BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021P22

Length=691
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086328.1|  PREDICTED: uncharacterized protein LOC105168091    169   9e-46   Sesamum indicum [beniseed]
ref|XP_006477961.1|  PREDICTED: DDRGK domain-containing protein 1...    166   5e-45   
ref|XP_010054060.1|  PREDICTED: homeobox protein GBX-1                  167   7e-45   Eucalyptus grandis [rose gum]
ref|XP_007014540.1|  Hydroxyproline-rich glycoprotein family prot...    166   1e-44   
emb|CBI17195.3|  unnamed protein product                                159   2e-44   Vitis vinifera
gb|EYU33805.1|  hypothetical protein MIMGU_mgv1a005203mg                165   5e-44   Erythranthe guttata [common monkey flower]
ref|XP_010552168.1|  PREDICTED: zinc finger CCCH domain-containin...    164   8e-44   Tarenaya hassleriana [spider flower]
gb|KDO45643.1|  hypothetical protein CISIN_1g009722mg                   164   2e-43   Citrus sinensis [apfelsine]
ref|XP_007147417.1|  hypothetical protein PHAVU_006G122700g             164   2e-43   Phaseolus vulgaris [French bean]
ref|XP_009616263.1|  PREDICTED: la-related protein 1                    162   4e-43   Nicotiana tomentosiformis
ref|XP_003629502.1|  hypothetical protein MTR_8g078230                  162   5e-43   Medicago truncatula
ref|XP_009796159.1|  PREDICTED: la-related protein 1                    161   8e-43   Nicotiana sylvestris
ref|XP_004230134.1|  PREDICTED: la-related protein 1                    160   2e-42   Solanum lycopersicum
ref|XP_004509236.1|  PREDICTED: uncharacterized protein LOC101507965    160   3e-42   Cicer arietinum [garbanzo]
ref|XP_010679107.1|  PREDICTED: uncharacterized protein LOC104894548    159   4e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007213291.1|  hypothetical protein PRUPE_ppa006080mg             158   7e-42   
ref|XP_002274822.2|  PREDICTED: coilin                                  159   9e-42   Vitis vinifera
ref|XP_006347816.1|  PREDICTED: la-related protein 1-like               158   1e-41   Solanum tuberosum [potatoes]
ref|XP_010095949.1|  hypothetical protein L484_023937                   157   2e-41   Morus notabilis
ref|XP_006586863.1|  PREDICTED: la-related protein 1 isoform X1         157   2e-41   Glycine max [soybeans]
ref|XP_004295550.1|  PREDICTED: uncharacterized protein LOC101300131    157   2e-41   Fragaria vesca subsp. vesca
ref|XP_009340554.1|  PREDICTED: uncharacterized protein LOC103932646    156   2e-41   
emb|CDP13552.1|  unnamed protein product                                157   2e-41   Coffea canephora [robusta coffee]
gb|KJB83335.1|  hypothetical protein B456_013G241700                    157   3e-41   Gossypium raimondii
ref|XP_008225991.1|  PREDICTED: la-related protein 1                    157   3e-41   Prunus mume [ume]
ref|XP_009340130.1|  PREDICTED: collagen alpha-1(III) chain-like        157   4e-41   Pyrus x bretschneideri [bai li]
ref|XP_010274926.1|  PREDICTED: pro-resilin                             156   6e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009363324.1|  PREDICTED: histone-lysine N-methyltransferas...    154   3e-40   Pyrus x bretschneideri [bai li]
gb|KHG06267.1|  FYVE, RhoGEF and PH domain-containing 2                 154   5e-40   Gossypium arboreum [tree cotton]
gb|KHN14280.1|  hypothetical protein glysoja_012318                     148   2e-39   Glycine soja [wild soybean]
ref|XP_002523666.1|  conserved hypothetical protein                     148   4e-38   Ricinus communis
ref|XP_008451827.1|  PREDICTED: uncharacterized protein LOC103492997    148   4e-38   Cucumis melo [Oriental melon]
ref|XP_010914286.1|  PREDICTED: one cut domain family member 3          146   2e-37   Elaeis guineensis
gb|KDP42449.1|  hypothetical protein JCGZ_00246                         146   3e-37   Jatropha curcas
ref|XP_008371966.1|  PREDICTED: uncharacterized protein LOC103435355    145   4e-37   
ref|XP_009417699.1|  PREDICTED: uncharacterized protein LOC103998046    145   7e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006392774.1|  hypothetical protein EUTSA_v10012156mg             135   2e-36   
ref|XP_006392772.1|  hypothetical protein EUTSA_v10011382mg             144   3e-36   Eutrema salsugineum [saltwater cress]
ref|XP_006307233.1|  hypothetical protein CARUB_v10008838mg             144   3e-36   Capsella rubella
ref|NP_564639.1|  hydroxyproline-rich glycoprotein family protein       143   5e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65660.1|  Contains similarity to RNA-binding protein from A...    143   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479938.1|  PREDICTED: histone-lysine N-methyltransferas...    142   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010462262.1|  PREDICTED: serine/threonine-protein kinase L...    142   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010501021.1|  PREDICTED: uncharacterized protein LOC104778302    142   1e-35   Camelina sativa [gold-of-pleasure]
gb|EPS65553.1|  hypothetical protein M569_09226                         141   1e-35   Genlisea aurea
emb|CDY68781.1|  BnaC06g41920D                                          136   8e-35   Brassica napus [oilseed rape]
ref|XP_011041628.1|  PREDICTED: uncharacterized protein LOC105137544    139   9e-35   Populus euphratica
ref|XP_002321880.2|  hydroxyproline-rich glycoprotein                   139   9e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006656343.1|  PREDICTED: uncharacterized protein LOC102703042    135   1e-34   Oryza brachyantha
ref|XP_008812566.1|  PREDICTED: one cut domain family member 3          139   1e-34   Phoenix dactylifera
ref|XP_004147751.1|  PREDICTED: uncharacterized protein LOC101215545    138   2e-34   Cucumis sativus [cucumbers]
gb|KFK35706.1|  hypothetical protein AALP_AA4G026200                    137   3e-34   Arabis alpina [alpine rockcress]
ref|XP_002894457.1|  predicted protein                                  139   4e-34   
ref|XP_009144805.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    132   6e-34   
gb|AAF78422.1|AC018748_1  Contains similarity to RNA-binding prot...    139   8e-34   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24082.1|  BnaA06g00800D                                          136   1e-33   Brassica napus [oilseed rape]
ref|XP_009123972.1|  PREDICTED: uncharacterized protein LOC103848902    136   1e-33   Brassica rapa
emb|CDY45126.1|  BnaC06g06470D                                          137   3e-33   Brassica napus [oilseed rape]
gb|EAZ41082.1|  hypothetical protein OsJ_25572                          129   5e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001136771.1|  uncharacterized protein LOC100216913               126   4e-32   
gb|EAZ01989.1|  hypothetical protein OsI_24021                          128   9e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_003563360.1|  PREDICTED: formin-like protein 3                   129   2e-31   
ref|NP_001174943.1|  Os06g0664400                                       128   5e-31   
ref|XP_004965630.1|  PREDICTED: CCAAT/enhancer-binding protein al...    127   1e-30   Setaria italica
ref|XP_008665440.1|  PREDICTED: uncharacterized protein LOC100216...    125   6e-30   
emb|CDY25835.1|  BnaA05g14260D                                          118   3e-29   Brassica napus [oilseed rape]
ref|XP_002466313.1|  hypothetical protein SORBIDRAFT_01g005470          122   1e-28   Sorghum bicolor [broomcorn]
gb|EMT30553.1|  hypothetical protein F775_52530                         120   3e-28   
emb|CDY72278.1|  BnaAnng40500D                                          115   5e-28   Brassica napus [oilseed rape]
ref|XP_007146827.1|  hypothetical protein PHAVU_006G0732001g            115   2e-26   Phaseolus vulgaris [French bean]
ref|XP_006583470.1|  PREDICTED: uncharacterized protein LOC100786...    106   4e-25   
ref|XP_006442253.1|  hypothetical protein CICLE_v10019766mg             112   6e-25   
ref|XP_006837366.1|  hypothetical protein AMTR_s00111p00111440        99.0    2e-20   
gb|KHN45261.1|  ATP-dependent RNA helicase DOB1                       62.0    9e-09   Glycine soja [wild soybean]
ref|XP_001772840.1|  predicted protein                                59.7    5e-07   
ref|XP_002438807.1|  hypothetical protein SORBIDRAFT_10g026546        54.3    1e-06   
ref|XP_007146828.1|  hypothetical protein PHAVU_006G0732000g          50.4    2e-05   Phaseolus vulgaris [French bean]



