PPQDPNMYYG YPGY NYQQPQ
Sbjct  321  WGRNPSNKQSDQN-----QWGSAYYGYTQGYESYGGYAPPQDPNMYYGGYPGYANYQQPQ  375

Query  289  Q  287
            Q
Sbjct  376  Q  376



>emb|CBI26626.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 92/122 (75%), Gaps = 7/122 (6%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVFS YGELVHVKI   KRCGFVQF+NR  AE AL+ L G QLG Q++RLSW
Sbjct  62   NVTDDYLRQVFSQYGELVHVKIPVGKRCGFVQFANRACAEQALAGLNGTQLGAQSIRLSW  121

Query  466  GRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  293
            GR+PSNKQ+  DQ           Y    QGY+AYGYAPPPQDPNMYYG+YPGY NYQQP
Sbjct  122  GRSPSNKQAQPDQA-----QWNGGYYGYAQGYEAYGYAPPPQDPNMYYGAYPGYGNYQQP  176

Query  292  QQ  287
            QQ
Sbjct  177  QQ  178



>emb|CAN83958.1| hypothetical protein VITISV_039907 [Vitis vinifera]
Length=410

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 92/122 (75%), Gaps = 7/122 (6%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVFS YGELVHVKI   KRCGFVQF+NR  AE AL+ L G QLG Q++RLSW
Sbjct  280  NVTDDYLRQVFSQYGELVHVKIPVGKRCGFVQFANRACAEQALAGLNGTQLGAQSIRLSW  339

Query  466  GRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  293
            GR+PSNKQ+  DQ           Y    QGY+AYGYAPPPQDPNMYYG+YPGY NYQQP
Sbjct  340  GRSPSNKQAQPDQA-----QWNGGYYGYAQGYEAYGYAPPPQDPNMYYGAYPGYGNYQQP  394

Query  292  QQ  287
            QQ
Sbjct  395  QQ  396



>ref|XP_002280601.1| PREDICTED: polyadenylate-binding protein RBP45-like [Vitis vinifera]
Length=417

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 92/122 (75%), Gaps = 7/122 (6%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVFS YGELVHVKI   KRCGFVQF+NR  AE AL+ L G QLG Q++RLSW
Sbjct  301  NVTDDYLRQVFSQYGELVHVKIPVGKRCGFVQFANRACAEQALAGLNGTQLGAQSIRLSW  360

Query  466  GRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  293
            GR+PSNKQ+  DQ           Y    QGY+AYGYAPPPQDPNMYYG+YPGY NYQQP
Sbjct  361  GRSPSNKQAQPDQA-----QWNGGYYGYAQGYEAYGYAPPPQDPNMYYGAYPGYGNYQQP  415

Query  292  QQ  287
            QQ
Sbjct  416  QQ  417



>gb|EYU33637.1| hypothetical protein MIMGU_mgv1a007175mg [Erythranthe guttata]
Length=416

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 84/126 (67%), Gaps = 5/126 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ ++QVFS YGELVHVKI   KRCGFVQF+ R  AE AL +L G QLG QN+RLS
Sbjct  291  PNVTDDHLKQVFSQYGELVHVKIPVGKRCGFVQFAERSCAEQALGNLNGTQLGGQNIRLS  350

Query  469  WGRNPSNKQSDQT-----qwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTN  305
            WGR+PSNKQ++Q        GGG     Y          G   PPQDPNMYYG YPGY N
Sbjct  351  WGRSPSNKQTEQNQWGSGGGGGGSYQGGYSQGGYEGHGGGGYAPPQDPNMYYGGYPGYAN  410

Query  304  YQQPQQ  287
            Y QPQQ
Sbjct  411  YHQPQQ  416



>ref|XP_006452313.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 ref|XP_006475160.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Citrus 
sinensis]
 gb|ESR65553.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|KDO62643.1| hypothetical protein CISIN_1g015468mg [Citrus sinensis]
Length=406

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++++++ VF  YGELVHVKI A KRCGFVQF+NR  AE ALS L G QLG Q++RLS
Sbjct  284  PSVTDDILKTVFGQYGELVHVKIPAGKRCGFVQFANRTCAEQALSVLNGTQLGGQSIRLS  343

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  293
            WGR+PSNKQSDQ        G  Y    QGY+AYGYAPP QDPNMYYG +PGY  YQQP
Sbjct  344  WGRSPSNKQSDQA----QWNGGGYYGFAQGYEAYGYAPPTQDPNMYYGGFPGYGTYQQP  398



>ref|XP_006452314.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|ESR65554.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
Length=417

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++++++ VF  YGELVHVKI A KRCGFVQF+NR  AE ALS L G QLG Q++RLS
Sbjct  284  PSVTDDILKTVFGQYGELVHVKIPAGKRCGFVQFANRTCAEQALSVLNGTQLGGQSIRLS  343

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  293
            WGR+PSNKQSDQ        G  Y    QGY+AYGYAPP QDPNMYYG +PGY  YQQP
Sbjct  344  WGRSPSNKQSDQA----QWNGGGYYGFAQGYEAYGYAPPTQDPNMYYGGFPGYGTYQQP  398



>ref|XP_010911059.1| PREDICTED: polyadenylate-binding protein RBP45-like [Elaeis guineensis]
Length=258

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 81/120 (68%), Gaps = 4/120 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+EE++RQVFSPYGELVHVKI   K CGFVQF+NR  AE AL  LQG QLG QN+RLSW
Sbjct  142  NVTEEVLRQVFSPYGELVHVKIPVGKHCGFVQFANRACAEEALLMLQGTQLGGQNIRLSW  201

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQPQ  290
            GR+P+NKQ              YG   + Y       PPQDPNMY YG+YPGY NYQQ Q
Sbjct  202  GRSPTNKQPQPDPNQWNGSYYGYGQGYEAYSYAQ---PPQDPNMYAYGTYPGYGNYQQQQ  258



>ref|XP_008806741.1| PREDICTED: polyadenylate-binding protein RBP45 [Phoenix dactylifera]
Length=420

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 83/120 (69%), Gaps = 4/120 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+EE++RQVFSPYGELVHVKI   K CGFVQF+NRP AE AL  LQG QLG QN+RLSW
Sbjct  304  NVTEEVLRQVFSPYGELVHVKIPVGKHCGFVQFANRPCAEEALLMLQGTQLGGQNIRLSW  363

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQPQ  290
            GR+P+NKQ              YG   + Y+      PPQDPNMY YG+YPGY NYQQ Q
Sbjct  364  GRSPTNKQPQPDPNQWNGSYYGYGQGYEAYNYAQ---PPQDPNMYAYGAYPGYGNYQQQQ  420



>ref|XP_002522953.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF39383.1| nuclear acid binding protein, putative [Ricinus communis]
Length=404

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 86/121 (71%), Gaps = 8/121 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VS+E +RQVF  YGELVHVKI A KRCGFVQF+NR  AE AL  L G QL  Q++RLS
Sbjct  275  PSVSDEHLRQVFGKYGELVHVKIPAGKRCGFVQFANRACAEQALLGLNGTQLAGQSIRLS  334

Query  469  WGRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQ  296
            WGR+PSNKQ+  DQ+QW GG  G   GY   GY       PPQDPNMYY  YPGY NYQQ
Sbjct  335  WGRSPSNKQAQPDQSQWNGGYYGYAQGYDAYGYA------PPQDPNMYYSGYPGYGNYQQ  388

Query  295  P  293
            P
Sbjct  389  P  389



>ref|XP_010276065.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Nelumbo 
nucifera]
Length=417

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 87/120 (73%), Gaps = 4/120 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQVFS +GELVHVKI   KRCGFVQF+NR  AE AL  L G QLG QN+RLSW
Sbjct  301  NVTDEHLRQVFSQFGELVHVKIPVGKRCGFVQFANRACAEEALLMLNGTQLGGQNIRLSW  360

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQPQ  290
            GR+PSNKQ    Q         Y    QGY+AYGYAPPPQDPNMY YG+YPGY NYQQ Q
Sbjct  361  GRSPSNKQP---QPDPNQWNGGYYGYGQGYEAYGYAPPPQDPNMYAYGAYPGYGNYQQQQ  417



>ref|XP_010276064.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Nelumbo 
nucifera]
Length=425

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 88/125 (70%), Gaps = 6/125 (5%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQVFS +GELVHVKI   KRCGFVQF+NR  AE AL  L G QLG QN+RLSW
Sbjct  301  NVTDEHLRQVFSQFGELVHVKIPVGKRCGFVQFANRACAEEALLMLNGTQLGGQNIRLSW  360

Query  466  GRNPSNKQSD-----QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTN  305
            GR+PSNKQ       Q Q         Y    QGY+AYGYAPPPQDPNMY YG+YPGY N
Sbjct  361  GRSPSNKQDPSVGWVQPQPDPNQWNGGYYGYGQGYEAYGYAPPPQDPNMYAYGAYPGYGN  420

Query  304  YQQPQ  290
            YQQ Q
Sbjct  421  YQQQQ  425



>ref|XP_010923889.1| PREDICTED: polyadenylate-binding protein RBP45-like [Elaeis guineensis]
Length=432

 Score =   124 bits (312),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 83/117 (71%), Gaps = 4/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++L+RQVFSPYGELV+VKI   KRCGFVQF  R  AE AL  L G QLG QN+RLS
Sbjct  307  PNVTDDLLRQVFSPYGELVYVKIPVGKRCGFVQFKIRSCAEEALRMLNGTQLGGQNIRLS  366

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q           Y    QGYD YGYAPPPQDPNMY Y +YPGY NY
Sbjct  367  WGRSPANKQPQQD---PNQWNGSYYGYAQGYDTYGYAPPPQDPNMYAYAAYPGYGNY  420


 Score = 33.9 bits (76),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  292  ENDPNNTTIFVGGLDP  307



>ref|XP_010240455.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Brachypodium distachyon]
Length=423

 Score =   122 bits (307),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E+ ++QVF+PYGE++HVKI   KRCGFVQF NRPSAE AL  LQG  +G QNVRLS
Sbjct  293  PNVTEDALKQVFAPYGEVIHVKIPVGKRCGFVQFVNRPSAEQALQMLQGTPIGGQNVRLS  352

Query  469  WGRNPSNKQSDQTqw-gggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+PSNKQ+ ++   G   G  YYG   QGYDAYG    PQDPNMY YG+Y GY NY
Sbjct  353  WGRSPSNKQAQESSQWGANAGAGYYGGYGQGYDAYGGYAQPQDPNMYGYGAYAGYPNY  410


 Score = 35.0 bits (79),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  278  DNDPNNTTIFVGGLDP  293



>ref|XP_010930147.1| PREDICTED: polyadenylate-binding protein RBP45 [Elaeis guineensis]
Length=418

 Score =   123 bits (308),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 75/117 (64%), Gaps = 4/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P V+EEL+RQVFSPYGELV+VKI   KRCGFVQF+ R  AE AL  L G QLG QNVRLS
Sbjct  292  PIVTEELLRQVFSPYGELVYVKIPVGKRCGFVQFAARSCAEEALQMLNGTQLGGQNVRLS  351

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q           Y      Y       PPQDPNMY Y SYPGY NY
Sbjct  352  WGRSPANKQPQQDPNQWNGSYYGYAQGYDTYGYAA---PPQDPNMYAYASYPGYGNY  405


 Score = 33.9 bits (76),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  277  ENDPNNTTIFVGGLDP  292



>ref|XP_010278708.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010278709.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nelumbo nucifera]
Length=430

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVFS +GELVHVKI   KRCGFVQF NR  AE AL  L G QLG QN+RLSW
Sbjct  308  NVTDDHLRQVFSQFGELVHVKIPVGKRCGFVQFVNRACAEEALLMLNGTQLGGQNIRLSW  367

Query  466  GRNPSNKQS----DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            GR+PS+KQ     +Q Q         Y    QGY+AYGYAPPPQDPNMY YG+YPGY NY
Sbjct  368  GRSPSSKQDSVGWEQPQPDPNQWNGGYYGYGQGYEAYGYAPPPQDPNMYAYGAYPGYGNY  427

Query  301  QQ  296
            QQ
Sbjct  428  QQ  429



>ref|XP_003580589.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Brachypodium distachyon]
Length=426

 Score =   121 bits (303),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 90/121 (74%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E+ ++QVF+PYGE++HVKI   KRCGFVQF NRPSAE AL  LQG  +G QNVRLS
Sbjct  293  PNVTEDALKQVFAPYGEVIHVKIPVGKRCGFVQFVNRPSAEQALQMLQGTPIGGQNVRLS  352

Query  469  WGRNPSNKQS----DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTN  305
            WGR+PSNKQ+    + +QWG   G  YYG   QGYDAYG    PQDPNMY YG+Y GY N
Sbjct  353  WGRSPSNKQAQPQQESSQWGANAGAGYYGGYGQGYDAYGGYAQPQDPNMYGYGAYAGYPN  412

Query  304  Y  302
            Y
Sbjct  413  Y  413


 Score = 35.0 bits (79),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  278  DNDPNNTTIFVGGLDP  293



>ref|XP_008792645.1| PREDICTED: polyadenylate-binding protein RBP45-like [Phoenix 
dactylifera]
Length=425

 Score =   122 bits (305),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 83/117 (71%), Gaps = 4/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++L+RQVFSPYGELV+VKI   KRCGFVQF  R  AE AL  L G Q+G Q++RLS
Sbjct  300  PNVTDDLLRQVFSPYGELVYVKIPVGKRCGFVQFKIRSCAEEALRMLNGTQIGGQSIRLS  359

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q           Y    QGYD YGYAPPPQDPNMY Y +YPGY NY
Sbjct  360  WGRSPANKQPQQD---PTQWNGSYYGYAQGYDTYGYAPPPQDPNMYAYAAYPGYGNY  413


 Score = 33.9 bits (76),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  285  ENDPNNTTIFVGGLDP  300



>ref|XP_010278711.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nelumbo nucifera]
 ref|XP_010278712.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Nelumbo nucifera]
Length=423

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 85/118 (72%), Gaps = 4/118 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVFS +GELVHVKI   KRCGFVQF NR  AE AL  L G QLG QN+RLSW
Sbjct  308  NVTDDHLRQVFSQFGELVHVKIPVGKRCGFVQFVNRACAEEALLMLNGTQLGGQNIRLSW  367

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQ  296
            GR+PS+KQ    Q         Y    QGY+AYGYAPPPQDPNMY YG+YPGY NYQQ
Sbjct  368  GRSPSSKQP---QPDPNQWNGGYYGYGQGYEAYGYAPPPQDPNMYAYGAYPGYGNYQQ  422



>dbj|BAK03410.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88936.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   119 bits (298),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 82/125 (66%), Gaps = 9/125 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E+ ++QVF+PYGE+VHVKI   KRCGFVQ++NRPSAE AL  LQG  +G QNVRLS
Sbjct  298  PNVTEDALKQVFAPYGEVVHVKIPVGKRCGFVQYANRPSAEQALQLLQGTLVGGQNVRLS  357

Query  469  WGRNPSNKQSD--------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYP  317
            WGR+PSNKQ+              G  GG Y GY Q           PQDPNMY YG+Y 
Sbjct  358  WGRSPSNKQTQPQEATQWGAGAAAGAAGGYYAGYGQGYEAYGQGYAQPQDPNMYGYGAYA  417

Query  316  GYTNY  302
            GY NY
Sbjct  418  GYPNY  422


 Score = 35.0 bits (79),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  283  DNDPNNTTIFVGGLDP  298



>ref|XP_009406502.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=437

 Score =   120 bits (300),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E +RQVFSPYGE+V++KI   KRCGFVQF NR +AE AL  L G  LG QNVRLS
Sbjct  314  PNVTDEHLRQVFSPYGEIVYIKIPVGKRCGFVQFGNRANAEEALQMLNGTLLGGQNVRLS  373

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q           Y  +   Y       PPQDPNMY Y +YPGY NY
Sbjct  374  WGRSPTNKQPQQDPNQWNGNYYGYTQSYDAYGYA----PPQDPNMYAYATYPGYGNY  426


 Score = 33.9 bits (76),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  299  ENDPNNTTIFVGGLDP  314



>ref|XP_009406503.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=430

 Score =   120 bits (300),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E +RQVFSPYGE+V++KI   KRCGFVQF NR +AE AL  L G  LG QNVRLS
Sbjct  307  PNVTDEHLRQVFSPYGEIVYIKIPVGKRCGFVQFGNRANAEEALQMLNGTLLGGQNVRLS  366

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q           Y  +   Y       PPQDPNMY Y +YPGY NY
Sbjct  367  WGRSPTNKQPQQDPNQWNGNYYGYTQSYDAYGYA----PPQDPNMYAYATYPGYGNY  419


 Score = 33.9 bits (76),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  292  ENDPNNTTIFVGGLDP  307



>ref|XP_009418782.1| PREDICTED: polyadenylate-binding protein RBP45-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   119 bits (299),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 78/117 (67%), Gaps = 5/117 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF PYGE+V+VKI   KRCGFVQF+NR +AE AL +L G  LG QN+RLS
Sbjct  321  PNVTDDHLRQVFGPYGEIVYVKIPVGKRCGFVQFANRANAEEALRALNGTSLGGQNIRLS  380

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q       G   Y  +   Y       PPQDPNMY Y +YPGY NY
Sbjct  381  WGRSPTNKQPQQDPNQWNGGYYGYTQSYDAYGYA----PPQDPNMYAYAAYPGYGNY  433


 Score = 33.9 bits (76),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  306  ENDPNNTTIFVGGLDP  321



>ref|XP_010062999.1| PREDICTED: polyadenylate-binding protein RBP45C [Eucalyptus grandis]
 gb|KCW70173.1| hypothetical protein EUGRSUZ_F03462 [Eucalyptus grandis]
Length=397

 Score =   119 bits (298),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VS++L+RQVFS YGEL HVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLS
Sbjct  274  PSVSDDLLRQVFSQYGELHHVKIPPGKRCGFVQFTSRACAEQALLMLNGTQLGGQSIRLS  333

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  293
            WGR+PSNKQ+          G  Y    QGY+AYGYAPP QDPNM+YG Y GY NYQQP
Sbjct  334  WGRSPSNKQAQ--PEQAQWNGGGYYGYPQGYEAYGYAPPTQDPNMFYGGYAGY-NYQQP  389


 Score = 33.9 bits (76),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  259  ENDPNNTTIFVGGLDP  274



>gb|KHN33037.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=334

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLS
Sbjct  202  PNVTDDHLRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLS  261

Query  469  WGRNPSNKQSD------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYT  308
            WGR+PSNKQ+           G G GG YYGYA QGY+ YGYAP  QDPNM YGSYPGY 
Sbjct  262  WGRSPSNKQAQADPNQWNGAAGAGSGGGYYGYAAQGYENYGYAPAGQDPNM-YGSYPGYP  320

Query  307  NYQQP  293
             YQ P
Sbjct  321  GYQAP  325



>gb|EEE68172.1| hypothetical protein OsJ_26296 [Oryza sativa Japonica Group]
Length=329

 Score =   117 bits (294),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 79/118 (67%), Gaps = 2/118 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++++++QVF+PYG++VHVKI   KRCGFVQF+NR SA+ AL  LQG  +G QNVRLS
Sbjct  193  PSVTDDMLKQVFTPYGDVVHVKIPVGKRCGFVQFANRASADEALVLLQGTLIGGQNVRLS  252

Query  469  WGRNPSNKQSD-QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+PSN+Q+  Q       G +   Y             PQDPNMY YG+Y GY NY
Sbjct  253  WGRSPSNRQAQPQQDSNQWGGANAGYYGYGQGYEGYGYAQPQDPNMYGYGAYAGYPNY  310


 Score = 35.0 bits (79),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDP+NTTIFVGGLDP
Sbjct  178  DSDPSNTTIFVGGLDP  193



>ref|NP_001168324.1| hypothetical protein [Zea mays]
 gb|ACN27804.1| unknown [Zea mays]
 gb|ACN27818.1| unknown [Zea mays]
 gb|AFW68317.1| hypothetical protein ZEAMMB73_975236, partial [Zea mays]
Length=406

 Score =   116 bits (290),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 80/117 (68%), Gaps = 3/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++EL++Q FSPYGEL++VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLS
Sbjct  280  PSVTDELLKQTFSPYGELLYVKIPVGKRCGFVQYSNRASAEEAIRVLNGSQLGGQSIRLS  339

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q Q     GG Y          Y    PPQDP MY Y +YPGY NY
Sbjct  340  WGRSPANKQPQQEQSQWSGGGYYGYPQGYDPYGYAR--PPQDPAMYAYAAYPGYGNY  394


 Score = 36.2 bits (82),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDPNNTT+FVGGLDP
Sbjct  265  DSDPNNTTVFVGGLDP  280