>ref|XP_011086328.1| PREDICTED: uncharacterized protein LOC105168091 [Sesamum indicum]
Length=484

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQEEWEEVM+ETM+  +P+IKEIVDHYSGPDRVTAKQQ +E
Sbjct  372  LRDALEKMKPFLMAYEGIQSQEEWEEVMEETMKT-VPLIKEIVDHYSGPDRVTAKQQQQE  430

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP  AP+SVK FTERAV SLQSNP WGF KKCQFMDKLV EVSQQYK
Sbjct  431  LERVAKTLPASAPSSVKRFTERAVLSLQSNPGWGFDKKCQFMDKLVMEVSQQYK  484



>ref|XP_006477961.1| PREDICTED: DDRGK domain-containing protein 1-like [Citrus sinensis]
Length=407

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQEEWEE + E ME R+P++KEIVDHYSGPDRVTAKQQ EE
Sbjct  295  LRDALEKMKPFLMAYEGIQSQEEWEEAVNEVME-RVPLLKEIVDHYSGPDRVTAKQQGEE  353

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA T+P+ AP S+K F  RAV SLQSNP WGF KKCQFMDKL +EVSQQYK
Sbjct  354  LERVAKTIPESAPASIKRFANRAVLSLQSNPGWGFDKKCQFMDKLAWEVSQQYK  407



>ref|XP_010054060.1| PREDICTED: homeobox protein GBX-1 [Eucalyptus grandis]
 gb|KCW78443.1| hypothetical protein EUGRSUZ_D02598 [Eucalyptus grandis]
Length=470

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLMVYEGI+SQEEWEEVMKE ME R+P++KEIVD+YSGPDRVTAK+Q EE
Sbjct  358  LRDALEKMKPFLMVYEGIQSQEEWEEVMKEVME-RVPLMKEIVDYYSGPDRVTAKKQQEE  416

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+ AP SVK FT+RAV+SLQSNP WGF KKCQFMDKLV+E SQQYK
Sbjct  417  LERVAKTLPESAPDSVKRFTDRAVRSLQSNPGWGFDKKCQFMDKLVWEASQQYK  470



>ref|XP_007014540.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY32159.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
1 [Theobroma cacao]
Length=474

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQEEWEEV+KETME R+P+++EIVD+YSGPDRVTAK+Q EE
Sbjct  362  LRDALEKMKPFLMAYEGIQSQEEWEEVIKETME-RVPLLQEIVDYYSGPDRVTAKKQQEE  420

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA T+P+RAP+SVK F  RAV SLQSNP WGF KKCQFMDKLV+EVSQQYK
Sbjct  421  LERVAKTIPERAPSSVKQFANRAVLSLQSNPGWGFDKKCQFMDKLVWEVSQQYK  474



>emb|CBI17195.3| unnamed protein product [Vitis vinifera]
Length=209

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQEEWEEVMKETME  +P +KE+VD+YSGPDRVTAK+Q EE
Sbjct  97   LRDALEKMKPFLMQYEGIQSQEEWEEVMKETME-NVPYLKELVDYYSGPDRVTAKKQQEE  155

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+ AP SVK FT+RA+ SLQSNP WGF KKCQFMDKLV+EVSQ YK
Sbjct  156  LERVAKTLPETAPNSVKRFTDRAILSLQSNPGWGFDKKCQFMDKLVWEVSQHYK  209



>gb|EYU33805.1| hypothetical protein MIMGU_mgv1a005203mg [Erythranthe guttata]
Length=493

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLMVYEGI+ QEEWE++++ETM+  +P+IKEIVDHYSGPDRVTAKQQ+EE
Sbjct  381  LRDALEKMKPFLMVYEGIKDQEEWEKIIEETMKD-VPLIKEIVDHYSGPDRVTAKQQNEE  439

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP  AP SVK FTERA+ SLQSNP WGF KKCQFMDK++ EVSQ YK
Sbjct  440  LERVAKTLPASAPASVKRFTERALLSLQSNPGWGFDKKCQFMDKVIMEVSQNYK  493



>ref|XP_010552168.1| PREDICTED: zinc finger CCCH domain-containing protein 18 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010552169.1| PREDICTED: zinc finger CCCH domain-containing protein 18 isoform 
X2 [Tarenaya hassleriana]
Length=481

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRD LEK+KPF+M YEGI+SQEEWEE + E ME R P+IKEIVDHYSGPDRVTAK+Q+EE
Sbjct  369  LRDCLEKVKPFIMSYEGIQSQEEWEEAINEVME-RAPLIKEIVDHYSGPDRVTAKKQNEE  427

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLPQ AP SVK FT+RAV +LQSNP WGF +KCQFMDKLV+EVSQQYK
Sbjct  428  LERVAKTLPQSAPDSVKRFTDRAVLTLQSNPGWGFDRKCQFMDKLVWEVSQQYK  481



>gb|KDO45643.1| hypothetical protein CISIN_1g009722mg [Citrus sinensis]
Length=527

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQEEWEE + E ME R+P++KEIVDHYSGPDRVTAKQQ EE
Sbjct  415  LRDALEKMKPFLMAYEGIQSQEEWEEAVNEVME-RVPLLKEIVDHYSGPDRVTAKQQGEE  473

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA T+P+ AP S+K F  RAV SLQSNP WGF KKCQFMDKL +EVSQ YK
Sbjct  474  LERVAKTIPESAPASIKRFANRAVLSLQSNPGWGFDKKCQFMDKLAWEVSQHYK  527



>ref|XP_007147417.1| hypothetical protein PHAVU_006G122700g [Phaseolus vulgaris]
 gb|ESW19411.1| hypothetical protein PHAVU_006G122700g [Phaseolus vulgaris]
Length=532

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQEEWEE+M+ETM  ++P++KEIVDHYSGPDRVTAK+Q EE
Sbjct  420  LRDALEKMKPFLMAYEGIQSQEEWEEIMEETMA-QVPLLKEIVDHYSGPDRVTAKKQQEE  478

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+ AP+SVK FT RAV SLQSNP WGF KKC FMDKLV+EVSQ YK
Sbjct  479  LERVAKTLPESAPSSVKQFTNRAVVSLQSNPGWGFDKKCHFMDKLVWEVSQHYK  532



>ref|XP_009616263.1| PREDICTED: la-related protein 1 [Nicotiana tomentosiformis]
Length=488

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+ QEEWE+V++ETME  +P++KEIVD+YSGPDRVTAKQQ +E
Sbjct  376  LRDALEKMKPFLMAYEGIKDQEEWEKVIEETMET-VPLMKEIVDYYSGPDRVTAKQQQQE  434

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLPQ AP SVK FTERAV SLQSNP WGF KKCQFMDK+V+EVSQ YK
Sbjct  435  LERVAKTLPQSAPNSVKRFTERAVLSLQSNPGWGFDKKCQFMDKVVWEVSQHYK  488