>ref|XP_007153936.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
 gb|ESW25930.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
Length=398

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLS
Sbjct  272  PNVTDDHLRQVFGQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLS  331

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            WGR+PSNKQ+          G YYGYA QGY+ YGYAP  QDPNM YGSYPGY NY
Sbjct  332  WGRSPSNKQAQPDANQWNGSGGYYGYAAQGYENYGYAPAGQDPNM-YGSYPGYANY  386



>dbj|BAE71244.1| putative DNA binding protein [Trifolium pratense]
Length=402

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 81/126 (64%), Gaps = 8/126 (6%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVFS YGELVHVKI + KRCGFVQFS+R SAE A+  L G  LG QNVRLS
Sbjct  268  PNVTDDHLRQVFSQYGELVHVKIPSGKRCGFVQFSDRSSAEEAIRVLNGTLLGGQNVRLS  327

Query  469  WGRNPSNKQSDQT-------qwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGY  311
            WGR PSNKQ+ Q          GGG G   Y         Y  AP  QDPN+ YGSYPGY
Sbjct  328  WGRTPSNKQTQQDPNQWNAAAAGGGGGYYGYPQGGYENYGYAAAPAGQDPNV-YGSYPGY  386

Query  310  TNYQQP  293
              YQ P
Sbjct  387  AGYQHP  392



>gb|EEE61728.1| hypothetical protein OsJ_16246 [Oryza sativa Japonica Group]
Length=607

 Score =   118 bits (295),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 86/120 (72%), Gaps = 4/120 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLS
Sbjct  242  PNVTEDVLKQVFAPYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAVLQGTLIGGQNVRLS  301

Query  469  WGRNPSNKQSDQTq---wgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+ SNKQ          G   G YYG   QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  302  WGRSLSNKQPQHDSNQWGAGAGAGGYYGGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  361


 Score = 33.9 bits (76),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  227  ENDPNNTTIFVGGLDP  242



>ref|XP_009420609.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   116 bits (290),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PN++++ +RQVFS YGE+V+VKI   KRCGFVQF+NR SAE AL  L G  LG Q++RLS
Sbjct  306  PNITDDHLRQVFSAYGEIVYVKIPVGKRCGFVQFANRASAEEALRMLNGTLLGGQSIRLS  365

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q           Y  +   Y       PPQDPNMY Y +YPGY NY
Sbjct  366  WGRSPANKQPQQDPNQWNGSYYGYTQSYDTYGYA----PPQDPNMYAYATYPGYGNY  418


 Score = 35.8 bits (81),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            +SDPNNTTIFVGGLDP
Sbjct  291  ESDPNNTTIFVGGLDP  306



>ref|XP_006652855.1| PREDICTED: polyadenylate-binding protein RBP45-like [Oryza brachyantha]
Length=372

 Score =   117 bits (294),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 2/118 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLS
Sbjct  242  PNVTEDVLKQVFAPYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAMLQGTLIGGQNVRLS  301

Query  469  WGRNPSNKQ-SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+ SNKQ    +   G   G YYG   QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  302  WGRSLSNKQPQHDSNQWGAGAGGYYGGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  359


 Score = 33.9 bits (76),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  227  ENDPNNTTIFVGGLDP  242



>dbj|BAD05744.1| putative RNA Binding Protein 45 [Oryza sativa Japonica Group]
 dbj|BAD05783.1| putative RNA Binding Protein 45 [Oryza sativa Japonica Group]
Length=427

 Score =   117 bits (292),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 79/118 (67%), Gaps = 2/118 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++++++QVF+PYG++VHVKI   KRCGFVQF+NR SA+ AL  LQG  +G QNVRLS
Sbjct  298  PSVTDDMLKQVFTPYGDVVHVKIPVGKRCGFVQFANRASADEALVLLQGTLIGGQNVRLS  357

Query  469  WGRNPSNKQSD-QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+PSN+Q+  Q       G +   Y             PQDPNMY YG+Y GY NY
Sbjct  358  WGRSPSNRQAQPQQDSNQWGGANAGYYGYGQGYEGYGYAQPQDPNMYGYGAYAGYPNY  415


 Score = 35.0 bits (79),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDP+NTTIFVGGLDP
Sbjct  283  DSDPSNTTIFVGGLDP  298



>ref|XP_002447134.1| hypothetical protein SORBIDRAFT_06g029180 [Sorghum bicolor]
 gb|EES11462.1| hypothetical protein SORBIDRAFT_06g029180 [Sorghum bicolor]
Length=440

 Score =   117 bits (293),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 80/125 (64%), Gaps = 9/125 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E+ ++QVFSPYGE+VHVKI   KRCGFVQF  RPSAE AL  LQGA +G QNVRLS
Sbjct  297  PNVTEDTLKQVFSPYGEVVHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLS  356

Query  469  WGRNPSNKQSD--------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYP  317
            WGR+ SNKQ+               G GG Y GY Q           PQDPNMY YG+Y 
Sbjct  357  WGRSLSNKQAQPQQESNQWGAAAAAGAGGYYGGYGQGYEAYGSGYAQPQDPNMYGYGAYA  416

Query  316  GYTNY  302
            GY NY
Sbjct  417  GYPNY  421


 Score = 33.9 bits (76),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  282  ENDPNNTTIFVGGLDP  297



>ref|XP_003573391.1| PREDICTED: polyadenylate-binding protein RBP45-like [Brachypodium 
distachyon]
Length=435

 Score =   116 bits (291),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 90/121 (74%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYGE+VHVKI   KRCGFVQ+++R S+E AL  LQG  +G QNVRLS
Sbjct  302  PNVTEDMLKQVFAPYGEVVHVKIPVGKRCGFVQYASRSSSEEALLMLQGTVIGGQNVRLS  361

Query  469  WGRNPSNKQ----SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTN  305
            WGR+PSNKQ     D  QWGG    + Y    QGY+AYGYA  PQDPNMY YG+Y GY N
Sbjct  362  WGRSPSNKQVQTPQDSNQWGGATANAGYYGYGQGYEAYGYAAQPQDPNMYGYGAYAGYPN  421

Query  304  Y  302
            Y
Sbjct  422  Y  422


 Score = 34.7 bits (78),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDP+NTTIFVGGLDP
Sbjct  287  DSDPSNTTIFVGGLDP  302



>ref|XP_003549897.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
 gb|KHN03463.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=402

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLS
Sbjct  274  PNVTDDHLRQVFGQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLS  333

Query  469  WGRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            WGR+PSNKQ+  D  QW G  GG YYGYAQ GY+ YGYAP  QDPNM YGSYPGY NY
Sbjct  334  WGRSPSNKQAQPDANQWNGSGGGGYYGYAQGGYENYGYAPAGQDPNM-YGSYPGYANY  390



>ref|XP_008796097.1| PREDICTED: polyadenylate-binding protein RBP45 [Phoenix dactylifera]
Length=420

 Score =   116 bits (291),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P V+EE +RQVFS YGELV+VKI   KRCGFVQF+ R  AE AL  L G QLG QN+RLS
Sbjct  293  PIVTEEHLRQVFSQYGELVYVKIPVGKRCGFVQFAVRSCAEEALQMLNGTQLGGQNIRLS  352

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q           Y      Y       PPQDPNMY Y SYPGY NY
Sbjct  353  WGRSPANKQPQQDSTQWNGSYYGYTQGYDTYGYA----PPQDPNMYAYASYPGYGNY  405


 Score = 34.3 bits (77),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  278  ENDPNNTTIFVGGLDP  293



>ref|NP_001053941.1| Os04g0625800 [Oryza sativa Japonica Group]
 dbj|BAF15855.1| Os04g0625800 [Oryza sativa Japonica Group]
 dbj|BAH00195.1| unnamed protein product [Oryza sativa Japonica Group]
Length=425

 Score =   116 bits (291),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 86/120 (72%), Gaps = 4/120 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLS
Sbjct  293  PNVTEDVLKQVFAPYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAVLQGTLIGGQNVRLS  352

Query  469  WGRNPSNKQSDQTq---wgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+ SNKQ          G   G YYG   QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  353  WGRSLSNKQPQHDSNQWGAGAGAGGYYGGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  412


 Score = 33.9 bits (76),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  278  ENDPNNTTIFVGGLDP  293



>emb|CAE04743.3| OSJNBb0060E08.6 [Oryza sativa Japonica Group]
 emb|CAH66831.1| OSIGBa0148A10.8 [Oryza sativa Indica Group]
Length=414

 Score =   116 bits (291),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 86/120 (72%), Gaps = 4/120 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLS
Sbjct  282  PNVTEDVLKQVFAPYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAVLQGTLIGGQNVRLS  341

Query  469  WGRNPSNKQSDQTq---wgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+ SNKQ          G   G YYG   QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  342  WGRSLSNKQPQHDSNQWGAGAGAGGYYGGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  401


 Score = 33.9 bits (76),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  267  ENDPNNTTIFVGGLDP  282



>gb|EAY95645.1| hypothetical protein OsI_17510 [Oryza sativa Indica Group]
Length=426

 Score =   116 bits (291),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 86/120 (72%), Gaps = 4/120 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLS
Sbjct  294  PNVTEDVLKQVFAPYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAVLQGTLIGGQNVRLS  353

Query  469  WGRNPSNKQSDQTq---wgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+ SNKQ          G   G YYG   QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  354  WGRSLSNKQPQHDSNQWGAGAGAGGYYGGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  413


 Score = 33.9 bits (76),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  279  ENDPNNTTIFVGGLDP  294



>gb|EAY95631.1| hypothetical protein OsI_17488 [Oryza sativa Indica Group]
Length=263

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 85/120 (71%), Gaps = 4/120 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLS
Sbjct  131  PNVTEDVLKQVFAPYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAVLQGTLIGGQNVRLS  190

Query  469  WGRNPSNKQSDQTq---wgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+ SNKQ          G   G YY    QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  191  WGRSLSNKQPQHDSNQWGAGAGAGGYYSGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  250



>gb|EEC75600.1| hypothetical protein OsI_12307 [Oryza sativa Indica Group]
Length=406

 Score =   114 bits (285),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E+++Q FSPYGELV+VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLS
Sbjct  277  PSVTDEVLKQAFSPYGELVYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLS  336

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P NKQ  Q Q     G   Y         Y    PPQDP MY Y +YPGY NY
Sbjct  337  WGRSPGNKQPQQDQNQWNAGYYGYPPQGYDPYGYAR--PPQDPAMYAYAAYPGYGNY  391


 Score = 36.2 bits (82),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDPNNTT+FVGGLDP
Sbjct  262  DSDPNNTTVFVGGLDP  277



>ref|XP_002464324.1| hypothetical protein SORBIDRAFT_01g016170 [Sorghum bicolor]
 gb|EER91322.1| hypothetical protein SORBIDRAFT_01g016170 [Sorghum bicolor]
Length=409

 Score =   114 bits (285),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++EL++Q FSPYGEL++VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLS
Sbjct  283  PSVTDELLKQTFSPYGELLYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLS  342

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q Q     GG Y          Y    PPQDP MY Y  YPGY NY
Sbjct  343  WGRSPANKQPQQEQNQWSGGGYYGYPQGYDPYGYAR--PPQDPAMYAYTPYPGYGNY  397


 Score = 35.8 bits (81),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDPNNTT+FVGGLDP
Sbjct  268  DSDPNNTTVFVGGLDP  283



>gb|EAZ27535.1| hypothetical protein OsJ_11490 [Oryza sativa Japonica Group]
Length=171

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E+++Q FSPYGELV+VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLS
Sbjct  42   PSVTDEVLKQAFSPYGELVYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLS  101

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P NKQ  Q Q     G   Y         Y    PPQDP MY Y +YPGY NY
Sbjct  102  WGRSPGNKQPQQDQNQWNAGYYGYPPQGYDPYGYVR--PPQDPAMYAYAAYPGYGNY  156



>gb|ABF97193.1| RNA recognition motif family protein, expressed [Oryza sativa 
Japonica Group]
Length=406

 Score =   114 bits (284),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E+++Q FSPYGELV+VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLS
Sbjct  277  PSVTDEVLKQAFSPYGELVYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLS  336

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P NKQ  Q Q     G   Y         Y    PPQDP MY Y +YPGY NY
Sbjct  337  WGRSPGNKQPQQDQNQWNAGYYGYPPQGYDPYGYVR--PPQDPAMYAYAAYPGYGNY  391


 Score = 36.2 bits (82),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDPNNTT+FVGGLDP
Sbjct  262  DSDPNNTTVFVGGLDP  277



>ref|XP_003546146.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
Length=411

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLS
Sbjct  279  PNVTDDHLRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLS  338

Query  469  WGRNPSNKQSD------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYT  308
            WGR+PSNKQ+           G G GG YYGYA QGY+ YGYAP  QDPNM YGSYPGY 
Sbjct  339  WGRSPSNKQAQADPNQWNGAAGAGSGGGYYGYAAQGYENYGYAPAGQDPNM-YGSYPGYP  397

Query  307  NYQQP  293
             YQ P
Sbjct  398  GYQAP  402



>gb|AAG59664.1|AC084319_22 putative RNA binding protein [Oryza sativa Japonica Group]
 gb|ABF97192.1| RNA recognition motif family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95141.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   114 bits (284),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E+++Q FSPYGELV+VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLS
Sbjct  277  PSVTDEVLKQAFSPYGELVYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLS  336

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P NKQ  Q Q     G   Y         Y    PPQDP MY Y +YPGY NY
Sbjct  337  WGRSPGNKQPQQDQNQWNAGYYGYPPQGYDPYGYVR--PPQDPAMYAYAAYPGYGNY  391


 Score = 35.8 bits (81),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDPNNTT+FVGGLDP
Sbjct  262  DSDPNNTTVFVGGLDP  277



>gb|EMS60206.1| RNA-binding post-transcriptional regulator csx1 [Triticum urartu]
Length=336

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 88/121 (73%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PN +E++++Q+F+PYGE+VHVKI   KRCGFVQ+++R SAE AL  LQG  +G QNVRLS
Sbjct  194  PNATEDVLKQLFTPYGEVVHVKIPVGKRCGFVQYASRSSAEEALLMLQGTMIGGQNVRLS  253

Query  469  WGRNPSNKQ----SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTN  305
            WGR+PSNKQ     D  QWGG    + Y    QGY AYGYA  PQDPNMY YG+Y GY N
Sbjct  254  WGRSPSNKQVQSQQDFNQWGGATANAGYYGYGQGYRAYGYATHPQDPNMYGYGTYAGYPN  313

Query  304  Y  302
            Y
Sbjct  314  Y  314



>gb|KEH36836.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=401

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 91/123 (74%), Gaps = 5/123 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF+ YGELVHVKI + KRCGFVQFS+R  AE A+  L G  LG QNVRLS
Sbjct  270  PNVTDDHLRQVFTQYGELVHVKIPSGKRCGFVQFSDRSCAEEAIRVLNGTLLGGQNVRLS  329

Query  469  WGRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPP--QDPNMYYGSYPGYTNY  302
            WGR PSNKQ+  D TQ G    G YYGYAQ GY+ YGYA PP  QDPN+ YGSYPGY  Y
Sbjct  330  WGRTPSNKQTQQDPTQGGYPAAGGYYGYAQGGYENYGYAAPPAGQDPNV-YGSYPGYPGY  388

Query  301  QQP  293
            Q P
Sbjct  389  QHP  391



>ref|NP_001050516.1| Os03g0569900 [Oryza sativa Japonica Group]
 dbj|BAF12430.1| Os03g0569900, partial [Oryza sativa Japonica Group]
Length=446

 Score =   113 bits (283),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E+++Q FSPYGELV+VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLS
Sbjct  321  PSVTDEVLKQAFSPYGELVYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLS  380

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P NKQ  Q Q     G   Y         Y    PPQDP MY Y +YPGY NY
Sbjct  381  WGRSPGNKQPQQDQNQWNAGYYGYPPQGYDPYGYVR--PPQDPAMYAYAAYPGYGNY  435


 Score = 35.8 bits (81),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDPNNTT+FVGGLDP
Sbjct  306  DSDPNNTTVFVGGLDP  321



>gb|EMT04468.1| RNA-binding post-transcriptional regulator csx1 [Aegilops tauschii]
Length=350

 Score =   117 bits (292),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 2/118 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PN +E++++QVF+PYG++VHVKI   KRCGFVQ+++R SAE AL  LQG  +G QNVRLS
Sbjct  211  PNATEDVLKQVFTPYGDVVHVKIPVGKRCGFVQYASRFSAEEALLMLQGTMIGGQNVRLS  270

Query  469  WGRNPSNKQ-SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+PSNKQ  D   WGG    + Y    QGY AYGYA  PQDPNMY YG+Y GY NY
Sbjct  271  WGRSPSNKQVQDFNHWGGATANAGYYGYGQGYGAYGYATQPQDPNMYGYGTYAGYPNY  328


 Score = 32.0 bits (71),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DP+N+TIFVGGLDP
Sbjct  196  DNDPSNSTIFVGGLDP  211



>ref|XP_003529629.1| PREDICTED: polyadenylate-binding protein RBP45 [Glycine max]
Length=397

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLS
Sbjct  270  PNVTDDHLRQVFGHYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLS  329

Query  469  WGRNPSNKQSD-QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            WGR+PSNKQ+        G GG YYGYAQ GY+ YGYAP  QDPNM YGSYPGY NY
Sbjct  330  WGRSPSNKQAQPDANQWNGSGGGYYGYAQGGYENYGYAPAGQDPNM-YGSYPGYANY  385



>gb|KHN35750.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=397

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLS
Sbjct  270  PNVTDDHLRQVFGHYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLS  329

Query  469  WGRNPSNKQSD-QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            WGR+PSNKQ+        G GG YYGYAQ GY+ YGYAP  QDPNM YGSYPGY NY
Sbjct  330  WGRSPSNKQAQPDANQWNGSGGGYYGYAQGGYENYGYAPAGQDPNM-YGSYPGYANY  385



>ref|XP_008676816.1| PREDICTED: uncharacterized protein LOC100273450 isoform X1 [Zea 
mays]
 gb|ACF85557.1| unknown [Zea mays]
 gb|AFW61058.1| hypothetical protein ZEAMMB73_234884 [Zea mays]
Length=456

 Score =   114 bits (284),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYG++VHVKI   KRCGFVQ++NR SAE AL  LQG  +G QNVRLS
Sbjct  324  PNVTEDMLKQVFTPYGDVVHVKIPVGKRCGFVQYANRSSAEEALVILQGTLVGGQNVRLS  383

Query  469  WGRNPSNKQ-SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNY  302
            WGR+PSNKQ   Q       G +   Y           P  QDPNMY    G+Y GY NY
Sbjct  384  WGRSPSNKQVQPQQDSNQWAGANAGYYGYGQGYEAYGYPQSQDPNMYNYGAGAYAGYPNY  443


 Score = 35.0 bits (79),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  309  DNDPNNTTIFVGGLDP  324



>gb|AFW61056.1| hypothetical protein ZEAMMB73_234884 [Zea mays]
Length=453

 Score =   114 bits (284),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYG++VHVKI   KRCGFVQ++NR SAE AL  LQG  +G QNVRLS
Sbjct  314  PNVTEDMLKQVFTPYGDVVHVKIPVGKRCGFVQYANRSSAEEALVILQGTLVGGQNVRLS  373

Query  469  WGRNPSNKQSD-QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNY  302
            WGR+PSNKQ   Q       G +   Y           P  QDPNMY    G+Y GY NY
Sbjct  374  WGRSPSNKQVQPQQDSNQWAGANAGYYGYGQGYEAYGYPQSQDPNMYNYGAGAYAGYPNY  433


 Score = 35.0 bits (79),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  299  DNDPNNTTIFVGGLDP  314



>ref|XP_008661406.1| PREDICTED: uncharacterized protein LOC100193230 isoform X1 [Zea 
mays]
Length=503

 Score =   114 bits (286),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 80/125 (64%), Gaps = 9/125 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++Q FSPYGE++HVKI   KRCGFVQF  RPSAE AL  LQGA +G QNVRLS
Sbjct  366  PNVTEDVLKQAFSPYGEVIHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLS  425

Query  469  WGRNPSNKQSD--------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYP  317
            WGR+ SNKQ+               GVG  Y GY Q           PQDPNMY YG+Y 
Sbjct  426  WGRSLSNKQTQPQQESMQWGAGAPAGVGDYYGGYGQGYEAYGSGYAQPQDPNMYGYGAYV  485

Query  316  GYTNY  302
            GY NY
Sbjct  486  GYPNY  490


 Score = 33.9 bits (76),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  351  ENDPNNTTIFVGGLDP  366



>ref|XP_004982540.1| PREDICTED: polyadenylate-binding protein RBP45-like [Setaria 
italica]
Length=409

 Score =   114 bits (285),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 78/117 (67%), Gaps = 4/117 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E++RQ FSPYGEL++VKI   KRCGFVQ+SNR SAE A+  L G QLG Q+VRLS
Sbjct  284  PSVTDEVLRQTFSPYGELLYVKIPVGKRCGFVQYSNRASAEEAIRVLNGTQLGGQSVRLS  343

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+P+NKQ  Q Q     G   Y      Y       PPQDP MY Y +YPGY NY
Sbjct  344  WGRSPANKQPQQEQNQWSSGYYGYPQGYDPYGYAR---PPQDPAMYAYTAYPGYGNY  397


 Score = 34.3 bits (77),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTT+FVGGLDP
Sbjct  269  DNDPNNTTVFVGGLDP  284



>ref|NP_001141359.1| uncharacterized protein LOC100273450 [Zea mays]
 gb|ACF86164.1| unknown [Zea mays]
 gb|AFW61059.1| hypothetical protein ZEAMMB73_234884 [Zea mays]
Length=453

 Score =   113 bits (283),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 77/119 (65%), Gaps = 5/119 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYG++VHVKI   KRCGFVQ++NR SAE AL  LQG  +G QNVRLS
Sbjct  324  PNVTEDMLKQVFTPYGDVVHVKIPVGKRCGFVQYANRSSAEEALVILQGTLVGGQNVRLS  383

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNY  302
            WGR+PSNKQ   +      G +   Y           P  QDPNMY    G+Y GY NY
Sbjct  384  WGRSPSNKQVQDS--NQWAGANAGYYGYGQGYEAYGYPQSQDPNMYNYGAGAYAGYPNY  440


 Score = 35.0 bits (79),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  309  DNDPNNTTIFVGGLDP  324



>ref|NP_001131852.1| uncharacterized protein LOC100193230 [Zea mays]
 gb|ACF80447.1| unknown [Zea mays]
 gb|AFW59517.1| hypothetical protein ZEAMMB73_768040 [Zea mays]
Length=434

 Score =   114 bits (286),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 80/125 (64%), Gaps = 9/125 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++Q FSPYGE++HVKI   KRCGFVQF  RPSAE AL  LQGA +G QNVRLS
Sbjct  291  PNVTEDVLKQAFSPYGEVIHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLS  350

Query  469  WGRNPSNKQSD--------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYP  317
            WGR+ SNKQ+               GVG  Y GY Q           PQDPNMY YG+Y 
Sbjct  351  WGRSLSNKQTQPQQESMQWGAGAPAGVGDYYGGYGQGYEAYGSGYAQPQDPNMYGYGAYV  410

Query  316  GYTNY  302
            GY NY
Sbjct  411  GYPNY  415


 Score = 33.9 bits (76),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  276  ENDPNNTTIFVGGLDP  291



>gb|EMS52025.1| RNA-binding post-transcriptional regulator csx1 [Triticum urartu]
Length=514

 Score =   115 bits (288),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 2/118 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P  +E++++QVF+PYG++VHVKI   KRCGFVQ+++R SAE AL  LQG  +G QNVRLS
Sbjct  375  PKATEDVLKQVFTPYGDVVHVKIPVGKRCGFVQYASRSSAEEALLMLQGTMIGGQNVRLS  434

Query  469  WGRNPSNKQ-SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+PSNKQ  D   WGG    + Y    QGY AYGYA  PQDPNMY YG+Y GY NY
Sbjct  435  WGRSPSNKQVQDFNHWGGATANAGYYRYGQGYGAYGYATQPQDPNMYGYGTYAGYPNY  492


 Score = 33.1 bits (74),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDPQ  645
            D+DP+N+TIFVGGLDP+
Sbjct  360  DNDPSNSTIFVGGLDPK  376



>gb|AFW59516.1| hypothetical protein ZEAMMB73_768040, partial [Zea mays]
Length=428

 Score =   114 bits (285),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 80/125 (64%), Gaps = 9/125 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++Q FSPYGE++HVKI   KRCGFVQF  RPSAE AL  LQGA +G QNVRLS
Sbjct  291  PNVTEDVLKQAFSPYGEVIHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLS  350

Query  469  WGRNPSNKQSD--------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYP  317
            WGR+ SNKQ+               GVG  Y GY Q           PQDPNMY YG+Y 
Sbjct  351  WGRSLSNKQTQPQQESMQWGAGAPAGVGDYYGGYGQGYEAYGSGYAQPQDPNMYGYGAYV  410

Query  316  GYTNY  302
            GY NY
Sbjct  411  GYPNY  415


 Score = 33.5 bits (75),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  276  ENDPNNTTIFVGGLDP  291



>ref|XP_006659900.1| PREDICTED: polyadenylate-binding protein RBP45-like [Oryza brachyantha]
Length=420

 Score =   114 bits (285),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ ++QVF+PYG++VHVKI   KRCGFVQF++R +AE AL  LQG  +G QNVRLS
Sbjct  291  PSVTDDALKQVFTPYGDVVHVKIPVGKRCGFVQFASRAAAEEALVLLQGTLIGGQNVRLS  350

Query  469  WGRNPSNKQSD-QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            WGR+PSN+Q+  Q       G +   Y             PQDPNMY YG+Y GY NY
Sbjct  351  WGRSPSNRQAQPQQDSNQWGGATTGYYGYGQGYEAYGYAQPQDPNMYGYGAYAGYPNY  408


 Score = 33.1 bits (74),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DP+NTTIFVGGLDP
Sbjct  276  DNDPSNTTIFVGGLDP  291



>ref|XP_009614215.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=415

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 79/115 (69%), Gaps = 3/115 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q++RLSW
Sbjct  289  NVTDDHLRQVFGHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRALSGTQLGGQSIRLSW  348

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQ  Q           Y     GY+AYGYAPP QDPNMYY  Y GY NY
Sbjct  349  GRSPSNKQQPQV---DPNQYGGYYGYTPGYEAYGYAPPAQDPNMYYAGYAGYGNY  400



>ref|XP_004486120.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cicer arietinum]
Length=399

 Score =   115 bits (288),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 82/123 (67%), Gaps = 5/123 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVFS YGELVHVKI + KRCGFVQFS+R  AE A+  L G  LG QNVRLS
Sbjct  268  PNVTDDHLRQVFSQYGELVHVKIPSGKRCGFVQFSDRSCAEEAIRVLNGTLLGGQNVRLS  327

Query  469  WGRNPSNKQSDQT----qwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            WGR PSNKQ+ Q       GGG  G    +   GY A   AP  QDPN+ YGSYPGY  Y
Sbjct  328  WGRTPSNKQTQQDPNQWGPGGGYYGYPQSFENYGYAAAAPAPAGQDPNV-YGSYPGYAGY  386

Query  301  QQP  293
            Q P
Sbjct  387  QAP  389


 Score = 31.6 bits (70),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVG LDP
Sbjct  253  ENDPNNTTIFVGNLDP  268



>ref|XP_004976877.1| PREDICTED: polyadenylate-binding protein RBP45-like [Setaria 
italica]
Length=428

 Score =   113 bits (282),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 79/123 (64%), Gaps = 7/123 (6%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYGE+VHVKI   KRCGFVQF  RPSAE AL  LQG  +G QNVRLS
Sbjct  293  PNVTEDVLKQVFAPYGEVVHVKIPVGKRCGFVQFVTRPSAEQALLMLQGTLIGGQNVRLS  352

Query  469  WGRNPSNK------QSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGY  311
            WGR+ SNK      Q          GG Y GY Q      G    PQDPNMY YG+Y GY
Sbjct  353  WGRSLSNKPQQDSNQWGGAAASAAAGGYYGGYGQGYEAYGGGYAQPQDPNMYGYGAYAGY  412

Query  310  TNY  302
             NY
Sbjct  413  PNY  415


 Score = 33.9 bits (76),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  278  ENDPNNTTIFVGGLDP  293



>ref|XP_011096085.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Sesamum 
indicum]
Length=420

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 78/115 (68%), Gaps = 5/115 (4%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSW
Sbjct  295  NVTDEHLRQVFGQYGQLLHVKIPVGKRCGFVQFTDRSCAEEALRILNGTQLGGQSIRLSW  354

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQ D         G  Y     GY+ YGYAP  QDPN+YY  YPGY NY
Sbjct  355  GRSPSNKQVDPN-----QWGGGYYGYAPGYETYGYAPAAQDPNLYYAGYPGYGNY  404



>ref|XP_009776429.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=415

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 79/115 (69%), Gaps = 3/115 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q++RLSW
Sbjct  289  NVTDDHLRQVFGHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRALSGTQLGGQSIRLSW  348

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQ  Q           Y     GY+AYGYAPP QDPNMYY  Y GY NY
Sbjct  349  GRSPSNKQQPQV---DPNQYGGYYGYTPGYEAYGYAPPVQDPNMYYAGYAGYGNY  400



>ref|XP_008349306.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Malus domestica]
Length=377

 Score =   114 bits (286),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 81/117 (69%), Gaps = 3/117 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVFS YGELVHVKI   KRCGFVQF++R  AE AL  L G+QLG QN+RLSW
Sbjct  245  NVTDDHLRQVFSKYGELVHVKIPMGKRCGFVQFADRSCAEEALRVLNGSQLGAQNIRLSW  304

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYP--GYTNY  302
            GR+PSNKQ  Q       GG  Y       D+YGYA   QDPN+YYGSYP  GY NY
Sbjct  305  GRSPSNKQP-QADPSQWNGGGGYYGYAPTPDSYGYAQVSQDPNLYYGSYPAAGYGNY  360


 Score = 31.6 bits (70),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            DSDPNNTTIFVG LD
Sbjct  229  DSDPNNTTIFVGNLD  243



>gb|AFK41944.1| unknown [Medicago truncatula]
Length=411

 Score =   114 bits (286),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 86/118 (73%), Gaps = 3/118 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E ++QVF+ YGELVHVKI + KRCGFVQF++R SAE AL  L G  LG QNVRLS
Sbjct  283  PNVTDEHLKQVFTQYGELVHVKIPSGKRCGFVQFADRSSAEEALRVLNGTLLGGQNVRLS  342

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPP-QDPNMYYGSYP-GYTNY  302
            WGR+P+NKQ+ Q         SY+G   QGY+ Y YAPP  QDPNM YGSYP GY +Y
Sbjct  343  WGRSPANKQTQQDPNQWNGSSSYFGGYAQGYENYAYAPPAGQDPNM-YGSYPAGYASY  399


 Score = 31.2 bits (69),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVG LDP
Sbjct  268  ENDPNNTTIFVGNLDP  283



>ref|XP_003610417.1| RNA-binding protein [Medicago truncatula]
 gb|AES92614.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=411

 Score =   114 bits (286),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 86/118 (73%), Gaps = 3/118 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E ++QVF+ YGELVHVKI + KRCGFVQF++R SAE AL  L G  LG QNVRLS
Sbjct  283  PNVTDEHLKQVFTQYGELVHVKIPSGKRCGFVQFADRSSAEEALRVLNGTLLGGQNVRLS  342

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPP-QDPNMYYGSYP-GYTNY  302
            WGR+P+NKQ+ Q         SY+G   QGY+ Y YAPP  QDPNM YGSYP GY +Y
Sbjct  343  WGRSPANKQTQQDPNQWNGSSSYFGGYAQGYENYAYAPPAGQDPNM-YGSYPAGYASY  399


 Score = 31.2 bits (69),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVG LDP
Sbjct  268  ENDPNNTTIFVGNLDP  283



>gb|AEW68341.1| putative nuclear acid binding protein [Medicago sativa]
Length=409

 Score =   114 bits (285),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 85/118 (72%), Gaps = 3/118 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E ++QVF+ YGELVHVKI + KRCGFVQF++R SAE AL  L G  LG QNVRLS
Sbjct  281  PNVTDEHLKQVFTQYGELVHVKIPSGKRCGFVQFADRSSAEEALRVLNGTLLGGQNVRLS  340

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPP-QDPNMYYGSYP-GYTNY  302
            WGR+P+NKQ+ Q          Y+G   QGY+ Y YAPP  QDPNM YGSYP GY +Y
Sbjct  341  WGRSPANKQTQQDPNQWNGSSGYFGGYAQGYENYAYAPPAGQDPNM-YGSYPAGYASY  397


 Score = 31.2 bits (69),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVG LDP
Sbjct  266  ENDPNNTTIFVGNLDP  281



>gb|KHN37596.1| Polyadenylate-binding protein RBP45B, partial [Glycine soja]
Length=357

 Score =   114 bits (285),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 91/122 (75%), Gaps = 6/122 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLS
Sbjct  224  PNVTDDHLRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLS  283

Query  469  WGRNPSNKQS----DQTqwgggvggsyygyaqqgydaygyAPPP-QDPNMYYGSYPGYTN  305
            WGR+PSNKQ+    +Q   G G GG YYGYA QGY+ YGYAP   QDPNM YGSYPGY  
Sbjct  284  WGRSPSNKQAQADPNQWNGGAGSGGGYYGYAAQGYENYGYAPAAGQDPNM-YGSYPGYPG  342

Query  304  YQ  299
            YQ
Sbjct  343  YQ  344


 Score = 31.6 bits (70),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVG LDP
Sbjct  209  ENDPNNTTIFVGNLDP  224



>ref|XP_009776437.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=414

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 78/115 (68%), Gaps = 4/115 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q++RLSW
Sbjct  289  NVTDDHLRQVFGHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRALSGTQLGGQSIRLSW  348

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQ              Y     GY+AYGYAPP QDPNMYY  Y GY NY
Sbjct  349  GRSPSNKQP----QVDPNQYGGYYGYTPGYEAYGYAPPVQDPNMYYAGYAGYGNY  399



>ref|XP_004972673.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Setaria italica]
Length=456

 Score =   107 bits (268),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYGE+VHVKI   KRCGFVQ++NR SAE AL  LQG  +G QNVRLS
Sbjct  312  PNVTEDVLKQVFAPYGEVVHVKIPVGKRCGFVQYANRSSAEEALVILQGTLIGGQNVRLS  371

Query  469  WGRNPSNKQ  443
            WGR+PSNKQ
Sbjct  372  WGRSPSNKQ  380


 Score = 36.2 bits (82),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 16/16 (100%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDPNNTTIFVGGLDP
Sbjct  297  DSDPNNTTIFVGGLDP  312



>ref|XP_004972674.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Setaria italica]
Length=446

 Score =   107 bits (267),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E++++QVF+PYGE+VHVKI   KRCGFVQ++NR SAE AL  LQG  +G QNVRLS
Sbjct  312  PNVTEDVLKQVFAPYGEVVHVKIPVGKRCGFVQYANRSSAEEALVILQGTLIGGQNVRLS  371

Query  469  WGRNPSNKQ  443
            WGR+PSNKQ
Sbjct  372  WGRSPSNKQ  380


 Score = 36.2 bits (82),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 16/16 (100%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            DSDPNNTTIFVGGLDP
Sbjct  297  DSDPNNTTIFVGGLDP  312



>ref|XP_004507695.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Cicer arietinum]
Length=400

 Score =   112 bits (280),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLS
Sbjct  274  PNVTDDHLRQVFGQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLS  333

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            WG++P NKQ+ Q           YGY Q   +        QDPNM YGSYPGY NY
Sbjct  334  WGKSP-NKQAQQDPNQWSGYTQGYGYTQGYENYGYAPAAGQDPNM-YGSYPGYANY  387


 Score = 31.2 bits (69),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVG LDP
Sbjct  259  ENDPNNTTIFVGNLDP  274



>ref|XP_010675694.1| PREDICTED: polyadenylate-binding protein RBP45 [Beta vulgaris 
subsp. vulgaris]
Length=417

 Score =   109 bits (272),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 87/122 (71%), Gaps = 4/122 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQVFSPYGELVHVKI   K CGFVQF +R +AE AL++L G Q+G QNVRLS
Sbjct  299  PNVSDEQLRQVFSPYGELVHVKIPMGKGCGFVQFGSRAAAEQALAALNGVQIGSQNVRLS  358

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY-PGYTNYQQP  293
            WGR+PS KQ    Q G       Y    QGYDAYGYA  PQDPNMYY +Y  GY NYQQ 
Sbjct  359  WGRSPSAKQG---QPGQAQWNGGYYGYPQGYDAYGYAAAPQDPNMYYANYAAGYGNYQQT  415

Query  292  QQ  287
            QQ
Sbjct  416  QQ  417


 Score = 33.9 bits (76),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  284  ENDPNNTTIFVGGLDP  299



>ref|XP_011096084.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Sesamum 
indicum]
Length=422

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSW
Sbjct  295  NVTDEHLRQVFGQYGQLLHVKIPVGKRCGFVQFTDRSCAEEALRILNGTQLGGQSIRLSW  354

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQ    Q      G  Y     GY+ YGYAP  QDPN+YY  YPGY NY
Sbjct  355  GRSPSNKQP---QVDPNQWGGGYYGYAPGYETYGYAPAAQDPNLYYAGYPGYGNY  406



>ref|XP_007211969.1| hypothetical protein PRUPE_ppa006617mg [Prunus persica]
 gb|EMJ13168.1| hypothetical protein PRUPE_ppa006617mg [Prunus persica]
Length=403

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 75/116 (65%), Gaps = 3/116 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVFS YG+L+HVKI A KRCGFVQF +R  AE AL  L G+QLG QN+RLSW
Sbjct  276  NVTDDHLRQVFSQYGDLLHVKIPAGKRCGFVQFQDRSCAEEALRVLNGSQLGAQNIRLSW  335

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYP-GYTNY  302
            GR+PSNKQ          GG Y          Y      QDP+MYYG YP GY+NY
Sbjct  336  GRSPSNKQPQADPNQWNGGGYYGYAPTPDGYGYAQV--SQDPSMYYGGYPAGYSNY  389



>ref|XP_010327241.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum lycopersicum]
Length=411

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+++ +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL++L G QLG Q +RLSW
Sbjct  284  SVTDDHLRQVFGNYGQLLHVKIPLGKRCGFVQFTDRSCAEEALNALSGTQLGGQTIRLSW  343

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQ  Q+Q         Y     GYDAYGYA P QDPNMYY  Y GY NY
Sbjct  344  GRSPSNKQ--QSQGDPNQWSGGYYGYTPGYDAYGYAQPTQDPNMYYAGYAGYGNY  396



>gb|KCW76953.1| hypothetical protein EUGRSUZ_D01313 [Eucalyptus grandis]
Length=270

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 76/118 (64%), Gaps = 8/118 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  YGE+V VKI   KRCGFVQF++R  AE AL  L G QLG QN+RLS
Sbjct  143  PNVTDDHLRQVFGQYGEIVQVKIPPGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLS  202

Query  469  WGRNPSNKQ--SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            WGR+P+NKQ  SD +Q+GG  G +          A       QD NMYYG Y GY NY
Sbjct  203  WGRSPANKQPQSDPSQYGGYYGYAAGYENYGYGAAS------QDANMYYGGYAGYANY  254



>ref|XP_010052832.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Eucalyptus 
grandis]
 gb|KCW76949.1| hypothetical protein EUGRSUZ_D01310 [Eucalyptus grandis]
Length=427

 Score =   109 bits (273),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 76/118 (64%), Gaps = 8/118 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  YGE+V VKI   KRCGFVQF++R  AE AL  L G QLG QN+RLS
Sbjct  300  PNVTDDHLRQVFGQYGEIVQVKIPPGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLS  359

Query  469  WGRNPSNKQ--SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            WGR+P+NKQ  SD +Q+GG  G +          A       QD NMYYG Y GY NY
Sbjct  360  WGRSPANKQPQSDPSQYGGYYGYAAGYENYGYGAAS------QDANMYYGGYAGYANY  411


 Score = 32.0 bits (71),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNN T+FVGGLDP
Sbjct  285  ETDPNNKTVFVGGLDP  300



>ref|XP_002518499.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43886.1| nuclear acid binding protein, putative [Ricinus communis]
Length=430

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +R++F  YG+L+HVKI A KRCGFVQF++R  AE AL  L G  L  Q++RLSW
Sbjct  300  NVTDDNLRELFGRYGQLLHVKIPAGKRCGFVQFADRSCAEEALRLLNGTSLSGQSIRLSW  359

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQ    Q       + Y    QGY+ YGYAP PQDPNMYYG+YPGY NY
Sbjct  360  GRSPSNKQP---QPDANQWNAGYYGYAQGYENYGYAPAPQDPNMYYGNYPGYGNY  411



>ref|XP_006352617.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum tuberosum]
Length=412

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 79/115 (69%), Gaps = 2/115 (2%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+++ +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q +RLSW
Sbjct  285  SVTDDHLRQVFGNYGQLLHVKIPLGKRCGFVQFTDRSCAEEALRALSGTQLGGQTIRLSW  344