>ref|XP_003629502.1| hypothetical protein MTR_8g078230 [Medicago truncatula]
 gb|AET03978.1| hypothetical protein MTR_8g078230 [Medicago truncatula]
Length=502

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI SQEEWEEV++E M+ R+P++K+IVDHYSGPDRVTAK+Q EE
Sbjct  390  LRDALEKMKPFLMTYEGIRSQEEWEEVIEELMQ-RVPLLKKIVDHYSGPDRVTAKKQQEE  448

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP  AP+SVK FT RAV SLQSNP WGF KKCQFMDKLV+EVSQ +K
Sbjct  449  LERVAKTLPTSAPSSVKEFTNRAVVSLQSNPGWGFDKKCQFMDKLVFEVSQHHK  502



>ref|XP_009796159.1| PREDICTED: la-related protein 1 [Nicotiana sylvestris]
Length=485

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+ QEEWE+V++ETME  +P++KEIVD+YSGPDRVTAKQQ +E
Sbjct  373  LRDALEKMKPFLMAYEGIKDQEEWEKVIEETMET-VPLMKEIVDYYSGPDRVTAKQQQQE  431

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLPQ AP SVK FTERAV SLQSNP WGF KKCQFMDK V+EVSQ YK
Sbjct  432  LERVAKTLPQSAPNSVKRFTERAVLSLQSNPGWGFDKKCQFMDKAVWEVSQHYK  485



>ref|XP_004230134.1| PREDICTED: la-related protein 1 [Solanum lycopersicum]
Length=473

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+ QEEWEEV+KETME  +P++KEIVD+YSGPDRVTAKQQ +E
Sbjct  361  LRDALEKMKPFLMAYEGIKDQEEWEEVIKETMET-VPLMKEIVDYYSGPDRVTAKQQQQE  419

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+ AP SVK FTERAV SLQSNP WGF KKCQFMDK+V EVSQ YK
Sbjct  420  LERVAKTLPESAPNSVKRFTERAVLSLQSNPGWGFDKKCQFMDKVVMEVSQHYK  473



>ref|XP_004509236.1| PREDICTED: uncharacterized protein LOC101507965 [Cicer arietinum]
Length=504

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQEEWE +M+ETME R+P++K+IVDHYSGPDRVTAK+Q EE
Sbjct  392  LRDALEKMKPFLMNYEGIQSQEEWEAIMEETME-RVPLLKKIVDHYSGPDRVTAKKQQEE  450

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP  AP+SV  FT RAV SLQSNP WGF KKCQFMDKLV+EVSQ +K
Sbjct  451  LERVAKTLPASAPSSVVQFTNRAVMSLQSNPGWGFDKKCQFMDKLVFEVSQHHK  504



>ref|XP_010679107.1| PREDICTED: uncharacterized protein LOC104894548 [Beta vulgaris 
subsp. vulgaris]
Length=473

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ALEKMKPFLM YEGI+SQEEWEEVM+ETME  +P++KEIV+HY GPD VTAKQQHEE
Sbjct  361  LREALEKMKPFLMAYEGIQSQEEWEEVMRETME-NVPLLKEIVEHYCGPDSVTAKQQHEE  419

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP  AP+SVK FT+RAV SLQSNP WGFH+KCQFMDKL  EVS+ YK
Sbjct  420  LERVAKTLPASAPSSVKRFTDRAVLSLQSNPGWGFHRKCQFMDKLAQEVSKSYK  473



>ref|XP_007213291.1| hypothetical protein PRUPE_ppa006080mg [Prunus persica]
 gb|EMJ14490.1| hypothetical protein PRUPE_ppa006080mg [Prunus persica]
Length=428

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YE IESQEEWEEV+ ETME R+P++KEIVDHYSGPDRVTAK+Q EE
Sbjct  316  LRDALEKMKPFLMAYENIESQEEWEEVVNETME-RVPLLKEIVDHYSGPDRVTAKKQQEE  374

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP + P SVK FT+RAV SLQSNP WGF +KCQFMDKLV +VSQ Y 
Sbjct  375  LERVAKTLPAKVPDSVKRFTDRAVLSLQSNPGWGFDRKCQFMDKLVAKVSQHYN  428



>ref|XP_002274822.2| PREDICTED: coilin [Vitis vinifera]
Length=482

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQEEWEEVMKETME  +P +KE+VD+YSGPDRVTAK+Q EE
Sbjct  370  LRDALEKMKPFLMQYEGIQSQEEWEEVMKETME-NVPYLKELVDYYSGPDRVTAKKQQEE  428

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+ AP SVK FT+RA+ SLQSNP WGF KKCQFMDKLV+EVSQ YK
Sbjct  429  LERVAKTLPETAPNSVKRFTDRAILSLQSNPGWGFDKKCQFMDKLVWEVSQHYK  482



>ref|XP_006347816.1| PREDICTED: la-related protein 1-like [Solanum tuberosum]
Length=480

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+ QEEWEEV+KETME  +P++KEIVD+YSGPDRVTAKQQ +E
Sbjct  368  LRDALEKMKPFLMAYEGIKDQEEWEEVIKETMET-VPLMKEIVDYYSGPDRVTAKQQQQE  426

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+ AP SVK FTERAV SLQSNP WGF KKCQFMDK+V E SQ YK
Sbjct  427  LERVAKTLPESAPNSVKRFTERAVLSLQSNPGWGFDKKCQFMDKVVMEASQHYK  480



>ref|XP_010095949.1| hypothetical protein L484_023937 [Morus notabilis]
 gb|EXB62642.1| hypothetical protein L484_023937 [Morus notabilis]
Length=442

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEK KPFLM YE IESQEEWEE+MKETME R+P++KEIVDHYSGP+RVT K+QH+E
Sbjct  330  LRDALEKAKPFLMAYENIESQEEWEEIMKETME-RVPLLKEIVDHYSGPNRVTVKKQHQE  388

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+RV  TLP  AP SVK FTERAV SLQ+NP WGFH+KCQFMDKLV  +SQ YK
Sbjct  389  LDRVTKTLPASAPNSVKQFTERAVLSLQNNPGWGFHRKCQFMDKLVARMSQHYK  442



>ref|XP_006586863.1| PREDICTED: la-related protein 1 isoform X1 [Glycine max]
 ref|XP_006586864.1| PREDICTED: la-related protein 1 isoform X2 [Glycine max]
 gb|KHN44676.1| hypothetical protein glysoja_036542 [Glycine soja]
Length=481

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEK KPFLM YEGI+SQEEWEE+M+ETM  R+P++K+I+DHYSGPDRVTAK+Q EE
Sbjct  369  LRDALEKAKPFLMSYEGIQSQEEWEEIMEETMA-RVPLLKKIIDHYSGPDRVTAKKQQEE  427

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP   P+SVK FT RAV SLQSNP WGF KKC FMDKLV+EVSQ YK
Sbjct  428  LERVAKTLPGSVPSSVKQFTNRAVISLQSNPGWGFDKKCHFMDKLVWEVSQHYK  481



>ref|XP_004295550.1| PREDICTED: uncharacterized protein LOC101300131 [Fragaria vesca 
subsp. vesca]
Length=464

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQEEWEE +KETME R+P++K+IVDHYSGPDRVTAK+Q EE
Sbjct  352  LRDALEKMKPFLMAYEGIQSQEEWEEAIKETME-RVPLLKKIVDHYSGPDRVTAKKQREE  410

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP   P SVK FT+RAV SLQ NP WGFH+KCQFMDKL  +VS+ YK
Sbjct  411  LERVAKTLPANVPDSVKQFTDRAVLSLQGNPGWGFHRKCQFMDKLTQKVSKHYK  464