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQ  Q+Q         Y     GYDAYGYA P QDPNMYY  Y GY NY
Sbjct  345  GRSPSNKQ--QSQGDPNQWSGGYYGYTPGYDAYGYAQPTQDPNMYYAGYAGYGNY  397



>ref|NP_001168401.1| hypothetical protein [Zea mays]
 gb|ACN28105.1| unknown [Zea mays]
 tpg|DAA35923.1| TPA: hypothetical protein ZEAMMB73_028165 [Zea mays]
Length=432

 Score =   107 bits (268),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+E+ ++QVFSPYGE+VHVKI   KRCGFVQF  RPSAE AL  LQGA +G QNVRLS
Sbjct  297  PNVTEDTLKQVFSPYGEVVHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLS  356

Query  469  WGRNPSNKQS  440
            WGR+ SNKQ+
Sbjct  357  WGRSLSNKQA  366


 Score = 33.9 bits (76),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  282  ENDPNNTTIFVGGLDP  297



>ref|XP_010092144.1| Polyadenylate-binding protein RBP45 [Morus notabilis]
 gb|EXB50295.1| Polyadenylate-binding protein RBP45 [Morus notabilis]
Length=543

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 90/128 (70%), Gaps = 12/128 (9%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            N++++++RQVFS +GELVHVKI   KRCGFVQF NR +AEHALS+L G QLG Q++RLSW
Sbjct  284  NINDDMLRQVFSQFGELVHVKIPVGKRCGFVQFVNRANAEHALSTLNGTQLGGQSIRLSW  343

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY--------PGY  311
            GR+P+NKQ+ Q        G  Y    QGYDAY YAPP QDPNMYYG Y        PG 
Sbjct  344  GRSPTNKQNQQ--EQAQWNGGGYYGYPQGYDAYSYAPPSQDPNMYYGGYPGYGNYQQPGA  401

Query  310  TNYQQPQQ  287
              YQQPQQ
Sbjct  402  --YQQPQQ  407



>ref|XP_004248403.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum lycopersicum]
Length=410

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+++ +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL++L G QLG Q +RLSW
Sbjct  284  SVTDDHLRQVFGNYGQLLHVKIPLGKRCGFVQFTDRSCAEEALNALSGTQLGGQTIRLSW  343

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQS         G   Y      Y       P QDPNMYY  Y GY NY
Sbjct  344  GRSPSNKQSQGDPNQWSGGYYGYTPGYDAYGYAQ---PTQDPNMYYAGYAGYGNY  395



>ref|XP_004232721.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=413

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            N+++E +RQ+F  YG+L+HVKI   KRCGF+QF++R  AE AL  L G QLG Q++RLSW
Sbjct  288  NITDEHLRQIFGHYGQLLHVKIPVGKRCGFIQFADRSCAEEALRVLNGTQLGGQSIRLSW  347

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+P+NKQ  Q         + Y     GY+ YGYAPP QDPN YY  Y GY NY
Sbjct  348  GRSPANKQQPQL---DPNQYAGYYGYTAGYEGYGYAPPAQDPNQYYAGYAGYGNY  399



>gb|ABR18422.1| unknown [Picea sitchensis]
Length=418

 Score =   105 bits (262),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 82/126 (65%), Gaps = 8/126 (6%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E++RQ+F  +GELVHVKI   KRCGFVQF+NR SAE AL  L G  LG+Q +RLS
Sbjct  292  PSVTDEMLRQLFGQFGELVHVKIPVGKRCGFVQFNNRASAEEALQMLHGTVLGQQAIRLS  351

Query  469  WGRNPSNKQSD--------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPG  314
            WGR+P+NKQ          Q       G +YYGY Q     YGYAP PQDPNMY  +   
Sbjct  352  WGRSPANKQVQTPGWVQPQQPDPNQWNGAAYYGYGQGYDAGYGYAPQPQDPNMYSYAPYA  411

Query  313  YTNYQQ  296
            Y NYQQ
Sbjct  412  YGNYQQ  417


 Score = 35.4 bits (80),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  277  DNDPNNTTIFVGGLDP  292



>ref|XP_009412453.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412454.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   108 bits (271),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 73/116 (63%), Gaps = 5/116 (4%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVFS YGE+V+VKI   KRCGFVQF++R +AE AL  L G  LG QN+RLSW
Sbjct  317  NVTDDHLRQVFSTYGEIVYVKIPVGKRCGFVQFASRANAEEALRMLNGTPLGGQNIRLSW  376

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  302
            GR+P+NKQ  Q           Y      Y       PPQDPNMY Y +Y GY NY
Sbjct  377  GRSPANKQPQQDPNQWNGSYYGYAQNYNTYGYT----PPQDPNMYAYAAYTGYGNY  428


 Score = 31.6 bits (70),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            ++DPNNTTIFVGGLD
Sbjct  301  ENDPNNTTIFVGGLD  315



>ref|XP_006352618.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum tuberosum]
Length=411

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 71/115 (62%), Gaps = 3/115 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+++ +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q +RLSW
Sbjct  285  SVTDDHLRQVFGNYGQLLHVKIPLGKRCGFVQFTDRSCAEEALRALSGTQLGGQTIRLSW  344

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQS         G   Y      Y       P QDPNMYY  Y GY NY
Sbjct  345  GRSPSNKQSQGDPNQWSGGYYGYTPGYDAYGYAQ---PTQDPNMYYAGYAGYGNY  396



>ref|XP_006348103.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=413

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            N+++E +RQ+F  YG+L+HVKI   KRCGF+QF++R  AE A+  L G QLG Q++RLSW
Sbjct  288  NITDEHLRQIFGHYGQLLHVKIPVGKRCGFIQFADRSCAEEAIRVLNGTQLGGQSIRLSW  347

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+P+NKQ  Q         + Y     GYD YGYAPP QDPN YY  Y GY NY
Sbjct  348  GRSPANKQQPQV---DPNQYAGYYGYTAGYDGYGYAPPAQDPNQYYAGYAGYGNY  399



>emb|CBI19566.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  203  PNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLS  262

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G      Y   Q         PPP DP MY   YG+YP Y N+Q
Sbjct  263  WGRNPANKQ--MRADFGNQWSGAYYGGQVYDGYGYALPPPHDPTMYAAAYGAYPVYGNHQ  320

Query  298  Q  296
            Q
Sbjct  321  Q  321



>ref|XP_006858185.1| hypothetical protein AMTR_s00062p00161920 [Amborella trichopoda]
 gb|ERN19652.1| hypothetical protein AMTR_s00062p00161920 [Amborella trichopoda]
Length=492

 Score =   103 bits (258),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++++++QVF  YGEL+HVKI   KRCGFVQF+NR  AE AL  L G QLG+Q++RLS
Sbjct  365  PNVNDDILKQVFGQYGELIHVKIPVGKRCGFVQFANRACAEEALLMLNGTQLGQQSIRLS  424

Query  469  WGRNPSNKQS  440
            WGR+PSNKQ 
Sbjct  425  WGRSPSNKQD  434


 Score = 35.8 bits (81),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            +SDPNNTTIFVGGLDP
Sbjct  350  ESDPNNTTIFVGGLDP  365



>ref|XP_006370698.1| hypothetical protein POPTR_0001s45000g [Populus trichocarpa]
 gb|ERP67267.1| hypothetical protein POPTR_0001s45000g [Populus trichocarpa]
Length=430

 Score =   105 bits (263),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ +R VFS YGELVHVKI A KRCGFVQF+NR  AE ALS L G Q+  QN+RLS
Sbjct  276  PSVTDDTLRAVFSKYGELVHVKIPAGKRCGFVQFANRTCAEQALSMLNGTQIAGQNIRLS  335

Query  469  WGRNPSNKQS  440
            WGR+PSNKQ+
Sbjct  336  WGRSPSNKQA  345


 Score = 33.9 bits (76),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            +SDPNNTTIFVG LDP
Sbjct  261  ESDPNNTTIFVGALDP  276



>ref|XP_011010320.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X1 [Populus euphratica]
 ref|XP_011010321.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X2 [Populus euphratica]
Length=428

 Score =   105 bits (263),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ +R VFS YGELVHVKI A KRCGFVQF+NR  AE ALS L G Q+  QN+RLS
Sbjct  276  PSVTDDTLRAVFSKYGELVHVKIPAGKRCGFVQFANRTCAEQALSMLNGTQIAGQNIRLS  335

Query  469  WGRNPSNKQS  440
            WGR+PSNKQ+
Sbjct  336  WGRSPSNKQA  345


 Score = 33.9 bits (76),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            +SDPNNTTIFVG LDP
Sbjct  261  ESDPNNTTIFVGALDP  276



>ref|XP_011010322.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X3 [Populus euphratica]
Length=427

 Score =   105 bits (263),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ +R VFS YGELVHVKI A KRCGFVQF+NR  AE ALS L G Q+  QN+RLS
Sbjct  276  PSVTDDTLRAVFSKYGELVHVKIPAGKRCGFVQFANRTCAEQALSMLNGTQIAGQNIRLS  335

Query  469  WGRNPSNKQS  440
            WGR+PSNKQ+
Sbjct  336  WGRSPSNKQA  345


 Score = 33.9 bits (76),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            +SDPNNTTIFVG LDP
Sbjct  261  ESDPNNTTIFVGALDP  276



>ref|XP_003634360.1| PREDICTED: polyadenylate-binding protein RBP47-like [Vitis vinifera]
Length=418

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 73/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  297  PNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLS  356

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G      Y   Q         PPP DP MY   YG+YP Y N+Q
Sbjct  357  WGRNPANKQ--MRADFGNQWSGAYYGGQVYDGYGYALPPPHDPTMYAAAYGAYPVYGNHQ  414

Query  298  Q  296
            Q
Sbjct  415  Q  415



>ref|XP_008226922.1| PREDICTED: polyadenylate-binding protein RBP45C [Prunus mume]
Length=406

 Score =   104 bits (260),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++++RQVFS +GELVHVKI   KRCGFVQF NR  AE AL +L G QLG Q++RLS
Sbjct  280  PSVNDDMLRQVFSQFGELVHVKIPVGKRCGFVQFGNRSCAEQALGTLNGTQLGGQSIRLS  339

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  335
            WGR+P++KQ+   Q     GG  +    QGYDAY YAPP QDPN+
Sbjct  340  WGRSPTSKQNQPDQAQWNGGGGGFYGYPQGYDAYTYAPPAQDPNL  384


 Score = 34.3 bits (77),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  265  EADPNNTTIFVGGLDP  280



>emb|CAN81343.1| hypothetical protein VITISV_008697 [Vitis vinifera]
Length=536

 Score =   109 bits (272),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 75/124 (60%), Gaps = 6/124 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  185  PNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLS  244

Query  469  WGRNPSNKQSDQTqwgggvg---gsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYT  308
            WGRNP+NKQ++        G      Y   Q         PPP DP MY   YG+YP Y 
Sbjct  245  WGRNPANKQANSLFMRADFGNQWSGAYYGGQVYDGYGYALPPPHDPTMYAAAYGAYPVYG  304

Query  307  NYQQ  296
            N+QQ
Sbjct  305  NHQQ  308


 Score = 29.3 bits (64),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D  NTTIFVGGLDP
Sbjct  170  DGDSMNTTIFVGGLDP  185



>gb|EYU20972.1| hypothetical protein MIMGU_mgv1a018561mg, partial [Erythranthe 
guttata]
Length=125

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 74/121 (61%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ FS YGE++ VKI   K CGFVQF+NR  AE AL  L G  +G+Q VRLS
Sbjct  4    PNVSDEDLRQPFSQYGEIISVKIPVGKGCGFVQFANRNEAEEALQQLTGTTIGKQTVRLS  63

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQS         G  Y   +  GY       PP DP+MY   YG+YP Y  +Q
Sbjct  64   WGRNPANKQSRGDLGNQWTGAYYGPPSFDGYGYAVG--PPHDPSMYAAAYGAYPMYGTHQ  121

Query  298  Q  296
            Q
Sbjct  122  Q  122



>ref|XP_009372712.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Pyrus x 
bretschneideri]
Length=408

 Score =   103 bits (258),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 2/107 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++++RQVFS +GELVHVKI   KRCGFVQF+NR  AE AL SL G QLG Q++RLS
Sbjct  279  PSVNDDMLRQVFSQFGELVHVKIPVGKRCGFVQFANRSCAEQALGSLNGTQLGGQSIRLS  338

Query  469  WGRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  335
            WGR+P++KQ+  DQ QW G  G  +YGY Q         PP QDP M
Sbjct  339  WGRSPTSKQNQPDQAQWNGAGGAGFYGYPQGYDAYSYAPPPAQDPAM  385


 Score = 34.3 bits (77),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  264  EADPNNTTIFVGGLDP  279



>gb|KDP39118.1| hypothetical protein JCGZ_00875 [Jatropha curcas]
Length=407

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 86/121 (71%), Gaps = 9/121 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VS+E +RQVFS YGELVHVKI A KRCGFVQF+NR  AE AL  L G QL  Q++RLS
Sbjct  279  PSVSDEHLRQVFSKYGELVHVKIPAGKRCGFVQFANRACAEQALLMLNGTQLAGQSIRLS  338

Query  469  WGRNPSNKQ--SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQ  296
            WGR+PSNKQ  +DQ+QW GG  G   GY            PPQDPNMYYG YPGY NYQQ
Sbjct  339  WGRSPSNKQASADQSQWNGGYYGYAPGYEYGYA-------PPQDPNMYYGGYPGYGNYQQ  391

Query  295  P  293
            P
Sbjct  392  P  392



>ref|XP_008385660.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Malus domestica]
Length=408

 Score =   103 bits (257),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 75/107 (70%), Gaps = 2/107 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++++RQVFS +GELVHVKI   KRCGFVQF+NR  AE AL SL G QLG Q++RLS
Sbjct  279  PSVNDDMLRQVFSQFGELVHVKIPVGKRCGFVQFANRSCAEQALGSLNGTQLGGQSIRLS  338

Query  469  WGRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  335
            WGR+P+ KQ+  DQ QW G  G  +YGY Q         PP QDP M
Sbjct  339  WGRSPTXKQNQPDQAQWNGAGGAGFYGYPQGYDAYSYAPPPAQDPAM  385


 Score = 34.3 bits (77),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  264  EADPNNTTIFVGGLDP  279



>ref|XP_009789022.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
sylvestris]
Length=413

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 5/120 (4%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+++ +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSW
Sbjct  285  DVTDDHLRQVFGHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRVLNGTQLGGQSIRLSW  344

Query  466  GRNPSNK-----QSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNK     Q+D  QW GG    Y         AYGYA P QDPN+YY  Y GY NY
Sbjct  345  GRSPSNKQVVQPQADPNQWNGGGYYGYTAGYDAAAAAYGYAQPAQDPNLYYAGYAGYGNY  404



>emb|CAC85246.1| salt tolerance protein 6 [Beta vulgaris]
Length=322

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQ FSPYGELVHVKI A K+CGFVQF+NR SAE AL  L G QLG +NVRLSW
Sbjct  197  NVTDEHLRQTFSPYGELVHVKIPAGKQCGFVQFTNRSSAEEALRVLNGMQLGGRNVRLSW  256

Query  466  GRNPSNKQS  440
            GR+P+N+QS
Sbjct  257  GRSPNNRQS  265



>ref|XP_007213954.1| hypothetical protein PRUPE_ppa006577mg [Prunus persica]
 gb|EMJ15153.1| hypothetical protein PRUPE_ppa006577mg [Prunus persica]
Length=405

 Score =   103 bits (256),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++++RQVF  +GELVHVKI   KRCGFVQF NR  AE AL +L G QLG Q++RLS
Sbjct  279  PSVNDDMLRQVFGQFGELVHVKIPVGKRCGFVQFGNRSCAEQALGTLNGTQLGGQSIRLS  338

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  335
            WGR+P++KQ+   Q     GG  +    QGYDAY YAPP QDPN+
Sbjct  339  WGRSPTSKQNQPDQAQWNGGGGGFYGYPQGYDAYTYAPPAQDPNL  383


 Score = 34.3 bits (77),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  264  EADPNNTTIFVGGLDP  279



>ref|XP_009352469.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Pyrus x 
bretschneideri]
Length=416

 Score =   103 bits (256),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++++RQVFS +GELVHVKI   KRCGFVQF+NR  AE AL SL G QLG Q++RLS
Sbjct  287  PSVNDDMLRQVFSQFGELVHVKIPVGKRCGFVQFANRSCAEQALGSLNGTQLGGQSIRLS  346

Query  469  WGRNPSNKQS  440
            WGR+P++KQ+
Sbjct  347  WGRSPTSKQN  356


 Score = 34.3 bits (77),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  272  EADPNNTTIFVGGLDP  287



>ref|XP_008365193.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Malus domestica]
Length=408

 Score =   103 bits (256),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++++RQVFS +GELVHVKI   KRCGFVQF+NR  AE AL SL G QLG Q++RLS
Sbjct  279  PSVNDDMLRQVFSQFGELVHVKIPVGKRCGFVQFANRSCAEQALGSLNGTQLGGQSIRLS  338

Query  469  WGRNPSNKQS  440
            WGR+P++KQ+
Sbjct  339  WGRSPTSKQN  348


 Score = 34.3 bits (77),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  264  EADPNNTTIFVGGLDP  279



>ref|XP_003542872.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Glycine 
max]
Length=409

 Score =   105 bits (263),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLS
Sbjct  278  PNVTDDHLRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLS  337

Query  469  WGRNPSNKQS  440
            WGR+PSNKQ+
Sbjct  338  WGRSPSNKQA  347


 Score = 31.2 bits (69),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVG LDP
Sbjct  263  ENDPNNTTIFVGNLDP  278



>gb|ABK25253.1| unknown [Picea sitchensis]
Length=487

 Score =   102 bits (253),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 8/114 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E++RQ+F  +GELVHVKI   KRCGFVQF+NR SAE AL  L G  LG+Q +RLS
Sbjct  291  PSVTDEMLRQLFGQFGELVHVKIPVGKRCGFVQFNNRASAEEALQMLHGTVLGQQAIRLS  350

Query  469  WGRNPSNKQSD--------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  332
            WGR+P+NKQ          Q       G +YYGY Q     YGYAP PQDPNMY
Sbjct  351  WGRSPANKQVQTPGWVQPQQPDPNQWNGAAYYGYGQGYDAGYGYAPQPQDPNMY  404


 Score = 35.4 bits (80),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  276  DNDPNNTTIFVGGLDP  291



>ref|XP_006354957.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Solanum 
tuberosum]
Length=438

 Score =   106 bits (265),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 71/121 (59%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ F+ YGE+V VKI   K CGFVQF+NR  AE AL  L G  +G+Q VRLS
Sbjct  317  PNVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTAIGKQTVRLS  376

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQS      G      Y             PPP DP MY   YG+YP Y  +Q
Sbjct  377  WGRNPANKQS--RSDFGNQWTGPYYGGHFYDGYGYAFPPPHDPGMYAAAYGAYPVYGTHQ  434

Query  298  Q  296
            Q
Sbjct  435  Q  435


 Score = 30.4 bits (67),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+D  NTTIFVGGLDP
Sbjct  302  DADSTNTTIFVGGLDP  317



>ref|XP_008441150.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Cucumis melo]
Length=402

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 74/105 (70%), Gaps = 4/105 (4%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVF  YGELVHVKI   KRCGFVQFS+R  AE AL +L G Q+G QN+RLSW
Sbjct  275  NVTDDHLRQVFGQYGELVHVKIPVGKRCGFVQFSDRNCAEEALRALNGTQIGGQNIRLSW  334

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  332
            GR+PSNKQ+D         G  Y    QGY+ Y YAP PQDPNM+
Sbjct  335  GRSPSNKQADPN----QWNGGGYYGYGQGYENYSYAPAPQDPNMF  375



>ref|XP_010665562.1| PREDICTED: polyadenylate-binding protein RBP45-like [Beta vulgaris 
subsp. vulgaris]
Length=414

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQ FSPYGELVHVKI A K+CGFVQF+NR SAE AL  L G QLG +NVRLSW
Sbjct  289  NVTDEHLRQTFSPYGELVHVKIPAGKQCGFVQFTNRSSAEEALRVLNGMQLGGRNVRLSW  348

Query  466  GRNPSNKQS  440
            GR+P+N+QS
Sbjct  349  GRSPNNRQS  357



>ref|XP_011030800.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Populus 
euphratica]
Length=402

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ +R VFS YGELVHVKI A KRCGFVQF+NR SAE ALS L G Q+  QN+RLS
Sbjct  278  PSVTDDTLRAVFSKYGELVHVKIPAGKRCGFVQFANRTSAEQALSMLNGTQIAGQNIRLS  337

Query  469  WGRNPSNKQ  443
            WGR+PSNKQ
Sbjct  338  WGRSPSNKQ  346



>ref|XP_008441163.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
melo]
Length=407

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQVFS YGELVHVKI A KRCGFVQFS+R  AE AL  L G Q+G QN+RLSW
Sbjct  275  NVTDEHLRQVFSQYGELVHVKIPAGKRCGFVQFSDRSCAEEALRMLNGTQIGGQNIRLSW  334

Query  466  GRNPSNK--QSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  332
            GR+PSNK  Q+D  QW GG GG  Y    QGY+ Y YAP  QDPNM+
Sbjct  335  GRSPSNKQPQADPNQWNGGGGGGGYYGYGQGYENYSYAPAAQDPNMF  381



>ref|XP_002316998.2| RNA-binding protein 45 [Populus trichocarpa]
 gb|EEE97610.2| RNA-binding protein 45 [Populus trichocarpa]
Length=404

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ +R VFS YGELVHVKI A KRCGFVQF+NR SAE ALS L G Q+  QN+RLS
Sbjct  279  PSVTDDTLRAVFSKYGELVHVKIPAGKRCGFVQFANRTSAEQALSMLNGTQIAGQNIRLS  338

Query  469  WGRNPSNKQ  443
            WGR+PSNKQ
Sbjct  339  WGRSPSNKQ  347



>ref|XP_009595795.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 4/119 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+++ +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSW
Sbjct  283  DVTDDHLRQVFGHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRVLNGTQLGGQSIRLSW  342

Query  466  GRNPSNKQSDQTqwg----ggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            GR+PSNKQ  Q Q       G G   Y        AYGYA P QDPN+YY  Y GY NY
Sbjct  343  GRSPSNKQVVQPQADPNQWNGGGYYGYTAGYDAAAAYGYAQPAQDPNLYYAGYAGYGNY  401



>gb|KJB59840.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
 gb|KJB59841.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
Length=419

 Score =   105 bits (261),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 74/121 (61%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+EE +RQ FS YGE+V VKI   K CGFVQ++NR +AE AL  L G  +G+Q VRLS
Sbjct  298  PNVTEEDLRQSFSQYGEIVSVKIPVGKGCGFVQYANRKNAEEALQKLNGMVIGKQTVRLS  357

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G   G  Y   Q         PPP DP MY   YG+YP Y ++Q
Sbjct  358  WGRNPANKQF--RGDYGNQWGGAYYGGQVYDGYRYAVPPPHDPGMYAAAYGTYPIYGSHQ  415

Query  298  Q  296
            Q
Sbjct  416  Q  416


 Score = 30.4 bits (67),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D +NTTIFVGGLDP
Sbjct  283  DGDSSNTTIFVGGLDP  298



>ref|XP_010041417.1| PREDICTED: polyadenylate-binding protein RBP45-like [Eucalyptus 
grandis]
Length=301

 Score =   102 bits (255),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 72/118 (61%), Gaps = 8/118 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  Y E+V VKI    RCG VQF++R  AE AL  L G QLG QN+RLS
Sbjct  174  PNVTDDHLRQVFGQYSEIVQVKIPPGMRCGIVQFADRSCAEEALRMLNGTQLGGQNIRLS  233

Query  469  WGRNPSNKQ--SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            WGR+P+NKQ  SD +Q+GG  G +                  QD NMYYG Y GY NY
Sbjct  234  WGRSPANKQPQSDPSQYGGYYGYAAGYENYGYG------AASQDANMYYGGYAGYANY  285


 Score = 32.3 bits (72),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNN T+FVGGLDP
Sbjct  159  ETDPNNKTVFVGGLDP  174



>gb|KCW44364.1| hypothetical protein EUGRSUZ_L02167 [Eucalyptus grandis]
Length=270

 Score =   102 bits (254),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 73/118 (62%), Gaps = 8/118 (7%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  Y E+V VKI    RCG VQF++R  AE AL  L G QLG QN+RLS
Sbjct  143  PNVTDDHLRQVFGQYSEIVQVKIPPGMRCGIVQFADRSCAEEALRMLNGTQLGGQNIRLS  202

Query  469  WGRNPSNKQ--SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  302
            WGR+P+NKQ  SD +Q+GG  G +          A       QD NMYYG Y GY NY
Sbjct  203  WGRSPANKQPQSDPSQYGGYYGYAAGYENYGYGAAS------QDANMYYGGYAGYANY  254


 Score = 32.3 bits (72),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNN T+FVGGLDP
Sbjct  128  ETDPNNKTVFVGGLDP  143



>ref|XP_004153241.1| PREDICTED: polyadenylate-binding protein RBP45-like, partial 
[Cucumis sativus]
Length=156

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 71/105 (68%), Gaps = 2/105 (2%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQVF  YGELVHVKI   KRCGFVQF++R  AE AL  L G Q+G QN+RLSW
Sbjct  27   NVTDEHLRQVFGQYGELVHVKIPVGKRCGFVQFADRNCAEEALRVLNGTQIGGQNIRLSW  86

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  332
            GR+PSNKQ           G  Y    QGY+ Y YAP PQDPNM+
Sbjct  87   GRSPSNKQP--QADPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  129



>ref|XP_008224810.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Prunus 
mume]
Length=403

 Score =   103 bits (258),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVFS YG+LVHVKI A KRCGFVQF +R  AE AL  L G+QLG QN+RLSW
Sbjct  276  NVTDDHLRQVFSQYGDLVHVKIPAGKRCGFVQFQDRSCAEEALRVLNGSQLGAQNIRLSW  335

Query  466  GRNPSNKQ  443
            GR+PSNKQ
Sbjct  336  GRSPSNKQ  343


 Score = 30.4 bits (67),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            +SDPNNTTIFVG LD
Sbjct  260  ESDPNNTTIFVGNLD  274



>gb|EEE69858.1| hypothetical protein OsJ_29658 [Oryza sativa Japonica Group]
Length=310

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVSE+ +RQ FS YGE+  VKI   K+CGFVQF  R +AE AL  L G+ +G+Q VRLS
Sbjct  188  PNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLS  247

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ           G YY  +         AP P DP MY   YG+YP Y N Q
Sbjct  248  WGRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADPGMYAAAYGAYPFYGNQQ  307

Query  298  Q  296
            Q
Sbjct  308  Q  308



>ref|XP_008441138.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Cucumis melo]
Length=405

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVF  YGELVHVKI   KRCGFVQFS+R  AE AL +L G Q+G QN+RLSW
Sbjct  275  NVTDDHLRQVFGQYGELVHVKIPVGKRCGFVQFSDRNCAEEALRALNGTQIGGQNIRLSW  334

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  332
            GR+PSNKQ  Q        G  Y    QGY+ Y YAP PQDPNM+
Sbjct  335  GRSPSNKQVPQA-DPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  378



>dbj|BAD33940.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
 dbj|BAD38554.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
Length=316

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVSE+ +RQ FS YGE+  VKI   K+CGFVQF  R +AE AL  L G+ +G+Q VRLS
Sbjct  194  PNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLS  253

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ           G YY  +         AP P DP MY   YG+YP Y N Q
Sbjct  254  WGRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADPGMYAAAYGAYPFYGNQQ  313

Query  298  Q  296
            Q
Sbjct  314  Q  314



>ref|XP_006283830.1| hypothetical protein CARUB_v10004931mg [Capsella rubella]
 gb|EOA16728.1| hypothetical protein CARUB_v10004931mg [Capsella rubella]
Length=413

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E+L++ VF  +GELVHVKI A KRCGFVQ++NR  AE ALS L G QLG Q+VRLSW
Sbjct  286  SVTEDLLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSMLNGTQLGGQSVRLSW  345

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDP  341
            GR+PSNKQ+   Q   G GG YYGY  QGY+AYGYAPPPQDP
Sbjct  346  GRSPSNKQNQPDQAQYGGGGGYYGYPPQGYEAYGYAPPPQDP  387



>ref|XP_006413118.1| hypothetical protein EUTSA_v10025342mg [Eutrema salsugineum]
 gb|ESQ54571.1| hypothetical protein EUTSA_v10025342mg [Eutrema salsugineum]
Length=408

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 78/106 (74%), Gaps = 3/106 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E++++ VF  +GELVHVKI A KRCGFVQ++NR SAE ALS L G QLG Q++RLSW
Sbjct  278  SVTEDVLKSVFGQFGELVHVKIPAGKRCGFVQYANRGSAEQALSMLNGTQLGGQSIRLSW  337

Query  466  GRNPSNK--QSDQTqwgggvggsyygyaqqgyday-gyAPPPQDPN  338
            GR+PSNK  QSDQ Q+GGG GG  Y           GYAPPPQDPN
Sbjct  338  GRSPSNKQTQSDQAQYGGGGGGGGYYGYPPQGYEAYGYAPPPQDPN  383



>ref|XP_007020874.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY12399.1| RNA-binding family protein [Theobroma cacao]
Length=417

 Score = 99.8 bits (247),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 89/131 (68%), Gaps = 17/131 (13%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VSE+ ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +N+RLS
Sbjct  294  PSVSEDQLKQIFSQLGEVVHVKIPANKHCGFVQYANRTSAEQALSVLNGTMLGGRNIRLS  353

Query  469  WGRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY--------  320
            WGR+PS+KQ+  DQ           Y    QG++AYGYAPPPQDPNMYYG Y        
Sbjct  354  WGRSPSSKQAQPDQA-----QWNGGYYGYAQGFEAYGYAPPPQDPNMYYGGYPGYGNYQQ  408

Query  319  PGYTNYQQPQQ  287
            PG   YQQPQQ
Sbjct  409  PG--AYQQPQQ  417


 Score = 33.9 bits (76),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  279  ENDPNNTTIFVGGLDP  294



>ref|XP_006280607.1| hypothetical protein CARUB_v10026566mg [Capsella rubella]
 gb|EOA13505.1| hypothetical protein CARUB_v10026566mg [Capsella rubella]
Length=391

 Score = 99.4 bits (246),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E ++ +F  +GEL+HVKI   KRCGFVQF+NR +AEHALS L G QLG Q++RLSW
Sbjct  268  NVTDEELKSIFGQFGELIHVKIPPGKRCGFVQFANRANAEHALSVLNGTQLGGQSIRLSW  327

Query  466  GRNPSNKQSDQT  431
            GR+P NKQ DQ 
Sbjct  328  GRSP-NKQPDQA  338


 Score = 34.3 bits (77),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            DSDPNNTTIFVGGLD
Sbjct  252  DSDPNNTTIFVGGLD  266



>ref|XP_007147735.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
 gb|ESW19729.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
Length=399

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NVS++ +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSW
Sbjct  275  NVSDDHLRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTLLGGQNVRLSW  334

Query  466  GRNPSNKQ  443
            GR+PSNKQ
Sbjct  335  GRSPSNKQ  342



>ref|XP_002510266.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF52453.1| nuclear acid binding protein, putative [Ricinus communis]
Length=443

 Score =   103 bits (257),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 77/121 (64%), Gaps = 4/121 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E ++Q FS YGE+V VKI   K CGFVQF++R +AE AL  L G  +G+Q VRLS
Sbjct  321  PNVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFASRSNAEEALQKLNGTVIGKQTVRLS  380

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ  ++   G   G  Y   Q         PPP DP+MY   YG+YP Y ++Q
Sbjct  381  WGRNPANKQQLRS-DFGNQWGGAYYGGQIYDGYGYALPPPHDPSMYAAPYGAYPVYGSHQ  439

Query  298  Q  296
            Q
Sbjct  440  Q  440


 Score = 30.0 bits (66),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D  NTTIFVGGLDP
Sbjct  306  DGDSTNTTIFVGGLDP  321



>dbj|BAG87507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVSE+ +RQ FS YGE+  VKI   K+CGFVQF  R +AE AL  L G+ +G+Q VRLS
Sbjct  223  PNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLS  282

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ           G YY  +         AP P DP MY   YG+YP Y N Q
Sbjct  283  WGRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADPGMYAAAYGAYPFYGNQQ  342

Query  298  Q  296
            Q
Sbjct  343  Q  343



>gb|AGV54881.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NVS++ +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSW
Sbjct  275  NVSDDHLRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTLLGGQNVRLSW  334

Query  466  GRNPSNKQ  443
            GR+PSNKQ
Sbjct  335  GRSPSNKQ  342



>gb|EEC84714.1| hypothetical protein OsI_31675 [Oryza sativa Indica Group]
Length=377

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVSE+ +RQ FS YGE+  VKI   K+CGFVQF  R +AE AL  L G+ +G+Q VRLS
Sbjct  255  PNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLS  314

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ           G +Y  +         AP P DP MY   YG+YP Y N Q
Sbjct  315  WGRNPANKQLRSDNGSQWNNGMFYAASPFYSGYGYPAPFPADPGMYAAAYGAYPFYGNQQ  374

Query  298  Q  296
            Q
Sbjct  375  Q  375



>ref|XP_011013053.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E ++Q FS YGE+V VKI  +K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  306  PNVTDEDLKQPFSQYGEIVSVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLS  365

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP NKQ              Y   Q         PPP DP+ Y   YG+YP Y N+Q
Sbjct  366  WGRNPGNKQ--HRADFSSPWNGAYYGGQVYDGYGYALPPPHDPSTYAAAYGAYPMYGNHQ  423

Query  298  Q  296
            Q
Sbjct  424  Q  424



>ref|XP_008441142.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Cucumis melo]
Length=403

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVF  YGELVHVKI   KRCGFVQFS+R  AE AL +L G Q+G QN+RLSW
Sbjct  275  NVTDDHLRQVFGQYGELVHVKIPVGKRCGFVQFSDRNCAEEALRALNGTQIGGQNIRLSW  334

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  332
            GR+PSNK   Q        G  Y    QGY+ Y YAP PQDPNM+
Sbjct  335  GRSPSNK---QVADPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  376



>gb|ABK24911.1| unknown [Picea sitchensis]
Length=397

 Score = 98.2 bits (243),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PN ++E +RQVF P+GE+V+VKI   K CGFVQF+NR SAE AL  L G  +G+Q++RLS
Sbjct  272  PNATDEDLRQVFGPFGEIVYVKIPVGKGCGFVQFTNRSSAEEALQKLHGTIIGQQSIRLS  331

Query  469  WGRNPSNKQS  440
            WGR+P+NKQ+
Sbjct  332  WGRSPANKQT  341


 Score = 35.0 bits (79),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  257  DNDPNNTTIFVGGLDP  272



>gb|KHN12758.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=318

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  197  PNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLS  256

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G      Y  A          PP  DP++Y   YG+YP Y  +Q
Sbjct  257  WGRNPANKQF--RMDFGSPWTGAYYGAPMYDGYGYALPPRHDPSIYAAAYGAYPLYGGHQ  314

Query  298  Q  296
            Q
Sbjct  315  Q  315



>ref|XP_009137630.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Brassica 
rapa]
Length=412

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 85/105 (81%), Gaps = 2/105 (2%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E++++ VF  +GELVHVKI A KRCGFVQ++NR  AE AL+SL G QLG Q++RLSW
Sbjct  283  SVTEDVLKSVFGQFGELVHVKIPAGKRCGFVQYANRGCAEQALNSLNGTQLGGQSIRLSW  342

Query  466  GRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPN  338
            GR PSNKQ+  +Q Q+GGG GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  343  GRTPSNKQTQPEQAQYGGGGGGGYYGYPPQGYEGYGYAPPPQDPN  387



>ref|XP_011017227.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E ++Q FS YGE+V VKI  +K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  306  PNVNDEDLKQPFSQYGEIVSVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLS  365

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP NKQ              Y   Q         PPP DP+ Y   YG+YP Y N+Q
Sbjct  366  WGRNPGNKQ--HRADFSSPWNGAYYGGQVYDGYGYALPPPHDPSTYAAAYGAYPMYGNHQ  423

Query  298  Q  296
            Q
Sbjct  424  Q  424



>emb|CDY46671.1| BnaA03g48370D [Brassica napus]
Length=429

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 85/105 (81%), Gaps = 2/105 (2%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E++++ VF  +GELVHVKI A KRCGFVQ++NR  AE AL+SL G QLG Q++RLSW
Sbjct  282  SVTEDVLKSVFGQFGELVHVKIPAGKRCGFVQYANRGCAEQALNSLNGTQLGGQSIRLSW  341

Query  466  GRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPN  338
            GR PSNKQ+  +Q Q+GGG GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  342  GRTPSNKQTQPEQAQYGGGGGGGYYGYPPQGYEGYGYAPPPQDPN  386



>ref|XP_010443072.1| PREDICTED: polyadenylate-binding protein RBP45A-like [Camelina 
sativa]
Length=387

 Score = 99.4 bits (246),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ ++ +F  +GEL+HVKI   KRCGFVQF+NR SAEHALS L G QLG Q++RLSW
Sbjct  266  NVTDDELKSIFGQFGELIHVKIPPGKRCGFVQFANRASAEHALSVLNGTQLGGQSIRLSW  325

Query  466  GRNPSNKQSDQ  434
            GR P NKQ DQ
Sbjct  326  GRTP-NKQPDQ  335


 Score = 33.9 bits (76),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            DSDPNNTT+FVGGLD
Sbjct  250  DSDPNNTTVFVGGLD  264



>gb|KJB13665.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=415

 Score = 98.6 bits (244),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VSE+ ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +NVRLS
Sbjct  291  PSVSEDQLKQIFSQLGEVVHVKIPANKHCGFVQYANRASAEQALSVLNGTVLGGRNVRLS  350

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  335
            WGR+PS+K   Q Q       + Y    QGY+AYGYAPPPQDPNM
Sbjct  351  WGRSPSSK---QVQPDQAQWNTGYYGYAQGYEAYGYAPPPQDPNM  392


 Score = 34.3 bits (77),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  276  ENDPNNTTIFVGGLDP  291



>gb|KJB13666.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=418

 Score = 98.6 bits (244),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VSE+ ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +NVRLS
Sbjct  291  PSVSEDQLKQIFSQLGEVVHVKIPANKHCGFVQYANRASAEQALSVLNGTVLGGRNVRLS  350

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  335
            WGR+PS+K   Q Q       + Y    QGY+AYGYAPPPQDPNM
Sbjct  351  WGRSPSSK---QVQPDQAQWNTGYYGYAQGYEAYGYAPPPQDPNM  392


 Score = 34.3 bits (77),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  276  ENDPNNTTIFVGGLDP  291



>gb|KJB13664.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=413

 Score = 98.6 bits (244),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VSE+ ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +NVRLS
Sbjct  291  PSVSEDQLKQIFSQLGEVVHVKIPANKHCGFVQYANRASAEQALSVLNGTVLGGRNVRLS  350

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  335
            WGR+PS+K   Q Q       + Y    QGY+AYGYAPPPQDPNM
Sbjct  351  WGRSPSSK---QVQPDQAQWNTGYYGYAQGYEAYGYAPPPQDPNM  392


 Score = 34.3 bits (77),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  276  ENDPNNTTIFVGGLDP  291



>gb|KJB81764.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
Length=420

 Score = 98.6 bits (244),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 89/131 (68%), Gaps = 17/131 (13%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VSE+ ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +NVRLS
Sbjct  292  PSVSEDQLKQIFSQLGEVVHVKIPANKNCGFVQYANRTSAEQALSVLNGTILGGRNVRLS  351

Query  469  WGRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY--------  320
            WGR+PS+KQ+  DQ           Y    QGY+AYGYAPPPQDP+MYYG Y        
Sbjct  352  WGRSPSSKQAQPDQA-----QWNGGYYGYAQGYEAYGYAPPPQDPSMYYGGYPGYGNYQQ  406

Query  319  PGYTNYQQPQQ  287
            PG   YQQPQQ
Sbjct  407  PGA--YQQPQQ  415


 Score = 33.9 bits (76),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  277  ENDPNNTTIFVGGLDP  292



>ref|XP_010448802.1| PREDICTED: polyadenylate-binding protein RBP45A-like [Camelina 
sativa]
Length=388

 Score = 99.4 bits (246),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ ++ +F  +GEL+HVKI   KRCGFVQF+NR SAEHALS L G QLG Q++RLSW
Sbjct  267  NVTDDELKSIFGQFGELIHVKIPPGKRCGFVQFANRASAEHALSVLNGTQLGGQSIRLSW  326

Query  466  GRNPSNKQSDQT  431
            GR P NKQ DQ 
Sbjct  327  GRTP-NKQPDQA  337


 Score = 33.1 bits (74),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            DSDPNNTT+FVGGLD
Sbjct  251  DSDPNNTTLFVGGLD  265



>ref|XP_010545222.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Tarenaya 
hassleriana]
Length=411

 Score = 98.6 bits (244),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++++++ VF  +GELVHVKI A KRCGFVQF+NR  AE ALS L G  LG Q++RLS
Sbjct  284  PSVTDDVLKSVFGQFGELVHVKIPAGKRCGFVQFANRACAEQALSMLNGTTLGGQSIRLS  343