>ref|XP_009340554.1| PREDICTED: uncharacterized protein LOC103932646 [Pyrus x bretschneideri]
Length=380

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+S EEWEE +KE ME R+P++KEIVDHYSGPDRVTAK+Q +E
Sbjct  268  LRDALEKMKPFLMAYEGIQSHEEWEEAVKEVME-RVPLLKEIVDHYSGPDRVTAKKQQQE  326

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP + P SVK FT+RAV SLQSNP WGF +KCQFMDKLV +VS+ YK
Sbjct  327  LERVAKTLPAKVPESVKRFTDRAVLSLQSNPGWGFDRKCQFMDKLVEKVSKHYK  380



>emb|CDP13552.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQ+EWEE ++ETM+ ++P++KEIVD+YSGPDRVTAKQQ EE
Sbjct  387  LRDALEKMKPFLMAYEGIQSQQEWEEAVEETMK-KVPLLKEIVDYYSGPDRVTAKQQQEE  445

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            + RVA  LP+  P SVK FT RAV SLQSNP WGF KKCQFMDKLV E+SQ YK
Sbjct  446  IERVAKALPESVPASVKRFTNRAVLSLQSNPGWGFDKKCQFMDKLVSEISQHYK  499



>gb|KJB83335.1| hypothetical protein B456_013G241700 [Gossypium raimondii]
Length=484

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEK+KPFLM YEGIE+QEEWEE +KETM+ ++P+++EI+D+YSGPDRVTAK+Q EE
Sbjct  372  LRDALEKVKPFLMSYEGIENQEEWEEAIKETMD-KVPLLQEIIDYYSGPDRVTAKKQQEE  430

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA T+P+ AP SVK F  RAV +LQSNP WGF KKCQFMDKLV+EVSQQYK
Sbjct  431  LERVAKTIPKSAPASVKQFANRAVLTLQSNPGWGFDKKCQFMDKLVWEVSQQYK  484



>ref|XP_008225991.1| PREDICTED: la-related protein 1 [Prunus mume]
Length=460

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YE I+SQEEWEEV+ ETME R+P++KEIVDHYSGPDRVTAK+Q EE
Sbjct  348  LRDALEKMKPFLMAYENIQSQEEWEEVVNETME-RVPLLKEIVDHYSGPDRVTAKKQQEE  406

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQY  351
            L RVA TLP + P SVK FT+RAV SLQSNP WGF +KCQFMDKLV +VSQ Y
Sbjct  407  LERVAKTLPAKVPDSVKRFTDRAVLSLQSNPGWGFDRKCQFMDKLVAKVSQHY  459



>ref|XP_009340130.1| PREDICTED: collagen alpha-1(III) chain-like [Pyrus x bretschneideri]
Length=521

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+S EEWEE +KE ME R+P++KEIVDHYSGPDRVTAK+Q EE
Sbjct  409  LRDALEKMKPFLMAYEGIQSHEEWEEAVKEVME-RVPLLKEIVDHYSGPDRVTAKKQQEE  467

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP + P SVK FT+RAV SLQSNP WGF +KCQFMDKLV +VS+ YK
Sbjct  468  LERVAKTLPTKVPESVKRFTDRAVLSLQSNPGWGFDRKCQFMDKLVEKVSKHYK  521



>ref|XP_010274926.1| PREDICTED: pro-resilin [Nelumbo nucifera]
Length=482

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEK+KPFLM YEGI+SQEEWEE+MKETME +LP +KE++D YSGPDRVT KQQ +E
Sbjct  370  LRDALEKVKPFLMAYEGIQSQEEWEEIMKETME-KLPYMKELIDIYSGPDRVTGKQQQQE  428

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+  P+SVK FT+RAV SLQSNP WGF KKCQFMDKLV+EVSQ YK
Sbjct  429  LERVAKTLPENVPSSVKCFTDRAVLSLQSNPGWGFDKKCQFMDKLVWEVSQHYK  482



>ref|XP_009363324.1| PREDICTED: histone-lysine N-methyltransferase 2B-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009363325.1| PREDICTED: histone-lysine N-methyltransferase 2B-like isoform 
X2 [Pyrus x bretschneideri]
Length=470

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+S EEWEE ++E ME  +P++KEIVDHYSGPDRVTAK+Q EE
Sbjct  358  LRDALEKMKPFLMAYEGIQSPEEWEEAVEEVMER-VPLLKEIVDHYSGPDRVTAKKQQEE  416

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP + P SVK FT+RAV SLQSNP WGF +KCQFMDKLV +VS+ YK
Sbjct  417  LERVAKTLPAKVPESVKRFTDRAVLSLQSNPGWGFDRKCQFMDKLVDKVSKHYK  470



>gb|KHG06267.1| FYVE, RhoGEF and PH domain-containing 2 [Gossypium arboreum]
Length=486

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEK+KPFLM YEGIE+QEEWEE +KETM+ ++P+++EI+D+YSGPDRVTAK+Q EE
Sbjct  374  LRDALEKVKPFLMSYEGIENQEEWEEAIKETMD-KVPLLQEIIDYYSGPDRVTAKKQQEE  432

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA T+P+  P SVK F  RAV +LQSNP WGF KKCQFMDKLV EVSQQYK
Sbjct  433  LERVAKTIPKSVPASVKQFANRAVLTLQSNPGWGFDKKCQFMDKLVCEVSQQYK  486



>gb|KHN14280.1| hypothetical protein glysoja_012318 [Glycine soja]
Length=278

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 85/114 (75%), Gaps = 16/114 (14%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEK KPFLM YEGI+SQEEW                EIVDHYSGPDRVTAK+Q EE
Sbjct  181  LRDALEKAKPFLMSYEGIQSQEEW----------------EIVDHYSGPDRVTAKKQQEE  224

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+RVA  LP+ AP+SVK FT R+V SLQSNP WGF KKC FMDKLV+EVSQ YK
Sbjct  225  LDRVAKILPESAPSSVKQFTNRSVISLQSNPGWGFDKKCHFMDKLVWEVSQHYK  278



>ref|XP_002523666.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38701.1| conserved hypothetical protein [Ricinus communis]
Length=436

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRD LEK+KPF+M YEGI+SQEEWE  ++ETM+  +P+ KEIVD+YSGPDR+TAK+Q EE
Sbjct  324  LRDVLEKVKPFIMAYEGIQSQEEWEAAVEETMK-NVPLFKEIVDYYSGPDRITAKKQEEE  382

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA T+P  AP SVK F +RAV SLQSNP WGF KKCQFMDKLV EV+Q Y 
Sbjct  383  LERVANTIPASAPASVKRFADRAVLSLQSNPGWGFDKKCQFMDKLVREVNQCYN  436



>ref|XP_008451827.1| PREDICTED: uncharacterized protein LOC103492997 [Cucumis melo]
Length=475

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDA EKMKPFLM YE I+S EEWEE+++ETM+  +P++KEIVD YSGPDRVTAK+Q  E
Sbjct  363  LRDAFEKMKPFLMAYENIQSHEEWEEIVEETMQS-VPLMKEIVDAYSGPDRVTAKEQQGE  421

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLPQ AP SVK FT RAV SLQSNP WGF KKCQFMDKLV   SQ+YK
Sbjct  422  LERVAKTLPQSAPNSVKQFTNRAVLSLQSNPGWGFDKKCQFMDKLVGGFSQRYK  475



>ref|XP_010914286.1| PREDICTED: one cut domain family member 3 [Elaeis guineensis]
Length=472

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEK KPFLM YEGI+SQEEWEE ++ETME ++P + E+++ YSGPD VTAKQQ +E
Sbjct  360  LRDALEKAKPFLMAYEGIKSQEEWEEAVQETME-KVPYLNELIEMYSGPDTVTAKQQQQE  418

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+  P+SVK FT+RAV +LQSNP WG+ KKCQFMDKLV+EVSQ YK
Sbjct  419  LERVAKTLPENIPSSVKRFTDRAVLTLQSNPGWGWDKKCQFMDKLVWEVSQHYK  472



>gb|KDP42449.1| hypothetical protein JCGZ_00246 [Jatropha curcas]
Length=485

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRD LEK+KPF+M Y+GI+SQEEWEEV++ETM+  +P++KEIVD+YSGPDRVTAK+Q EE
Sbjct  373  LRDVLEKVKPFIMAYDGIQSQEEWEEVVEETMK-NVPLLKEIVDYYSGPDRVTAKKQQEE  431

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA T+P  AP SVK F +RAV SLQSNP WGF +KCQFMDKL  EV+Q Y 
Sbjct  432  LERVAKTIPASAPASVKRFADRAVLSLQSNPGWGFDRKCQFMDKLAREVNQCYN  485



>ref|XP_008371966.1| PREDICTED: uncharacterized protein LOC103435355 [Malus domestica]
Length=470

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR AL KMKPFLM YEGI+S EEWEE ++E ME R+P++KEIVDHYSGPDRVTAK+Q EE
Sbjct  358  LRXALXKMKPFLMAYEGIQSHEEWEEAVEEVME-RVPLLKEIVDHYSGPDRVTAKKQQEE  416

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP + P SVK FT+RAV SLQSNP WGF +KCQFMDKLV +VS+  K
Sbjct  417  LERVAKTLPAKVPESVKQFTDRAVLSLQSNPGWGFDRKCQFMDKLVDKVSKHXK  470



>ref|XP_009417699.1| PREDICTED: uncharacterized protein LOC103998046 [Musa acuminata 
subsp. malaccensis]
Length=449

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L +ALEK KPFLM YEGI+SQEEWEE +KE ME +LP +KE++D Y GPDRVTAKQQ +E
Sbjct  337  LLEALEKAKPFLMAYEGIQSQEEWEEAVKEIME-KLPYMKELMDVYCGPDRVTAKQQQQE  395

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+ A +SVK FTERA+ SLQSNP WGF KKCQFM+KLV+EVSQ YK
Sbjct  396  LERVAKTLPENAASSVKRFTERALLSLQSNPGWGFDKKCQFMNKLVWEVSQYYK  449



>ref|XP_006392774.1| hypothetical protein EUTSA_v10012156mg [Eutrema salsugineum]
 gb|ESQ30060.1| hypothetical protein EUTSA_v10012156mg [Eutrema salsugineum]
Length=106

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = -3

Query  668  MKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEELNRVAAT  489
            MKPF++ YEGI+ QEEWEE + E M  + P+IKEIVDHYSGPDRVTAK+Q+EEL+R+A T
Sbjct  1    MKPFIVAYEGIKDQEEWEEAIDEVMA-QAPLIKEIVDHYSGPDRVTAKKQNEELDRIATT  59

Query  488  LPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            +P+ AP SVK F +RA  SL+SNP WGF KK QFM+KLV EVSQ YK
Sbjct  60   VPKSAPDSVKRFADRAALSLKSNPGWGFDKKYQFMEKLVAEVSQSYK  106



>ref|XP_006392772.1| hypothetical protein EUTSA_v10011382mg [Eutrema salsugineum]
 gb|ESQ30058.1| hypothetical protein EUTSA_v10011382mg [Eutrema salsugineum]
Length=531

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++ YEGI+ QEEWEE + E M  + P+IKEIVDHYSGPDRVTAK+Q+EE
Sbjct  419  LRECLEKVKPFIVAYEGIKDQEEWEEAIDEVMA-QAPLIKEIVDHYSGPDRVTAKKQNEE  477

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A T+P+ AP SVK F +RA  SL+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  478  LDRIATTVPKSAPDSVKRFADRAALSLKSNPGWGFDKKYQFMDKLVAEVSQSYK  531



>ref|XP_006307233.1| hypothetical protein CARUB_v10008838mg [Capsella rubella]
 gb|EOA40131.1| hypothetical protein CARUB_v10008838mg [Capsella rubella]
Length=525

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++ YEGI+ QEEWEE + E M  + P++KEIVDHYSGPDRVTAK+Q+EE
Sbjct  413  LRECLEKVKPFIVAYEGIKDQEEWEEAINEAMA-QAPLMKEIVDHYSGPDRVTAKKQNEE  471

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A TLP+ AP SVK F +RA  +L+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  472  LDRIATTLPKSAPDSVKRFADRAALTLKSNPGWGFDKKYQFMDKLVLEVSQSYK  525



>ref|NP_564639.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
 gb|AAG51990.1|AC024260_28 unknown protein; 43598-45751 [Arabidopsis thaliana]
 gb|AAL15304.1| At1g53640/F22G10.8 [Arabidopsis thaliana]
 gb|AAN28868.1| At1g53640/F22G10.8 [Arabidopsis thaliana]
 dbj|BAF02054.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32975.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis 
thaliana]
Length=523

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++ YEGI+ QEEWEE + E M  + P++KEIVDHYSGPDRVTAK+Q+EE
Sbjct  411  LRECLEKVKPFIVAYEGIKDQEEWEEAINEAMT-QAPLMKEIVDHYSGPDRVTAKKQNEE  469

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A TLP  AP SVK F +RA  +L+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  470  LDRIATTLPASAPDSVKRFADRAALTLKSNPGWGFDKKYQFMDKLVLEVSQSYK  523



>gb|AAM65660.1| Contains similarity to RNA-binding protein from Arabidopsis thaliana 
gi|2129727 and contains RNA recognition PF|00076 domain 
[Arabidopsis thaliana]
Length=523

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++ YEGI+ QEEWEE + E M  + P++KEIVDHYSGPDRVTAK+Q+EE
Sbjct  411  LRECLEKVKPFIVAYEGIKDQEEWEEAINEAMT-QAPLMKEIVDHYSGPDRVTAKKQNEE  469

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A TLP  AP SVK F +RA  +L+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  470  LDRIATTLPASAPDSVKRFADRAALTLKSNPGWGFDKKYQFMDKLVLEVSQSYK  523



>ref|XP_010479938.1| PREDICTED: histone-lysine N-methyltransferase 2B-like [Camelina 
sativa]
Length=514

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++ YEGI+ QEEWEE + E M  + P++KEIVDHYSGPDRVTAK+Q+EE
Sbjct  402  LRECLEKVKPFIVAYEGIKDQEEWEEAINEAMA-QAPLMKEIVDHYSGPDRVTAKKQNEE  460

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A T+P+ AP SVK F +RA  +L+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  461  LDRIATTIPKSAPDSVKRFADRAALTLKSNPGWGFDKKYQFMDKLVLEVSQSYK  514



>ref|XP_010462262.1| PREDICTED: serine/threonine-protein kinase LMTK3-like [Camelina 
sativa]
Length=513

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++ YEGI+ QEEWEE + E M  + P++KEIVDHYSGPDRVTAK+Q+EE
Sbjct  401  LRECLEKVKPFIVAYEGIKDQEEWEEAINEAMA-QAPLMKEIVDHYSGPDRVTAKKQNEE  459

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A T+P+ AP SVK F +RA  +L+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  460  LDRIATTIPKSAPDSVKRFADRAALTLKSNPGWGFDKKYQFMDKLVLEVSQSYK  513



>ref|XP_010501021.1| PREDICTED: uncharacterized protein LOC104778302 [Camelina sativa]
Length=519

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++ YEGI+ QEEWEE + E M  + P++KEIVDHYSGPDRVTAK+Q+EE
Sbjct  407  LRECLEKVKPFIVAYEGIKDQEEWEEAINEAMA-QAPLMKEIVDHYSGPDRVTAKKQNEE  465