Query  469  WGRNPSNKQS  440
            WGR+PS+KQ+
Sbjct  344  WGRSPSSKQA  353


 Score = 33.9 bits (76),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            +SDPNNTTIFVG LDP
Sbjct  269  ESDPNNTTIFVGALDP  284



>gb|KJB81761.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
 gb|KJB81763.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
Length=415

 Score = 98.2 bits (243),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 89/131 (68%), Gaps = 17/131 (13%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VSE+ ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +NVRLS
Sbjct  292  PSVSEDQLKQIFSQLGEVVHVKIPANKNCGFVQYANRTSAEQALSVLNGTILGGRNVRLS  351

Query  469  WGRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY--------  320
            WGR+PS+KQ+  DQ           Y    QGY+AYGYAPPPQDP+MYYG Y        
Sbjct  352  WGRSPSSKQAQPDQA-----QWNGGYYGYAQGYEAYGYAPPPQDPSMYYGGYPGYGNYQQ  406

Query  319  PGYTNYQQPQQ  287
            PG   YQQPQQ
Sbjct  407  PGA--YQQPQQ  415


 Score = 33.9 bits (76),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  277  ENDPNNTTIFVGGLDP  292



>gb|ACF83065.1| unknown [Zea mays]
 tpg|DAA61809.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=320

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 73/124 (59%), Gaps = 6/124 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVSEE +RQ FS YGE+  VKI   K+CGFVQF+ R +AE AL  L G+ +G+QNVRLS
Sbjct  195  PNVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFAQRKNAEDALQGLNGSTIGKQNVRLS  254

Query  469  WGRNPSNKQ--SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY----YGSYPGYT  308
            WGRNP+NKQ   D        G  Y          Y  A P  DP MY    YG+YP Y 
Sbjct  255  WGRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYGYPAAAPFPDPGMYAAPAYGAYPFYG  314

Query  307  NYQQ  296
            N QQ
Sbjct  315  NQQQ  318



>dbj|BAJ87828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   100 bits (248),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+ +E++++QVF+PYGE+VHVKI   KRCGFVQ+++R SAE AL  LQG  +  QNVRLS
Sbjct  287  PSATEDVLKQVFTPYGEVVHVKIPVGKRCGFVQYASRSSAEEALLMLQGTMIEGQNVRLS  346

Query  469  WGRNPSNKQ  443
            WGR+PSNKQ
Sbjct  347  WGRSPSNKQ  355


 Score = 32.3 bits (72),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DP+N+TIFVGGLDP
Sbjct  272  DNDPSNSTIFVGGLDP  287



>ref|NP_001063403.1| Os09g0462700 [Oryza sativa Japonica Group]
 dbj|BAF25317.1| Os09g0462700, partial [Oryza sativa Japonica Group]
Length=441

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 72/121 (60%), Gaps = 3/121 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVSE+ +RQ FS YGE+  VKI   K+CGFVQF  R +AE AL  L G+ +G+Q VRLS
Sbjct  319  PNVSEDDLRQTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLS  378

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ           G YY  +         AP P DP MY   YG+YP Y N Q
Sbjct  379  WGRNPANKQLRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADPGMYAAAYGAYPFYGNQQ  438

Query  298  Q  296
            Q
Sbjct  439  Q  439



>ref|XP_008441139.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Cucumis melo]
Length=404

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 72/105 (69%), Gaps = 2/105 (2%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVF  YGELVHVKI   KRCGFVQFS+R  AE AL +L G Q+G QN+RLSW
Sbjct  275  NVTDDHLRQVFGQYGELVHVKIPVGKRCGFVQFSDRNCAEEALRALNGTQIGGQNIRLSW  334

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  332
            GR+PSNKQ           G  Y    QGY+ Y YAP PQDPNM+
Sbjct  335  GRSPSNKQP--QADPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  377



>gb|EYU25396.1| hypothetical protein MIMGU_mgv1a006186mg [Erythranthe guttata]
Length=454

 Score =   103 bits (256),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E +RQ FS YGE+V VKI   K CGFVQF NR  AE AL  L G  +G+Q VRLS
Sbjct  332  PSVTDEELRQPFSEYGEIVSVKIPVGKGCGFVQFVNRNDAEEALQQLSGKTIGKQTVRLS  391

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WG +P+NKQS +  +     G+ Y             PPP DPNMY   YG+YP Y  +Q
Sbjct  392  WGHSPANKQS-RVDYAHQWTGAAYYGGPYFDGYGYALPPPHDPNMYAAAYGAYPFYGTHQ  450

Query  298  Q  296
            Q
Sbjct  451  Q  451


 Score = 28.9 bits (63),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D  NTTIFVGGLDP
Sbjct  317  DGDSVNTTIFVGGLDP  332



>dbj|BAJ85753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score =   100 bits (248),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+ +E++++QVF+PYGE+VHVKI   KRCGFVQ+++R SAE AL  LQG  +  QNVRLS
Sbjct  287  PSATEDVLKQVFTPYGEVVHVKIPVGKRCGFVQYASRSSAEEALLMLQGTMIEGQNVRLS  346

Query  469  WGRNPSNKQ  443
            WGR+PSNKQ
Sbjct  347  WGRSPSNKQ  355


 Score = 32.0 bits (71),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DP+N+TIFVGGLDP
Sbjct  272  DNDPSNSTIFVGGLDP  287



>ref|XP_010054589.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
RBP45B-like [Eucalyptus grandis]
Length=260

 Score = 99.8 bits (247),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  YGE+V VKI   KRCGFVQF++R  AE AL  L G QLG QN+RLS
Sbjct  184  PNVTDDHLRQVFGQYGEIVQVKIPPGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLS  243

Query  469  WGRNPSNKQ  443
            WGR+P+NKQ
Sbjct  244  WGRSPANKQ  252


 Score = 32.3 bits (72),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNN T+FVGGLDP
Sbjct  169  ETDPNNKTVFVGGLDP  184



>ref|XP_004145107.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
sativus]
 ref|XP_004153511.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
sativus]
Length=408

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQVFS YGELVHVKI A KRCGFVQFS+R  AE AL  L G  +G QN+RLSW
Sbjct  275  NVTDEHLRQVFSQYGELVHVKIPAGKRCGFVQFSDRSCAEEALRILNGTPIGGQNIRLSW  334

Query  466  GRNPSNKQ  443
            GR+PSNKQ
Sbjct  335  GRSPSNKQ  342



>ref|XP_010476096.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Camelina sativa]
Length=407

 Score = 97.4 bits (241),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ ++ VFS YGE+VHVKI A KRCGFVQFS +  AE AL +L G QLG   VRLS
Sbjct  272  PSVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRALNGVQLGGTTVRLS  331

Query  469  WGRNPSNKQS  440
            WGR+PSNKQ+
Sbjct  332  WGRSPSNKQA  341


 Score = 34.3 bits (77),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTT+FVGGLDP
Sbjct  257  DNDPNNTTVFVGGLDP  272



>ref|XP_010476097.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Camelina sativa]
Length=397

 Score = 97.4 bits (241),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ ++ VFS YGE+VHVKI A KRCGFVQFS +  AE AL +L G QLG   VRLS
Sbjct  262  PSVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRALNGVQLGGTTVRLS  321

Query  469  WGRNPSNKQS  440
            WGR+PSNKQ+
Sbjct  322  WGRSPSNKQA  331


 Score = 34.3 bits (77),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTT+FVGGLDP
Sbjct  247  DNDPNNTTVFVGGLDP  262



>ref|XP_003549410.2| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=413

 Score =   102 bits (254),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  292  PNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLS  351

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G      Y  A          PP  DP++Y   YG+YP Y  +Q
Sbjct  352  WGRNPANKQF--RMDFGSPWTGAYYGAPMYDGYGYALPPRHDPSIYAAAYGAYPLYGGHQ  409

Query  298  Q  296
            Q
Sbjct  410  Q  410


 Score = 29.3 bits (64),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++D  NTTIFVGGLDP
Sbjct  277  EADSTNTTIFVGGLDP  292



>emb|CDP04387.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL  L G QLG QN+RLSW
Sbjct  61   NVTDEHLRQVFGNYGQLLHVKIPVGKRCGFVQFADRSCAEEALRLLNGTQLGGQNIRLSW  120

Query  466  GRNPSNKQ  443
            GR+PSNKQ
Sbjct  121  GRSPSNKQ  128



>gb|KJB58432.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=432

 Score =   100 bits (250),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 71/121 (59%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+EE +RQ FS YGE+V VKI   K CGFVQF+ R +AE AL  L G  +G+Q VRLS
Sbjct  311  PNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAGRNNAEEALQKLNGTIIGKQTVRLS  370

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G   G  Y             PPP +P +Y   YG YP Y +YQ
Sbjct  371  WGRNPTNKQF--RADYGNQWGGAYYGGAVYDGYGYAFPPPHNPGIYTAAYGVYPFYGSYQ  428

Query  298  Q  296
            Q
Sbjct  429  Q  429


 Score = 30.4 bits (67),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D +NTTIFVGGLDP
Sbjct  296  DGDSSNTTIFVGGLDP  311



>gb|KHG01774.1| Polyadenylate-binding RBP45C -like protein [Gossypium arboreum]
Length=413

 Score = 97.1 bits (240),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VSE+ ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE +LS L G  LG +NVRLS
Sbjct  291  PSVSEDQLKQIFSQLGEVVHVKIPANKHCGFVQYANRASAEQSLSVLNGTVLGGRNVRLS  350

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  335
            WGR+PS+K   Q Q       + Y    QGY+AYGYAPPPQDPNM
Sbjct  351  WGRSPSSK---QVQPEQAQWNTGYYGYAQGYEAYGYAPPPQDPNM  392


 Score = 34.3 bits (77),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  276  ENDPNNTTIFVGGLDP  291



>ref|XP_002302445.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE81718.2| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E ++Q FS YGE+V VKI  +K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  308  PNVTDEDLKQPFSQYGEIVSVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLS  367

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP +KQ              Y   Q         PPP DP+ Y   YG+YP Y N+Q
Sbjct  368  WGRNPGHKQ--HRADFSSPWNGAYYGGQVYDGYGYALPPPHDPSTYAAAYGAYPMYGNHQ  425

Query  298  Q  296
            Q
Sbjct  426  Q  426



>dbj|BAB08769.1| unnamed protein product [Arabidopsis thaliana]
Length=390

 Score = 98.6 bits (244),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ ++ +F  +GEL+HVKI   KRCGFVQ++N+ SAEHALS L G QLG Q++RLSW
Sbjct  270  NVTDDELKSIFGQFGELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQLGGQSIRLSW  329

Query  466  GRNPSNKQSDQT  431
            GR+P NKQSDQ 
Sbjct  330  GRSP-NKQSDQA  340


 Score = 32.7 bits (73),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            D+DPNNTTIFVGGLD
Sbjct  254  DNDPNNTTIFVGGLD  268



>ref|NP_568815.1| RNA-binding protein 45A [Arabidopsis thaliana]
 sp|Q9FPJ8.1|RB45A_ARATH RecName: Full=Polyadenylate-binding protein RBP45A; Short=Poly(A)-binding 
protein RBP45A; AltName: Full=RNA-binding protein 
45A; Short=AtRBP45A [Arabidopsis thaliana]
 gb|AAG40335.1|AF324983_1 AT5g54900 [Arabidopsis thaliana]
 gb|ABL66801.1| At5g54900 [Arabidopsis thaliana]
 gb|AED96554.1| RNA-binding protein 45A [Arabidopsis thaliana]
Length=387

 Score = 98.2 bits (243),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ ++ +F  +GEL+HVKI   KRCGFVQ++N+ SAEHALS L G QLG Q++RLSW
Sbjct  270  NVTDDELKSIFGQFGELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQLGGQSIRLSW  329

Query  466  GRNPSNKQSDQT  431
            GR+P NKQSDQ 
Sbjct  330  GRSP-NKQSDQA  340


 Score = 32.7 bits (73),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            D+DPNNTTIFVGGLD
Sbjct  254  DNDPNNTTIFVGGLD  268



>ref|XP_010098709.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
 gb|EXB75612.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
Length=423

 Score =   100 bits (250),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 74/121 (61%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V +E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  302  PSVIDEDLRQPFSQYGEIVSVKIPTGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLS  361

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G   G  Y   Q         PPP DP+MY   YG+YP Y ++Q
Sbjct  362  WGRNPANKQ--YRGDFGNQWGGAYYGGQVYDGYGYALPPPHDPSMYAASYGAYPLYGSHQ  419

Query  298  Q  296
            Q
Sbjct  420  Q  420


 Score = 30.0 bits (66),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D +NTTIFVGGLDP
Sbjct  287  DGDSSNTTIFVGGLDP  302



>ref|XP_010275609.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Nelumbo nucifera]
Length=418

 Score =   101 bits (251),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 71/121 (59%), Gaps = 6/121 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E +RQ FS YGE++ VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  298  PSVTDEDLRQPFSQYGEIISVKIPVGKGCGFVQFANRTNAEEALQKLNGTVIGKQTVRLS  357

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NK               Y   Q         PPP DP+MY   YG+YP Y  +Q
Sbjct  358  WGRNPANKMR---IDPVNQWNGAYYGGQVYDGYGYVIPPPHDPSMYAAAYGAYPIYGGHQ  414

Query  298  Q  296
            Q
Sbjct  415  Q  415


 Score = 30.0 bits (66),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D  NTTIFVGGLDP
Sbjct  283  DGDSTNTTIFVGGLDP  298



>gb|AGV54456.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NVS++ +RQVFSPYGELVHVKI A K CGFVQF++R  AE AL  L GA LG QNV LSW
Sbjct  275  NVSDDHLRQVFSPYGELVHVKIPAGKGCGFVQFADRSCAEEALWMLNGALLGGQNVCLSW  334

Query  466  GRNPSNKQ  443
            GR+PSNKQ
Sbjct  335  GRSPSNKQ  342



>ref|XP_004145109.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Cucumis 
sativus]
Length=404

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 71/105 (68%), Gaps = 2/105 (2%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQVF  YGELVHVKI   KRCGFVQF++R  AE AL  L G Q+G QN+RLSW
Sbjct  275  NVTDEHLRQVFGQYGELVHVKIPVGKRCGFVQFADRNCAEEALRVLNGTQIGGQNIRLSW  334

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  332
            GR+PSNKQ           G  Y    QGY+ Y YAP PQDPNM+
Sbjct  335  GRSPSNKQPQ--ADPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  377



>ref|XP_010493089.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Camelina 
sativa]
Length=406

 Score = 96.7 bits (239),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ ++ VFS YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLS
Sbjct  271  PSVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLS  330

Query  469  WGRNPSNKQS  440
            WGR+PSNKQ+
Sbjct  331  WGRSPSNKQA  340


 Score = 34.3 bits (77),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTT+FVGGLDP
Sbjct  256  DNDPNNTTVFVGGLDP  271



>ref|XP_010275610.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X2 
[Nelumbo nucifera]
Length=413

 Score =   100 bits (250),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 71/121 (59%), Gaps = 6/121 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E +RQ FS YGE++ VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  293  PSVTDEDLRQPFSQYGEIISVKIPVGKGCGFVQFANRTNAEEALQKLNGTVIGKQTVRLS  352

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NK               Y   Q         PPP DP+MY   YG+YP Y  +Q
Sbjct  353  WGRNPANKMR---IDPVNQWNGAYYGGQVYDGYGYVIPPPHDPSMYAAAYGAYPIYGGHQ  409

Query  298  Q  296
            Q
Sbjct  410  Q  410


 Score = 30.0 bits (66),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D  NTTIFVGGLDP
Sbjct  278  DGDSTNTTIFVGGLDP  293



>ref|XP_004294372.1| PREDICTED: polyadenylate-binding protein RBP45C [Fragaria vesca 
subsp. vesca]
Length=415

 Score = 96.3 bits (238),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V +E++RQ F  +GELVHVKI   KRCGFVQF+NR  AE ALS + G  +G Q+VRLS
Sbjct  287  PSVDDEMLRQAFGIFGELVHVKIPVGKRCGFVQFANRACAEQALSVMNGRVVGSQSVRLS  346

Query  469  WGRNPSNKQS  440
            WGR+P++KQ+
Sbjct  347  WGRSPTSKQN  356


 Score = 34.7 bits (78),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVGGLDP
Sbjct  272  EADPNNTTIFVGGLDP  287



>ref|XP_002864364.1| hypothetical protein ARALYDRAFT_495572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40623.1| hypothetical protein ARALYDRAFT_495572 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score = 96.3 bits (238),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ ++ +F  +GEL+HVKI   KRCGFVQ++NR +AEHALS L G QLG Q++RLSW
Sbjct  274  NVTDDELKSIFGQFGELLHVKIPPGKRCGFVQYANRATAEHALSVLNGTQLGGQSIRLSW  333

Query  466  GRNPSNKQSDQT  431
            GR+P NKQ DQ 
Sbjct  334  GRSP-NKQPDQA  344


 Score = 34.3 bits (77),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            DSDPNNTTIFVGGLD
Sbjct  258  DSDPNNTTIFVGGLD  272



>ref|XP_010448184.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Camelina 
sativa]
Length=421

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E+L++ VF  +GELVHVKI A KRCGFVQF+NR  AE ALS L G QLG Q+VRLSW
Sbjct  292  SVTEDLLKSVFGQFGELVHVKIPAGKRCGFVQFANRACAEQALSMLNGTQLGGQSVRLSW  351

Query  466  GRNPSNKQS  440
            G +PSNKQS
Sbjct  352  GHSPSNKQS  360



>ref|XP_010458570.1| PREDICTED: polyadenylate-binding protein RBP45B [Camelina sativa]
Length=406

 Score = 96.3 bits (238),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ ++ VFS YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLS
Sbjct  271  PSVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLS  330

Query  469  WGRNPSNKQS  440
            WGR+PSNKQ+
Sbjct  331  WGRSPSNKQA  340


 Score = 34.3 bits (77),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTT+FVGGLDP
Sbjct  256  DNDPNNTTVFVGGLDP  271



>ref|XP_007160823.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
 gb|ESW32817.1| hypothetical protein PHAVU_001G019600g [Phaseolus vulgaris]
Length=415

 Score =   101 bits (251),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  294  PNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLS  353

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G      Y  A          PP  DP++Y   YG+YP Y  +Q
Sbjct  354  WGRNPANKQF--RMDFGNPWTGAYYGAPIYDGYGYALPPRHDPSIYAAAYGAYPLYGAHQ  411

Query  298  Q  296
            Q
Sbjct  412  Q  412


 Score = 29.3 bits (64),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++D  NTTIFVGGLDP
Sbjct  279  EADSTNTTIFVGGLDP  294



>gb|AGV54251.1| RNA binding post-transcriptional regulator csx1 like protein 
[Phaseolus vulgaris]
Length=416

 Score =   101 bits (251),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  295  PNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLS  354

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G      Y  A          PP  DP++Y   YG+YP Y  +Q
Sbjct  355  WGRNPANKQF--RMDFGNPWTGAYYGAPIYDGYGYALPPRHDPSIYAAAYGAYPLYGAHQ  412

Query  298  Q  296
            Q
Sbjct  413  Q  413


 Score = 29.3 bits (64),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++D  NTTIFVGGLDP
Sbjct  280  EADSTNTTIFVGGLDP  295



>ref|NP_001144988.1| uncharacterized protein LOC100278143 [Zea mays]
 gb|ACG44236.1| hypothetical protein [Zea mays]
Length=436

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 73/124 (59%), Gaps = 6/124 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVSEE +RQ FS YGE+  VKI   K+CGFVQF+ R +AE AL  L G+ +G+QNVRLS
Sbjct  311  PNVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFAQRKNAEDALQGLNGSTIGKQNVRLS  370

Query  469  WGRNPSNKQ--SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY----YGSYPGYT  308
            WGRNP+NKQ   D        G  Y          Y  A P  DP MY    YG+YP Y 
Sbjct  371  WGRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYGYPAAAPFPDPGMYAAPAYGAYPFYG  430

Query  307  NYQQ  296
            N QQ
Sbjct  431  NQQQ  434



>gb|ACF87959.1| unknown [Zea mays]
 tpg|DAA61808.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=433

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 73/124 (59%), Gaps = 6/124 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVSEE +RQ FS YGE+  VKI   K+CGFVQF+ R +AE AL  L G+ +G+QNVRLS
Sbjct  308  PNVSEEDLRQTFSQYGEISSVKIPIGKQCGFVQFAQRKNAEDALQGLNGSTIGKQNVRLS  367

Query  469  WGRNPSNKQ--SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY----YGSYPGYT  308
            WGRNP+NKQ   D        G  Y          Y  A P  DP MY    YG+YP Y 
Sbjct  368  WGRNPANKQFRGDNGNQWNNGGMYYAAPPFYNGYGYPAAAPFPDPGMYAAPAYGAYPFYG  427

Query  307  NYQQ  296
            N QQ
Sbjct  428  NQQQ  431



>ref|NP_567764.1| polyadenylate-binding protein RBP45C [Arabidopsis thaliana]
 sp|Q93W34.1|RP45C_ARATH RecName: Full=Polyadenylate-binding protein RBP45C; Short=Poly(A)-binding 
protein RBP45C; AltName: Full=RNA-binding protein 
45C; Short=AtRBP45C [Arabidopsis thaliana]
 gb|AAK44154.1|AF370339_1 putative DNA binding protein [Arabidopsis thaliana]
 gb|AAK96678.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAL34173.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAM13291.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AEE85282.1| polyadenylate-binding protein RBP45C [Arabidopsis thaliana]
Length=415

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E+ ++ VF  +GELVHVKI A KRCGFVQ++NR  AE ALS L G QLG Q++RLSW
Sbjct  288  SVTEDDLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSVLNGTQLGGQSIRLSW  347

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDP  341
            GR+PSNKQ+   Q   G GG YYGY  QGY+AYGYAPPPQDP
Sbjct  348  GRSPSNKQTQPDQAQYGGGGGYYGYPPQGYEAYGYAPPPQDP  389



>emb|CAB36546.1| putative DNA binding protein [Arabidopsis thaliana]
 emb|CAB79555.1| putative DNA binding protein [Arabidopsis thaliana]
Length=427

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E+ ++ VF  +GELVHVKI A KRCGFVQ++NR  AE ALS L G QLG Q++RLSW
Sbjct  288  SVTEDDLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSVLNGTQLGGQSIRLSW  347

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDP  341
            GR+PSNKQ+   Q   G GG YYGY  QGY+AYGYAPPPQDP
Sbjct  348  GRSPSNKQTQPDQAQYGGGGGYYGYPPQGYEAYGYAPPPQDP  389



>gb|KHG22988.1| Polyadenylate-binding RBP45C -like protein [Gossypium arboreum]
Length=415

 Score = 97.8 bits (242),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 85/130 (65%), Gaps = 14/130 (11%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VSE+ ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G   G +NVRLS
Sbjct  291  PSVSEDQLKQIFSQLGEVVHVKIPANKNCGFVQYANRASAEQALSVLNGTIFGGRNVRLS  350

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY---------P  317
            WGR+PS KQ+             Y    QGY+AYGYAPPPQDPNMYYG Y         P
Sbjct  351  WGRSPSTKQAQ---PDPAQWNGGYYGYAQGYEAYGYAPPPQDPNMYYGGYPAGYGNYQQP  407

Query  316  GYTNYQQPQQ  287
            G   YQQPQQ
Sbjct  408  GA--YQQPQQ  415


 Score = 32.3 bits (72),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DP+NTTIFVGGLDP
Sbjct  276  ENDPSNTTIFVGGLDP  291



>ref|XP_009142977.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Brassica 
rapa]
Length=409

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E+ ++ VF  +GELVHVKI A KRCGFVQ++NR  AE AL+ L G QLG Q++RLSW
Sbjct  283  SVTEDGLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQALNQLNGTQLGGQSIRLSW  342

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPN  338
            GR+P+NKQ+   Q   G GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  343  GRSPNNKQTQPDQAQYGGGGGYYGYPPQGYEGYGYAPPPQDPN  385



>ref|XP_006468022.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Citrus sinensis]
 gb|KDO75472.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=406

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  643  VSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWG  464
            V++E +R++FS YG+LVHVKI A KRCGFVQF++R  AE AL  L G QLG QN+RLSWG
Sbjct  287  VTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWG  346

Query  463  RNPSNKQS  440
            R+PSNKQ+
Sbjct  347  RSPSNKQA  354



>ref|XP_006449039.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62279.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=406

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  643  VSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWG  464
            V++E +R++FS YG+LVHVKI A KRCGFVQF++R  AE AL  L G QLG QN+RLSWG
Sbjct  287  VTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWG  346

Query  463  RNPSNKQS  440
            R+PSNKQ+
Sbjct  347  RSPSNKQA  354



>ref|XP_006449038.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62278.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=413

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  643  VSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWG  464
            V++E +R++FS YG+LVHVKI A KRCGFVQF++R  AE AL  L G QLG QN+RLSWG
Sbjct  294  VTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWG  353

Query  463  RNPSNKQS  440
            R+PSNKQ+
Sbjct  354  RSPSNKQA  361



>ref|XP_006468021.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Citrus sinensis]
 gb|KDO75473.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=413

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  643  VSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWG  464
            V++E +R++FS YG+LVHVKI A KRCGFVQF++R  AE AL  L G QLG QN+RLSWG
Sbjct  294  VTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWG  353

Query  463  RNPSNKQS  440
            R+PSNKQ+
Sbjct  354  RSPSNKQA  361



>ref|XP_004250947.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Solanum 
lycopersicum]
Length=417

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PN++EE +RQVF  +GE+V+VKI AAK CGFVQFS RPSAE A+  +QGA +G+Q VR+S
Sbjct  235  PNLTEEELRQVFLQFGEIVYVKIPAAKGCGFVQFSARPSAEEAIQRMQGAVVGQQIVRVS  294

Query  469  WGRNPSNKQSDQT-qwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQ  296
            WGR+P+ KQ                 Y              QDP++Y YG+Y GYT Y  
Sbjct  295  WGRSPTAKQDAGLWGQPADPSQWNAYYGYGQGYDAYAYGATQDPSLYAYGAYAGYTQY--  352

Query  295  PQQ  287
            PQQ
Sbjct  353  PQQ  355



>gb|KHN46301.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=318

 Score =   100 bits (249),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  197  PNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTSIGKQTVRLS  256

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ          G  Y      GY       P  DP++Y   YG+YP Y  +Q
Sbjct  257  WGRNPANKQFRMDFGNPWTGAYYGAPMYDGYGYALT--PRHDPSIYAAAYGAYPLYGGHQ  314

Query  298  Q  296
            Q
Sbjct  315  Q  315


 Score = 29.3 bits (64),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++D  NTTIFVGGLDP
Sbjct  182  EADSTNTTIFVGGLDP  197



>ref|XP_010313279.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Solanum 
lycopersicum]
Length=416

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PN++EE +RQVF  +GE+V+VKI AAK CGFVQFS RPSAE A+  +QGA +G+Q VR+S
Sbjct  234  PNLTEEELRQVFLQFGEIVYVKIPAAKGCGFVQFSARPSAEEAIQRMQGAVVGQQIVRVS  293

Query  469  WGRNPSNKQSDQT-qwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQ  296
            WGR+P+ KQ                 Y              QDP++Y YG+Y GYT Y  
Sbjct  294  WGRSPTAKQDAGLWGQPADPSQWNAYYGYGQGYDAYAYGATQDPSLYAYGAYAGYTQY--  351

Query  295  PQQ  287
            PQQ
Sbjct  352  PQQ  354



>ref|XP_010433418.1| PREDICTED: polyadenylate-binding protein RBP45C [Camelina sativa]
Length=419

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E+L++ VF  +GELVHVKI A KRCGFVQF+NR  AE ALS L G QLG Q+VRLSW
Sbjct  291  SVTEDLLKSVFGQFGELVHVKIPAGKRCGFVQFANRACAEQALSMLNGTQLGGQSVRLSW  350

Query  466  GRNPSNKQS  440
            G +PSNKQ+
Sbjct  351  GHSPSNKQT  359



>ref|XP_004501589.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=413

 Score =   100 bits (248),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 4/121 (3%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PN + E +R+ FS YGE+V VKI   K CGFVQF+NR +AE AL  L GA +G+Q VRLS
Sbjct  291  PNATAEDLREPFSEYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGATIGKQTVRLS  350

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ  +  +G    G+YYG        Y   P P DP+MY   YG+YP Y  +Q
Sbjct  351  WGRNPANKQF-RMDFGSPWNGAYYGGPVYDGYGYAALPHPHDPSMYAAAYGAYPIYGGHQ  409

Query  298  Q  296
            Q
Sbjct  410  Q  410


 Score = 29.3 bits (64),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++D  NTTIFVGGLDP
Sbjct  276  EADSTNTTIFVGGLDP  291



>ref|XP_004957865.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Setaria italica]
Length=497

 Score = 98.6 bits (244),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+EE +RQ F+PYGE+ +VKI   KRCGFVQF++R SAE A+  L G+ +G QNVRLSW
Sbjct  336  NVNEEYLRQTFTPYGEIAYVKIPVGKRCGFVQFTSRSSAEEAIRMLNGSLIGGQNVRLSW  395

Query  466  GRNPSNKQSDQ  434
            GR+P NKQ+ Q
Sbjct  396  GRSPQNKQAPQ  406


 Score = 31.2 bits (69),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            ++DPNNTT+FVGGLD
Sbjct  320  ENDPNNTTVFVGGLD  334



>ref|XP_010438672.1| PREDICTED: polyadenylate-binding protein RBP45C [Camelina sativa]
Length=423

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E+L++ VF  +GELVHVKI A KRCGFVQF+NR  AE ALS L G QLG Q+VRLSW
Sbjct  291  SVTEDLLKSVFGQFGELVHVKIPAGKRCGFVQFANRACAEQALSMLNGTQLGGQSVRLSW  350

Query  466  GRNPSNKQS  440
            G +PSNKQ+
Sbjct  351  GHSPSNKQT  359



>ref|XP_004499084.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=426

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 71/121 (59%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E +RQ FS YGE+  VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  305  PNVTDEDLRQAFSQYGEIASVKIPVGKGCGFVQFANRNNAEEALQKLNGTMIGKQTVRLS  364

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G   G Y+         Y    P  DPNMY   YG YP Y  +Q
Sbjct  365  WGRNPANKQF--RFDFGSWAGPYFPSPIYDGYGYAMPSPHHDPNMYPLAYGGYPFYGGHQ  422

Query  298  Q  296
            Q
Sbjct  423  Q  423



>ref|XP_010482899.1| PREDICTED: polyadenylate-binding protein RBP45A-like [Camelina 
sativa]
Length=384

 Score = 97.1 bits (240),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ ++ +F  +GEL+HVK+   KRCGFVQ++NR SAEHALS L G QLG Q++RLSW
Sbjct  263  NVTDDELKSIFGQFGELIHVKLPPGKRCGFVQYANRASAEHALSVLHGTQLGGQSIRLSW  322

Query  466  GRNPSNKQSDQ  434
            GR+P NKQ DQ
Sbjct  323  GRSP-NKQPDQ  332


 Score = 32.3 bits (72),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            DS+PNNTT+FVGGLD
Sbjct  247  DSNPNNTTVFVGGLD  261



>ref|XP_009772575.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=410

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 66/118 (56%), Gaps = 32/118 (27%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQ+F  YG+L+HVKI   KRCGFVQF++R  AE AL SL G QLG Q++RLSW
Sbjct  285  NVTDEHLRQIFGHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRSLNGTQLGGQSIRLSW  344

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM---YYGSYPGYTNY  302
            GR+P+NKQ                             P  DPN    YYG  PGY  Y
Sbjct  345  GRSPANKQ-----------------------------PQVDPNQYGGYYGCTPGYEAY  373



>ref|XP_004957864.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Setaria italica]
Length=517

 Score = 98.2 bits (243),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+EE +RQ F+PYGE+ +VKI   KRCGFVQF++R SAE A+  L G+ +G QNVRLSW
Sbjct  336  NVNEEYLRQTFTPYGEIAYVKIPVGKRCGFVQFTSRSSAEEAIRMLNGSLIGGQNVRLSW  395

Query  466  GRNPSNKQSDQ  434
            GR+P NKQ+ Q
Sbjct  396  GRSPQNKQAPQ  406


 Score = 31.2 bits (69),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            ++DPNNTT+FVGGLD
Sbjct  320  ENDPNNTTVFVGGLD  334



>ref|XP_006307499.1| hypothetical protein CARUB_v10009124mg, partial [Capsella rubella]
 gb|EOA40397.1| hypothetical protein CARUB_v10009124mg, partial [Capsella rubella]
Length=448

 Score = 95.1 bits (235),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ ++ VF  YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLS
Sbjct  311  PSVTDDHLKNVFGQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLS  370

Query  469  WGRNPSNKQS  440
            WGR+PSNKQ+
Sbjct  371  WGRSPSNKQT  380


 Score = 34.3 bits (77),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTT+FVGGLDP
Sbjct  296  DNDPNNTTVFVGGLDP  311



>ref|XP_010546929.1| PREDICTED: polyadenylate-binding protein RBP45B [Tarenaya hassleriana]
Length=416

 Score = 97.1 bits (240),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V+++ +R+VF  YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG Q+VRLS
Sbjct  282  PSVTDDHLRKVFGQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGLQLGGQSVRLS  341

Query  469  WGRNPSNKQSDQT  431
            WGR+P++KQ   T
Sbjct  342  WGRSPTSKQGQAT  354


 Score = 32.3 bits (72),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DP NTT+FVGGLDP
Sbjct  267  DNDPTNTTVFVGGLDP  282



>ref|XP_002867529.1| hypothetical protein ARALYDRAFT_913848 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43788.1| hypothetical protein ARALYDRAFT_913848 [Arabidopsis lyrata subsp. 
lyrata]
Length=418

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V E+ ++ VF  +GELVHVKI A KRCGFVQ++NR  AE ALS L G QLG Q++RLSW
Sbjct  289  SVIEDDLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSLLNGTQLGGQSIRLSW  348

Query  466  GRNPSNKQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDP  341
            GR+PSNKQ+  DQ Q+GGG GG YYGY  QGY+AYGYAPPPQDP
Sbjct  349  GRSPSNKQTQPDQAQYGGGGGGGYYGYPPQGYEAYGYAPPPQDP  392



>ref|XP_009772574.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=411

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 66/118 (56%), Gaps = 31/118 (26%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E +RQ+F  YG+L+HVKI   KRCGFVQF++R  AE AL SL G QLG Q++RLSW
Sbjct  285  NVTDEHLRQIFGHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRSLNGTQLGGQSIRLSW  344

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM---YYGSYPGYTNY  302
            GR+P+NKQ                             P  DPN    YYG  PGY  Y
Sbjct  345  GRSPANKQQ----------------------------PQVDPNQYGGYYGCTPGYEAY  374



>gb|EPS64177.1| hypothetical protein M569_10604, partial [Genlisea aurea]
Length=438

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 75/128 (59%), Gaps = 15/128 (12%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV EE +RQVF  YGEL+HVKI   KRCGFVQF  R SAE A+  L G+QLG Q++RLSW
Sbjct  299  NVIEEHLRQVFGQYGELLHVKIPVGKRCGFVQFGERRSAEEAIRILNGSQLGGQSIRLSW  358

Query  466  GRNPSNKQSDQ-------------TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYG  326
            GR+PSNK   Q                GGG  G   G    G  +YG A   QDPNMYYG
Sbjct  359  GRSPSNKAQQQQADPSQWGSGGGAGGGGGGYYGYGGGGGYDGSYSYGGASQVQDPNMYYG  418

Query  325  SYPGYTNY  302
               GY NY
Sbjct  419  G--GYANY  424



>gb|KJB22074.1| hypothetical protein B456_004G028000 [Gossypium raimondii]
Length=414

 Score = 96.7 bits (239),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 86/130 (66%), Gaps = 14/130 (11%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+VSE+ ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G   G +NVRLS
Sbjct  290  PSVSEDQLKQIFSQLGEVVHVKIPANKNCGFVQYANRASAEQALSVLNGTIFGGRNVRLS  349

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY---------P  317
            WGR+PS KQ+           S Y    QGY+AYGYAPPPQDPNMYYG Y         P
Sbjct  350  WGRSPSTKQAQ---PDPAQWNSGYYGYAQGYEAYGYAPPPQDPNMYYGGYPAGYGNYQQP  406

Query  316  GYTNYQQPQQ  287
            G   YQQPQQ
Sbjct  407  G--AYQQPQQ  414


 Score = 32.3 bits (72),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DP+NTTIFVGGLDP
Sbjct  275  ENDPSNTTIFVGGLDP  290



>ref|XP_001777334.1| predicted protein [Physcomitrella patens]
 ref|XP_001782740.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ52446.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ57864.1| predicted protein, partial [Physcomitrella patens]
Length=416

 Score = 94.0 bits (232),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P V +E +R VF  +GELV+VKI A K CGFVQF++R  AE AL  L    +G Q VRLS
Sbjct  234  PAVGDEDLRNVFGQFGELVYVKIPAGKGCGFVQFTHRACAEEALQRLHQTVIGTQAVRLS  293

Query  469  WGRNPSNKQS-------DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPG  314
            WGR+P NKQ+        Q       GG Y GYAQ        A PPQDP    YG+YPG
Sbjct  294  WGRSPGNKQTADPGWGQHQDPNQWNAGGYYQGYAQGYDQYGYPAQPPQDPAYAQYGNYPG  353

Query  313  YTNYQQPQQ  287
            Y NY  PQQ
Sbjct  354  YGNY--PQQ  360


 Score = 35.0 bits (79),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  219  DNDPNNTTIFVGGLDP  234



>ref|XP_009109155.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Brassica 
rapa]
Length=404

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E++++ VF  +GELVHVKI A KRCGFVQ++NR  AE  L++L G QLG Q++RLSW
Sbjct  276  SVTEDVLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQGLNALNGTQLGGQSIRLSW  335

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPN  338
            GR  SNKQ+   Q   G GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  336  GRTTSNKQTQPDQAQYGGGGGYYGYPPQGYEGYGYAPPPQDPN  378



>emb|CDY14290.1| BnaA08g14210D [Brassica napus]
Length=417

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E++++ VF  +GELVHVKI A KRCGFVQ++NR  AE  L++L G QLG Q++RLSW
Sbjct  276  SVTEDVLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQGLNALNGTQLGGQSIRLSW  335

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPN  338
            GR  SNKQ+   Q   G GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  336  GRTTSNKQTQPDQAQYGGGGGYYGYPPQGYEGYGYAPPPQDPN  378



>ref|XP_004238180.1| PREDICTED: polyadenylate-binding protein RBP47-like [Solanum 
lycopersicum]
Length=451

 Score = 98.6 bits (244),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 68/121 (56%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ F+ YGE+V VKI   K CGFVQF+ R  AE AL  L G  +G+Q VRLS
Sbjct  330  PNVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFAKRNDAEEALQKLNGTAIGKQTVRLS  389

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G      Y             P P DP MY   YG+YP Y  +Q
Sbjct  390  WGRNPANKQP--RSDFGNQWTGPYYGGHFYDGYGYAFPQPHDPGMYAAAYGAYPVYGTHQ  447

Query  298  Q  296
            Q
Sbjct  448  Q  448


 Score = 30.4 bits (67),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+D  NTTIFVGGLDP
Sbjct  315  DADSTNTTIFVGGLDP  330



>ref|XP_006361746.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
X1 [Solanum tuberosum]
Length=418

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 81/130 (62%), Gaps = 18/130 (14%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PN++EE +RQVF  +GE+V+VKI A+K CGFVQFS RPSAE A+  +QGA +G+Q VR+S
Sbjct  235  PNLTEEELRQVFLQFGEIVYVKIPASKGCGFVQFSARPSAEEAIQRMQGAVVGQQIVRVS  294

Query  469  WGRNPSNKQ--------SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYP  317
            WGR+P+ KQ        +D TQW    G      A             QDP++Y YG+Y 
Sbjct  295  WGRSPTAKQDAGLWGQPADPTQWNAYYGYGQGYDAYAYGAT-------QDPSLYAYGAYA  347

Query  316  GYTNYQQPQQ  287
            GYT Y  PQQ
Sbjct  348  GYTQY--PQQ  355



>ref|XP_006361747.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
X2 [Solanum tuberosum]
Length=417

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 81/130 (62%), Gaps = 18/130 (14%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PN++EE +RQVF  +GE+V+VKI A+K CGFVQFS RPSAE A+  +QGA +G+Q VR+S
Sbjct  234  PNLTEEELRQVFLQFGEIVYVKIPASKGCGFVQFSARPSAEEAIQRMQGAVVGQQIVRVS  293

Query  469  WGRNPSNKQ--------SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYP  317
            WGR+P+ KQ        +D TQW    G      A             QDP++Y YG+Y 
Sbjct  294  WGRSPTAKQDAGLWGQPADPTQWNAYYGYGQGYDAYAYGAT-------QDPSLYAYGAYA  346

Query  316  GYTNYQQPQQ  287
            GYT Y  PQQ
Sbjct  347  GYTQY--PQQ  354



>ref|XP_003544447.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=425

 Score = 99.8 bits (247),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  304  PNVSDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTSIGKQTVRLS  363