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A T+P+ AP SVK F +RA  +L+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  466  LDRIATTIPKSAPDSVKRFADRAALTLKSNPGWGFDKKYQFMDKLVLEVSQSYK  519



>gb|EPS65553.1| hypothetical protein M569_09226 [Genlisea aurea]
Length=426

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+A EKMKPFLM + GIE+QEEWE++++ETME  +P  K+I+DHY+GPDRVTA QQ  E
Sbjct  314  LREAFEKMKPFLMQHIGIETQEEWEQIIEETMES-VPRWKKIIDHYAGPDRVTALQQIGE  372

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP  AP SVK FTERAV SL+SNP WGF KKCQFMDK+V EVSQQYK
Sbjct  373  LERVAGTLPATAPASVKRFTERAVLSLKSNPGWGFKKKCQFMDKVVMEVSQQYK  426



>emb|CDY68781.1| BnaC06g41920D, partial [Brassica napus]
Length=307

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRD LEK+KPF++  EGI+   E  E        + P++K+IVDHYSGPDRVTAK Q+EE
Sbjct  195  LRDCLEKVKPFIVALEGIKD-LEESEEAINEAMKQAPLMKDIVDHYSGPDRVTAKTQNEE  253

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A T+PQ AP SVK F +RA  SL+SNP WG+ KK QFMDKLV E SQ YK
Sbjct  254  LDRIATTVPQSAPDSVKRFADRAALSLKSNPGWGYDKKYQFMDKLVLEASQSYK  307



>ref|XP_011041628.1| PREDICTED: uncharacterized protein LOC105137544 [Populus euphratica]
Length=470

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEK+KPF+M Y GI++ EEWEE+++ETM+   P++K+IVD YSGPDRV+ K+Q EE
Sbjct  358  LRDALEKVKPFMMAYMGIKTHEEWEEIVEETMKD-APLMKKIVDSYSGPDRVSGKKQKEE  416

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA T+P  AP SVK F +RAV SLQSNP WGF KKC FMDKL  EVSQ YK
Sbjct  417  LERVAKTIPASAPDSVKSFADRAVLSLQSNPGWGFDKKCTFMDKLAKEVSQHYK  470



>ref|XP_002321880.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEF06007.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=466

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEK+KPF+M Y GI++ EEWEE+++ETM+   P++K+IVD YSGPDRV+ K+Q EE
Sbjct  354  LRDALEKVKPFMMAYMGIKTHEEWEEIVEETMKD-APLMKKIVDSYSGPDRVSGKKQKEE  412

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA T+P  AP SVK F +RAV SLQSNP WGF KKC FMDKL  EVSQ YK
Sbjct  413  LERVAKTIPASAPDSVKSFADRAVLSLQSNPGWGFDKKCMFMDKLAKEVSQHYK  466



>ref|XP_006656343.1| PREDICTED: uncharacterized protein LOC102703042 [Oryza brachyantha]
Length=273

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L D L+K+KPF++ YEGI++QEEWEE +K+ M  R P +KE++D YSGPD VTAKQQ EE
Sbjct  161  LEDMLQKVKPFVVAYEGIQNQEEWEEAVKDVMA-RAPHMKELIDMYSGPDVVTAKQQEEE  219

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLPQ  P+SVK FT++ + SL++NP WGF KKCQFMDK V EVS+QYK
Sbjct  220  LQRVANTLPQNIPSSVKRFTDKTLLSLKNNPGWGFDKKCQFMDKFVREVSEQYK  273



>ref|XP_008812566.1| PREDICTED: one cut domain family member 3 [Phoenix dactylifera]
Length=465

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRD+LEK KPFLM YEGI+SQEEWEE ++ETME ++P + E+++ Y+GPD VTAKQQ +E
Sbjct  353  LRDSLEKAKPFLMAYEGIKSQEEWEEAVQETME-KVPYLNELIEMYAGPDTVTAKQQQQE  411

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+  P+SVK F + AV +LQSNP WG+ KKCQFMDKLV+EVSQ Y+
Sbjct  412  LERVAKTLPENTPSSVKRFADSAVLTLQSNPGWGWDKKCQFMDKLVWEVSQHYQ  465



>ref|XP_004147751.1| PREDICTED: uncharacterized protein LOC101215545 [Cucumis sativus]
 ref|XP_004161555.1| PREDICTED: uncharacterized protein LOC101224016 [Cucumis sativus]
 gb|KGN53518.1| hypothetical protein Csa_4G064010 [Cucumis sativus]
Length=478

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YE I+S EEWEE+++ETM+  +P++KEIVD Y GPDRVTAK+Q  E
Sbjct  366  LRDALEKMKPFLMAYENIQSHEEWEEIVEETMQS-VPLLKEIVDAYGGPDRVTAKEQQGE  424

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLPQ AP SVK FT R V SLQSNP WGF KK Q MDKLV   S++YK
Sbjct  425  LERVAKTLPQSAPNSVKQFTNRVVLSLQSNPGWGFDKKWQLMDKLVEGFSKRYK  478



>gb|KFK35706.1| hypothetical protein AALP_AA4G026200 [Arabis alpina]
Length=474

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ +EK+KPF++ YEGI+ QEEWEE +KE ME + P++KEIVDHYSGPDRVTAK+Q+EE
Sbjct  362  LRECIEKVKPFIVAYEGIKDQEEWEEAVKEVME-QAPLLKEIVDHYSGPDRVTAKKQNEE  420

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A T+P+ AP SVK F +R   SL+SNP WGF KK +FMDK+V EVSQ YK
Sbjct  421  LDRIATTIPKSAPDSVKRFADRVALSLKSNPGWGFDKKYKFMDKVVMEVSQSYK  474



>ref|XP_002894457.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70716.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=769

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++ YEGI+ QEEWEE + E M  + P++KEIVDHYSGPDRVTAK+Q+EE
Sbjct  657  LRECLEKVKPFIVAYEGIKDQEEWEEAVNEAMA-QAPLMKEIVDHYSGPDRVTAKKQNEE  715

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+ +A T+P  AP SVK F +RA  +L+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  716  LDSIATTIPASAPDSVKRFADRAALTLKSNPGWGFDKKYQFMDKLVLEVSQSYK  769



>ref|XP_009144805.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103868468 
[Brassica rapa]
Length=204

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRD LEK+KPF++  EGI+ QEEW+E + E M+ + P++K+IVDHYSGPDRVTAK Q+EE
Sbjct  92   LRDCLEKVKPFIVAXEGIKDQEEWQEAIDEAMK-QAPLMKDIVDHYSGPDRVTAKTQNEE  150

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+  TLPQ AP SVK F +R   SL+SNP W + KK QFMDKLV E SQ YK
Sbjct  151  LDRITTTLPQSAPDSVKRFADRVALSLKSNPEWRYDKKYQFMDKLVLEASQSYK  204



>gb|AAF78422.1|AC018748_1 Contains similarity to RNA-binding protein from Arabidopsis thaliana 
gi|2129727 and contains RNA recognition PF|00076 domain. 
ESTs gb|H37317, gb|F14415, gb|AA651290 come from this gene 
[Arabidopsis thaliana]
Length=829

 Score =   139 bits (350),  Expect = 8e-34, Method: Composition-based stats.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++ YEGI+ QEEWEE + E M  + P++KEIVDHYSGPDRVTAK+Q+EE
Sbjct  717  LRECLEKVKPFIVAYEGIKDQEEWEEAINEAMT-QAPLMKEIVDHYSGPDRVTAKKQNEE  775

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A TLP  AP SVK F +RA  +L+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  776  LDRIATTLPASAPDSVKRFADRAALTLKSNPGWGFDKKYQFMDKLVLEVSQSYK  829



>emb|CDY24082.1| BnaA06g00800D [Brassica napus]
Length=498

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++  EGI+ QEEWEE ++E M    P +K+IVDHYSGPDRVTAK+Q+EE
Sbjct  386  LRECLEKVKPFIVALEGIKDQEEWEEAIEEVMA-EAPRMKQIVDHYSGPDRVTAKKQNEE  444

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A TLPQ AP SVK F +R   SL+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  445  LDRIATTLPQSAPDSVKRFADRVALSLKSNPGWGFDKKYQFMDKLVLEVSQNYK  498



>ref|XP_009123972.1| PREDICTED: uncharacterized protein LOC103848902 [Brassica rapa]
Length=512

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++  EGI+ QEEWEE ++E M    P +K+IVDHYSGPDRVTAK+Q+EE
Sbjct  400  LRECLEKVKPFIVALEGIKDQEEWEEAIEEVMA-EAPRMKQIVDHYSGPDRVTAKKQNEE  458

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A TLPQ AP SVK F +R   SL+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  459  LDRIATTLPQSAPDSVKRFADRVALSLKSNPGWGFDKKYQFMDKLVLEVSQNYK  512



>emb|CDY45126.1| BnaC06g06470D [Brassica napus]
Length=772

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LR+ LEK+KPF++  EGI+ QEEWEE + E M    P +KEIVDHYSGPDRVTAK+Q+EE
Sbjct  660  LRECLEKVKPFIVALEGIKDQEEWEEAIGEAMA-EAPRMKEIVDHYSGPDRVTAKKQNEE  718

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L+R+A T+PQ AP SVK F +R   SL+SNP WGF KK QFMDKLV EVSQ YK
Sbjct  719  LDRIATTVPQSAPDSVKRFADRVALSLKSNPGWGFDKKYQFMDKLVLEVSQNYK  772



>gb|EAZ41082.1| hypothetical protein OsJ_25572 [Oryza sativa Japonica Group]
Length=195

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L D L+K+KPF++ YEGI++QEEWEE +K+ M  R P +KE++D YSGPD VTAKQQ EE
Sbjct  83   LEDMLQKVKPFIVAYEGIQNQEEWEEAVKDVMA-RAPHMKELIDMYSGPDVVTAKQQEEE  141

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP   P+SVK FT++ + SL++NP WGF KKCQFMDK   EVS+ YK
Sbjct  142  LQRVANTLPGNIPSSVKRFTDKTLLSLKNNPGWGFDKKCQFMDKFAREVSELYK  195



>ref|NP_001136771.1| uncharacterized protein LOC100216913 [Zea mays]
 gb|ACF82583.1| unknown [Zea mays]
Length=169

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L + L+K+KPF++ YEGI++QEEWEE +K+ M  R P +KE++D YSGPD VTAKQQ EE
Sbjct  57   LEEMLQKVKPFVVAYEGIQNQEEWEEAVKDVMA-RAPHMKELIDMYSGPDVVTAKQQEEE  115

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+  P+SVK FT++ + SL++NP WGF KKCQFMDK    VS+QYK
Sbjct  116  LQRVANTLPESIPSSVKRFTDKTLLSLKNNPGWGFDKKCQFMDKYARIVSEQYK  169



>gb|EAZ01989.1| hypothetical protein OsI_24021 [Oryza sativa Indica Group]
Length=285

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L D L+K+KPF++ YEGI++QEEWEE +K+ M  R P +KE++D YSGPD VTAKQQ EE
Sbjct  173  LEDMLQKVKPFIVAYEGIQNQEEWEEAVKDVMA-RAPHMKELIDMYSGPDVVTAKQQEEE  231

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP   P+SVK FT + + SL++NP WGF KKCQFMDK   EVS+ YK
Sbjct  232  LQRVANTLPGNIPSSVKRFTNKTLLSLKNNPGWGFDKKCQFMDKFAREVSELYK  285



>ref|XP_003563360.1| PREDICTED: formin-like protein 3 [Brachypodium distachyon]
 ref|XP_010240366.1| PREDICTED: formin-like protein 3 [Brachypodium distachyon]
 ref|XP_010240368.1| PREDICTED: formin-like protein 3 [Brachypodium distachyon]
 ref|XP_010240370.1| PREDICTED: formin-like protein 3 [Brachypodium distachyon]
Length=438

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L + L+K+KPF++ YEGI++QEEWEE +K+ ME R P +KE++D YSGPD V AKQQ EE
Sbjct  326  LEEMLQKVKPFIIAYEGIKNQEEWEEAVKDVME-RAPHMKELIDMYSGPDVVAAKQQEEE  384

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+  P+SVK FT++ + SL++NP WGF KKCQFMDK V EVS+QYK
Sbjct  385  LQRVANTLPESIPSSVKRFTDKTLLSLKNNPGWGFDKKCQFMDKFVREVSEQYK  438



>ref|NP_001174943.1| Os06g0664400 [Oryza sativa Japonica Group]
 dbj|BAD45380.1| hydroxyproline-rich glycoprotein-like [Oryza sativa Japonica 
Group]
 dbj|BAH93671.1| Os06g0664400 [Oryza sativa Japonica Group]
Length=436

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L D L+K+KPF++ YEGI++QEEWEE +K+ M  R P +KE++D YSGPD VTAKQQ EE
Sbjct  324  LEDMLQKVKPFIVAYEGIQNQEEWEEAVKDVMA-RAPHMKELIDMYSGPDVVTAKQQEEE  382

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP   P+SVK FT++ + SL++NP WGF KKCQFMDK   EVS+ YK
Sbjct  383  LQRVANTLPGNIPSSVKRFTDKTLLSLKNNPGWGFDKKCQFMDKFAREVSELYK  436



>ref|XP_004965630.1| PREDICTED: CCAAT/enhancer-binding protein alpha-like [Setaria 
italica]
Length=457

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L + L+K+KPF++ YEGI++QEEWEE +K+ M  R P +KE++D YSGPD VTAKQQ EE
Sbjct  345  LEEMLQKVKPFIVAYEGIQNQEEWEEAVKDVMA-RAPHMKELIDMYSGPDVVTAKQQEEE  403

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+  P+SVK FT++ + SL++NP WGF KKCQFMDK    VS+QYK
Sbjct  404  LQRVANTLPENIPSSVKRFTDKTLLSLKNNPGWGFDKKCQFMDKFTRIVSEQYK  457



>ref|XP_008665440.1| PREDICTED: uncharacterized protein LOC100216913 isoform X1 [Zea 
mays]
 tpg|DAA51855.1| TPA: hypothetical protein ZEAMMB73_029894 [Zea mays]
Length=455

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L + L+K+KPF++ YEGI++QEEWEE +K+ M  R P +KE++D YSGPD VTAKQQ EE
Sbjct  343  LEEMLQKVKPFVVAYEGIQNQEEWEEAVKDVMA-RAPHMKELIDMYSGPDVVTAKQQEEE  401

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+  P+SVK FT++ + SL++NP WGF KKCQFMDK    VS+QYK
Sbjct  402  LQRVANTLPESIPSSVKRFTDKTLLSLKNNPGWGFDKKCQFMDKYARIVSEQYK  455



>emb|CDY25835.1| BnaA05g14260D [Brassica napus]
Length=158

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  581  PIIKEIVDHYSGPDRVTAKQQHEELNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFH  402
            P++K+IVDHYSGPDRVTAK Q+EEL+R+A T+PQ AP SVK F +R   SL+SNP WG+ 
Sbjct  81   PLMKDIVDHYSGPDRVTAKTQNEELDRIATTVPQSAPDSVKRFADRVALSLKSNPGWGYD  140