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ          G  Y      GY       P  DP++Y   YG+YP Y  +Q
Sbjct  364  WGRNPANKQFRMDFGNPWTGAYYGAPMYDGYGYALT--PRHDPSIYAAAYGAYPLYGGHQ  421

Query  298  Q  296
            Q
Sbjct  422  Q  422


 Score = 29.3 bits (64),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++D  NTTIFVGGLDP
Sbjct  289  EADSTNTTIFVGGLDP  304



>emb|CDX92786.1| BnaC07g40440D [Brassica napus]
Length=426

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E++++ VF  +GELVHVKI A KRCGFVQ++ R  AE AL+SL G QLG QN+RLSW
Sbjct  282  SVTEDVLKSVFGQFGELVHVKIPAGKRCGFVQYAIRGCAEQALNSLNGTQLGGQNIRLSW  341

Query  466  GRNPSNKQSD-QTqwgggvggsyygyaqqgydaygyAPPPQDPN  338
            GR PSNKQ+  +    GG GG YYGY  QGY+ YGY PPPQDPN
Sbjct  342  GRTPSNKQTQPEQAQYGGGGGGYYGYPPQGYEGYGYVPPPQDPN  385



>ref|XP_002305583.2| RNA-binding protein 45 [Populus trichocarpa]
 gb|EEE86094.2| RNA-binding protein 45 [Populus trichocarpa]
Length=409

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV ++ ++++F  YG+L+HVKI A KRCGFVQF++R SAE AL  L GAQL  QN+RLSW
Sbjct  286  NVMDDHLKELFGQYGQLLHVKIPAGKRCGFVQFADRSSAEEALKMLNGAQLSGQNIRLSW  345

Query  466  GRNPSNKQS  440
            GRNPSNKQ+
Sbjct  346  GRNPSNKQA  354



>ref|XP_011037670.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Populus 
euphratica]
Length=409

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV ++ ++++F  YG+L+HVKI A KRCGFVQF++R SAE AL  L GAQL  QN+RLSW
Sbjct  286  NVMDDHLKELFGQYGQLLHVKIPAGKRCGFVQFADRSSAEEALKMLNGAQLNGQNIRLSW  345

Query  466  GRNPSNKQS  440
            GRNPSNKQ+
Sbjct  346  GRNPSNKQA  354



>ref|XP_009631417.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nicotiana tomentosiformis]
Length=396

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E ++Q+F  YG+L+HVKI   KRCGFVQF++R  AE AL SL G QLG Q++RLSW
Sbjct  282  NVTDEHLKQIFGHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRSLNGTQLGGQSIRLSW  341

Query  466  GRNPSNKQSD  437
            GR+P+NKQ D
Sbjct  342  GRSPANKQVD  351



>emb|CDY66423.1| BnaAnng22220D [Brassica napus]
Length=426

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E++++ VF  +GELVHVKI A KRCGFVQ++NR  AE  L++L G QLG Q++RLSW
Sbjct  278  SVTEDVLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQGLNALNGTQLGGQSIRLSW  337

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPN  338
            GR  SNKQ+   Q   G GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  338  GRTTSNKQTQPDQAQYGGGGGYYGYPPQGYEGYGYAPPPQDPN  380



>ref|XP_007017333.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
 gb|EOY14558.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
Length=380

 Score = 97.8 bits (242),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+EE +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  311  PNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLS  370

Query  469  WGRNPSNKQS  440
            WGRNP+NKQS
Sbjct  371  WGRNPANKQS  380


 Score = 30.8 bits (68),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D +NTTIFVGGLDP
Sbjct  296  DGDSSNTTIFVGGLDP  311



>ref|XP_004507696.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Cicer arietinum]
Length=361

 Score = 97.1 bits (240),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 1/69 (1%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+++ +RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLS
Sbjct  274  PNVTDDHLRQVFGQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLS  333

Query  469  WGRNPSNKQ  443
            WG++P NKQ
Sbjct  334  WGKSP-NKQ  341


 Score = 31.2 bits (69),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++DPNNTTIFVG LDP
Sbjct  259  ENDPNNTTIFVGNLDP  274



>ref|XP_009765294.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
sylvestris]
Length=456

 Score = 97.8 bits (242),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ F+ YGE+V VKI   K CGFVQF+NR  AE AL  L G  +G+Q VRLS
Sbjct  332  PNVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTAIGKQTVRLS  391

Query  469  WGRNPSNKQS  440
            WGRNP+NKQS
Sbjct  392  WGRNPANKQS  401


 Score = 30.4 bits (67),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+D  NTTIFVGGLDP
Sbjct  317  DADSTNTTIFVGGLDP  332



>ref|XP_008812246.1| PREDICTED: polyadenylate-binding protein RBP47B' [Phoenix dactylifera]
Length=447

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+EE ++Q+F+ +GEL++VKI AAK CGFVQFS RPSAE A+  LQG  +G+Q V+LS
Sbjct  266  PNVTEEELKQIFAQFGELIYVKIPAAKGCGFVQFSARPSAEEAIQRLQGTMIGQQIVKLS  325

Query  469  WGRNPSNKQS  440
            WGR+P+NKQ 
Sbjct  326  WGRSPANKQD  335



>gb|KFK43438.1| hypothetical protein AALP_AA1G125300 [Arabis alpina]
Length=403

 Score = 94.4 bits (233),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P V+E+ ++ VF  YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLS
Sbjct  270  PTVTEDHLKNVFGQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGMQLGGTTVRLS  329

Query  469  WGRNPSNKQS  440
            WGR+P+NKQ+
Sbjct  330  WGRSPANKQA  339


 Score = 33.5 bits (75),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTT+F+GGLDP
Sbjct  255  DNDPNNTTVFIGGLDP  270



>ref|XP_009629702.1| PREDICTED: polyadenylate-binding protein RBP47-like [Nicotiana 
tomentosiformis]
Length=456

 Score = 97.4 bits (241),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVS+E +RQ F+ YGE+V VKI   K CGFVQF+NR  AE AL  L G  +G+Q VRLS
Sbjct  332  PNVSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTAIGKQTVRLS  391

Query  469  WGRNPSNKQS  440
            WGRNP+NKQS
Sbjct  392  WGRNPANKQS  401


 Score = 30.4 bits (67),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+D  NTTIFVGGLDP
Sbjct  317  DADSTNTTIFVGGLDP  332



>ref|XP_001784132.1| predicted protein [Physcomitrella patens]
 gb|EDQ51056.1| predicted protein [Physcomitrella patens]
Length=453

 Score = 92.8 bits (229),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 73/128 (57%), Gaps = 8/128 (6%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P V +E +R VF  +GELV+VKI A K CGFVQF++R  AE AL  L    +G Q VRLS
Sbjct  266  PAVGDEDLRNVFGQFGELVYVKIPAGKGCGFVQFTHRACAEEALQRLHQTVIGTQAVRLS  325

Query  469  WGRNPSNKQSD-------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPG  314
            WGR+P NKQ+        Q        G Y GYAQ        AP PQDP    YG+YPG
Sbjct  326  WGRSPGNKQTSDPAWGHHQDPNQWNAAGYYQGYAQGYDQYGYPAPAPQDPAYAQYGNYPG  385

Query  313  YTNYQQPQ  290
            Y NY Q Q
Sbjct  386  YGNYPQQQ  393


 Score = 35.0 bits (79),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 15/16 (94%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D+DPNNTTIFVGGLDP
Sbjct  251  DNDPNNTTIFVGGLDP  266



>ref|XP_010525621.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Tarenaya 
hassleriana]
Length=434

 Score = 99.4 bits (246),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 70/122 (57%), Gaps = 6/122 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E +RQ F+ YG++V VKI   K CGFVQF NR SAE AL  L G  +G+Q VRLS
Sbjct  312  PNVTDEDLRQPFADYGDIVSVKIPTGKGCGFVQFVNRTSAEEALDKLNGVVIGKQTVRLS  371

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY----YGSYPGYTNY  302
            WGR+P+NKQ       G      Y   Q         PPP DP MY    YG+YP Y   
Sbjct  372  WGRSPANKQV--RGEFGNQWVGPYYGGQYYNGYGYMIPPPHDPIMYTAAPYGAYPMYGGD  429

Query  301  QQ  296
            QQ
Sbjct  430  QQ  431


 Score = 28.5 bits (62),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D  NTTIFVGGLDP
Sbjct  297  DGDSLNTTIFVGGLDP  312



>ref|XP_004141245.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
 ref|XP_004160607.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cucumis 
sativus]
Length=426

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E +RQ FS YGE+V VKI   K CGFVQF+NR  AE AL  L G  +G+Q VRLS
Sbjct  301  PNVTDEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTVIGKQTVRLS  360

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQ  290
            WGRNP+NKQ    +  G      Y               P DP+MY+ +Y  YT Y   Q
Sbjct  361  WGRNPANKQ---FRDFGNQWNGAYYGGHIYDGYGYGLASPHDPSMYHAAYGAYTVYGNHQ  417

Query  289  Q  287
            Q
Sbjct  418  Q  418



>gb|KJB69303.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=419

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+E+ +R+VFSPYG+LVHVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSW
Sbjct  297  NVTEDHLREVFSPYGQLVHVKIPQNKRCGFVQFADRSCAEEALRILNGTQLGGQSIRLSW  356

Query  466  GRNPSNKQS  440
            GR+ SNKQ+
Sbjct  357  GRSTSNKQA  365



>ref|XP_010539063.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010539064.1| PREDICTED: polyadenylate-binding protein RBP47C-like isoform 
X2 [Tarenaya hassleriana]
Length=426

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 71/124 (57%), Gaps = 6/124 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P+V++E +RQ F+ YG+++ VKI + K CGFVQF NR SAE AL  L G+ +G+Q VRLS
Sbjct  303  PSVTDEDLRQPFAEYGDIISVKIPSGKGCGFVQFVNRTSAEEALEKLNGSVIGQQTVRLS  362

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY----YGSYPGYTNY  302
            WGRNP+NKQ              Y   +         PPP DP MY    YG+YP Y   
Sbjct  363  WGRNPANKQ--HRGEFRNQWVGPYYGGEYYNGYGYMIPPPHDPIMYNPATYGAYPMYGGD  420

Query  301  QQPQ  290
             Q Q
Sbjct  421  HQQQ  424



>ref|XP_009605325.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Nicotiana 
tomentosiformis]
Length=422

 Score = 97.8 bits (242),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 67/122 (55%), Gaps = 6/122 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            P VS+E +R  F+ YGE+  VKI   K CGFVQF+ R  AE AL  L G  +G+Q VRLS
Sbjct  300  PIVSDEDLRHPFAQYGEIASVKIPVGKGCGFVQFAKRNDAEKALQKLNGTAIGKQTVRLS  359

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY----YGSYPGYTNY  302
            WGRNP+NKQS             Y             PPP DP+MY    YG+YP Y  +
Sbjct  360  WGRNPANKQS--RADFMKQWTGPYYGGHFYNAYGYAFPPPHDPSMYAAAAYGTYPIYGTH  417

Query  301  QQ  296
            QQ
Sbjct  418  QQ  419


 Score = 29.3 bits (64),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D  NTTIFVGGLDP
Sbjct  285  DVDSTNTTIFVGGLDP  300



>ref|XP_007136663.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
 gb|ESW08657.1| hypothetical protein PHAVU_009G063200g [Phaseolus vulgaris]
Length=420

 Score = 97.4 bits (241),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 70/121 (58%), Gaps = 5/121 (4%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+ E +RQ FS YGE+V VKI   K CGFVQF+ R +AE AL  L G  +G+Q VRLS
Sbjct  299  PNVTAEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAIRNNAEEALQKLNGTTIGKQMVRLS  358

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ       G      Y             PPP DP++Y   YG+YP Y  +Q
Sbjct  359  WGRNPANKQF--RGDFGSPWSGAYYGGPVYDGYGYALPPPHDPSIYAAAYGAYPIYGGHQ  416

Query  298  Q  296
            Q
Sbjct  417  Q  417


 Score = 29.6 bits (65),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            ++D  NTTIFVGGLDP
Sbjct  284  EADSTNTTIFVGGLDP  299



>gb|KJB69301.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=427

 Score = 98.2 bits (243),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+E+ +R+VFSPYG+LVHVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSW
Sbjct  297  NVTEDHLREVFSPYGQLVHVKIPQNKRCGFVQFADRSCAEEALRILNGTQLGGQSIRLSW  356

Query  466  GRNPSNKQ  443
            GR+ SNKQ
Sbjct  357  GRSTSNKQ  364


 Score = 28.9 bits (63),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            ++DPNNTTIFVG LD
Sbjct  281  ENDPNNTTIFVGNLD  295



>gb|AAM64532.1| putative DNA binding protein [Arabidopsis thaliana]
Length=404

 Score = 95.1 bits (235),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+++ ++ VFS YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLSW
Sbjct  270  SVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLSW  329

Query  466  GRNPSNKQS  440
            GR+PSNKQS
Sbjct  330  GRSPSNKQS  338


 Score = 32.0 bits (71),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            D+DPNNTT+FVGGLD
Sbjct  254  DNDPNNTTVFVGGLD  268



>gb|KFK29206.1| hypothetical protein AALP_AA7G103000 [Arabis alpina]
Length=401

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+E++++ VF  +GELVHVKI A KRCGFVQ++NR  AE ALS L G QLG Q++RLSW
Sbjct  275  SVTEDVLKSVFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSVLNGTQLGGQSIRLSW  334

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPN  338
            GR+PS+KQ+ Q       GG YYGY  QGY+AYGYAPP QDPN
Sbjct  335  GRSPSSKQT-QPDQAQYGGGGYYGYPPQGYEAYGYAPPTQDPN  376



>ref|XP_007017330.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
 gb|EOY14555.1| RNA-binding protein 47C isoform 2 [Theobroma cacao]
Length=394

 Score = 96.3 bits (238),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+EE +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  311  PNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLS  370

Query  469  WGRNPSNKQ  443
            WGRNP+NKQ
Sbjct  371  WGRNPANKQ  379


 Score = 30.4 bits (67),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D +NTTIFVGGLDP
Sbjct  296  DGDSSNTTIFVGGLDP  311



>ref|XP_007017331.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
 gb|EOY14556.1| RNA-binding protein 47C isoform 3 [Theobroma cacao]
Length=436

 Score = 96.3 bits (238),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+EE +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  312  PNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLS  371

Query  469  WGRNPSNKQ  443
            WGRNP+NKQ
Sbjct  372  WGRNPANKQ  380


 Score = 30.4 bits (67),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D +NTTIFVGGLDP
Sbjct  297  DGDSSNTTIFVGGLDP  312



>ref|NP_172630.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
 sp|Q9SAB3.1|RB45B_ARATH RecName: Full=Polyadenylate-binding protein RBP45B; Short=Poly(A)-binding 
protein RBP45B; AltName: Full=RNA-binding protein 
45B; Short=AtRBP45B [Arabidopsis thaliana]
 gb|AAD30259.1|AC007296_20 Similar to gb|U90212 DNA binding protein ACBF from Nicotiana 
tabacum and contains 3 PF|00076 RNA recognition motif domains. 
ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, 
gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, 
gb|F15495 and gb|Z30868 come from this gene [Arabidopsis 
thaliana]
 gb|AAM13200.1| similar to gb|U90212 DNA binding protein ACBF from Nicotiana 
tabacum and contains 3 PF|00076 RNA recognition motif domains 
[Arabidopsis thaliana]
 gb|AAP37853.1| At1g11650 [Arabidopsis thaliana]
 gb|AEE28764.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
Length=405

 Score = 95.1 bits (235),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            +V+++ ++ VFS YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLSW
Sbjct  271  SVTDDHLKNVFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLSW  330

Query  466  GRNPSNKQS  440
            GR+PSNKQS
Sbjct  331  GRSPSNKQS  339


 Score = 32.0 bits (71),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 13/15 (87%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLD  651
            D+DPNNTT+FVGGLD
Sbjct  255  DNDPNNTTVFVGGLD  269



>ref|XP_006374988.1| RNA-binding protein 47 [Populus trichocarpa]
 gb|ERP52785.1| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score = 94.7 bits (234),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E ++Q FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  305  PNVTDEDLKQPFSQYGEIVSVKIPVGKGCGFVQFANRDNAEEALQKLNGTVIGKQTVRLS  364

Query  469  WGRNPSNKQ  443
            WGRNP+NKQ
Sbjct  365  WGRNPANKQ  373


 Score = 32.3 bits (72),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D NNTTIFVGGLDP
Sbjct  290  DGDSNNTTIFVGGLDP  305



>ref|XP_007017329.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
 gb|EOY14554.1| RNA-binding protein 47C isoform 1 [Theobroma cacao]
Length=435

 Score = 96.3 bits (238),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV+EE +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLS
Sbjct  311  PNVTEEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLS  370

Query  469  WGRNPSNKQ  443
            WGRNP+NKQ
Sbjct  371  WGRNPANKQ  379


 Score = 30.4 bits (67),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D D +NTTIFVGGLDP
Sbjct  296  DGDSSNTTIFVGGLDP  311



>ref|XP_009631415.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana tomentosiformis]
Length=399

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 81/121 (67%), Gaps = 4/121 (3%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV++E ++Q+F  YG+L+HVKI   KRCGFVQF++R  AE AL SL G QLG Q++RLSW
Sbjct  282  NVTDEHLKQIFGHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRSLNGTQLGGQSIRLSW  341

Query  466  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM-YYGSYPGYTNYQQPQ  290
            GR+P+NKQ  Q           Y     GY+AYGYAPP QD N+ Y   Y GY NY QPQ
Sbjct  342  GRSPANKQQPQV---DPNQYGGYYGYTPGYEAYGYAPPTQDSNLYYAAGYAGYGNYTQPQ  398

Query  289  Q  287
            Q
Sbjct  399  Q  399



>ref|XP_008782204.1| PREDICTED: polyadenylate-binding protein RBP47-like isoform X1 
[Phoenix dactylifera]
Length=409

 Score = 94.4 bits (233),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 77/121 (64%), Gaps = 6/121 (5%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNVSE+ ++Q FS YGE+  VKI   K+CGFVQF +R +AE AL  L G  +G+Q VRLS
Sbjct  290  PNVSEDDLKQAFSQYGEVASVKIPVGKQCGFVQFVHRNNAEEALQQLNGTVIGKQLVRLS  349

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQ  299
            WGRNP+NKQ    +   G   +   +  Q ++ YGY  P  DP+MY   YG+YP Y N Q
Sbjct  350  WGRNPTNKQ---LRARPGSHWNGVYHGGQVHNGYGYVLPAHDPSMYAAAYGAYPLYGNQQ  406

Query  298  Q  296
            Q
Sbjct  407  Q  407


 Score = 32.3 bits (72),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            D DP NTT+FVGGLDP
Sbjct  275  DGDPTNTTVFVGGLDP  290



>ref|XP_004234481.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
lycopersicum]
Length=405

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -1

Query  646  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  467
            NV+++ +RQVF  YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q +RLSW
Sbjct  281  NVTDDHLRQVFGNYGQLLHVKIPVGKRCGFVQFADRSCAEEALRALSGTQLGGQTIRLSW  340

Query  466  GRNPSNKQSDQ  434
            GR+PSNKQ  Q
Sbjct  341  GRSPSNKQQPQ  351



>ref|XP_008452518.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cucumis 
melo]
Length=426

 Score = 98.2 bits (243),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 69/121 (57%), Gaps = 3/121 (2%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E +RQ FS +GE+V VKI   K CGFVQF+NR  AE AL  L G  +G+Q VRLS
Sbjct  301  PNVTDEDLRQPFSQHGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTVIGKQTVRLS  360

Query  469  WGRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQ  290
            WGRNP+NKQ  +    G      Y               P DP+MY+ +Y  YT Y   Q
Sbjct  361  WGRNPANKQFRE---FGNQWNGAYYGGHIYDGYGYGLASPHDPSMYHAAYGAYTVYGNHQ  417

Query  289  Q  287
            Q
Sbjct  418  Q  418


 Score = 28.1 bits (61),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -3

Query  695  DSDPNNTTIFVGGLDP  648
            + D  NTTIFVGGLDP
Sbjct  286  EGDSANTTIFVGGLDP  301



>gb|KDO35913.1| hypothetical protein CISIN_1g029152mg [Citrus sinensis]
Length=152

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -1

Query  649  PNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLS  470
            PNV++E +RQ FS YGE+  VKI   K CGFVQF+NR +AE AL  L G  +G+Q+VRLS
Sbjct  65   PNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLS  124

Query  469  WGRNPSNKQS  440
            WGRNP+NKQ+
Sbjct  125  WGRNPANKQA  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160