Query  401  KKCQFMDKLVYEVSQQYK  348
            KK QFMDKLV E SQ YK
Sbjct  141  KKYQFMDKLVLEASQSYK  158



>ref|XP_002466313.1| hypothetical protein SORBIDRAFT_01g005470 [Sorghum bicolor]
 gb|EER93311.1| hypothetical protein SORBIDRAFT_01g005470 [Sorghum bicolor]
Length=458

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L + L+K+KPF++ +EGI++QEEWEE +K+ M  R P +KE++D  SGPD VTAKQQ EE
Sbjct  346  LEEMLQKVKPFIVAFEGIQNQEEWEESVKDVMA-RAPHMKELIDMCSGPDVVTAKQQEEE  404

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQYK  348
            L RVA TLP+  P+SVK FT++ + SL++NP WGF KKCQFMDK    VS+QYK
Sbjct  405  LQRVANTLPESIPSSVKRFTDKTLLSLKNNPGWGFDKKCQFMDKFTRIVSEQYK  458



>gb|EMT30553.1| hypothetical protein F775_52530 [Aegilops tauschii]
Length=353

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 81/122 (66%), Gaps = 8/122 (7%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeV--------RLPIIKEIVDHYSGPDRV  534
            L + L+K+KPF++ YEGI+ QEEWE                 R P +KE++D YSGPD V
Sbjct  232  LEEMLQKVKPFIVAYEGIQDQEEWESPNTSECARDAVKDIMLRAPHMKELIDMYSGPDVV  291

Query  533  TAKQQHEELNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVSQQ  354
            TA QQ  EL RVA TLP+  P SVK  T++ + SL++NP WGF KKCQFMDK V EVS+Q
Sbjct  292  TAIQQEGELQRVANTLPENIPNSVKRCTDKTLLSLKNNPGWGFDKKCQFMDKFVREVSEQ  351

Query  353  YK  348
            YK
Sbjct  352  YK  353



>emb|CDY72278.1| BnaAnng40500D [Brassica napus]
Length=158

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -3

Query  581  PIIKEIVDHYSGPDRVTAKQQHEELNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFH  402
            P++K+IVDHYSGPDRVTAK Q+EEL+ +  TLPQ AP SVK F +R   SL+SNP WG+ 
Sbjct  81   PLMKDIVDHYSGPDRVTAKTQNEELDGITTTLPQSAPDSVKRFADRVALSLKSNPGWGYD  140

Query  401  KKCQFMDKLVYEVSQQYK  348
            KK QFMDKLV E SQ YK
Sbjct  141  KKYQFMDKLVLEASQSYK  158



>ref|XP_007146827.1| hypothetical protein PHAVU_006G0732001g, partial [Phaseolus vulgaris]
 gb|ESW18821.1| hypothetical protein PHAVU_006G0732001g, partial [Phaseolus vulgaris]
Length=471

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQEEWEE+M+ETM  R+P++K+IVDHYSGPDRVTAK+Q EE
Sbjct  385  LRDALEKMKPFLMAYEGIQSQEEWEEIMEETMA-RVPLLKKIVDHYSGPDRVTAKKQQEE  443

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQ  426
            L RVA TLP+ AP+SVK FT RAV SLQ
Sbjct  444  LERVAKTLPESAPSSVKQFTNRAVVSLQ  471



>ref|XP_006583470.1| PREDICTED: uncharacterized protein LOC100786394 isoform X1 [Glycine 
max]
Length=121

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEK KPFLM YEGI+SQE WE+ M+ETM  R+P++K+IVDHYSGPDRVT K++ EE
Sbjct  29   LRDALEKAKPFLMSYEGIQSQEVWEKTMEETMA-RVPLLKKIVDHYSGPDRVTTKKRQEE  87

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQ  426
            L+RVA TLP+ AP+SV+ FT R+V SLQ
Sbjct  88   LDRVAKTLPESAPSSVEQFTNRSVISLQ  115



>ref|XP_006442253.1| hypothetical protein CICLE_v10019766mg [Citrus clementina]
 gb|ESR55493.1| hypothetical protein CICLE_v10019766mg [Citrus clementina]
Length=511

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            LRDALEKMKPFLM YEGI+SQ+EWEE + E ME R+P++KEIVDHYSGPDRVTAKQQ EE
Sbjct  414  LRDALEKMKPFLMAYEGIQSQKEWEEAVNEVME-RVPLLKEIVDHYSGPDRVTAKQQGEE  472

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQ  426
            L RVA T+P+ AP S+K F   AV SLQ
Sbjct  473  LERVAKTIPESAPASIKRFANHAVLSLQ  500



>ref|XP_006837366.1| hypothetical protein AMTR_s00111p00111440 [Amborella trichopoda]
 gb|ERN00220.1| hypothetical protein AMTR_s00111p00111440 [Amborella trichopoda]
Length=447

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L DALEK+KPF+M YEGI++QEEWEEV+KETM+ ++P +KE+VD YSGPDRVTA+QQ +E
Sbjct  355  LCDALEKIKPFIMTYEGIQNQEEWEEVVKETMD-KVPYLKELVDIYSGPDRVTARQQQQE  413

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQS  423
            L RVA+TLP+  P+SVK FT RAV SLQ 
Sbjct  414  LERVASTLPENVPSSVKNFTNRAVLSLQC  442



>gb|KHN45261.1| ATP-dependent RNA helicase DOB1 [Glycine soja]
Length=182

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDR  537
            LRDALEK KPFLM YEGI+SQ E  E   E    R+P++K+IVDHYSGPDR
Sbjct  75   LRDALEKAKPFLMSYEGIQSQ-EVWEKTMEETMARVPLLKKIVDHYSGPDR  124



>ref|XP_001772840.1| predicted protein [Physcomitrella patens]
 gb|EDQ62407.1| predicted protein [Physcomitrella patens]
Length=855

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 60/110 (55%), Gaps = 3/110 (3%)
 Frame = -3

Query  689  LRDALEKMKPFLMVYEGIESQeeweevmketmeVRLPIIKEIVDHYSGPDRVTAKQQHEE  510
            L + L   KP+LM+    E Q + E         + P ++ +V+ Y+GPDR+TA++Q+  
Sbjct  747  LEEILADAKPYLMIDGMTEEQWQGEVQDVMA---KAPHLENLVNLYAGPDRLTAREQNSR  803

Query  509  LNRVAATLPQRAPTSVKLFTERAVQSLQSNPSWGFHKKCQFMDKLVYEVS  360
            L  VA T+P      ++ F  +A+ +LQSNP     +K + M+K V  +S
Sbjct  804  LQAVAETMPAHVGPEIQDFMSQALLTLQSNPGIRMREKERLMNKFVSGLS  853



>ref|XP_002438807.1| hypothetical protein SORBIDRAFT_10g026546 [Sorghum bicolor]
 gb|EER90174.1| hypothetical protein SORBIDRAFT_10g026546 [Sorghum bicolor]
Length=64

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  587  RLPIIKEIVDHYSGPDRVTAKQQHEELNRVAATLPQRAPTSVKLFTER  444
            R P +K ++D Y  PD VTAKQQ EEL R ++T P+  P+SVK FT++
Sbjct  12   RAPHMKLLIDMYREPDVVTAKQQEEELQRGSSTFPESIPSSVKWFTDK  59



>ref|XP_007146828.1| hypothetical protein PHAVU_006G0732000g, partial [Phaseolus vulgaris]
 gb|ESW18822.1| hypothetical protein PHAVU_006G0732000g, partial [Phaseolus vulgaris]
Length=26

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  425  SNPSWGFHKKCQFMDKLVYEVSQQYK  348
            SNP WGF KKC FMDKLV EVSQ YK
Sbjct  1    SNPGWGFDKKCHFMDKLVGEVSQHYK  26



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520