BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021O13

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010046453.1|  PREDICTED: aconitate hydratase, cytoplasmic        200   7e-62   
ref|XP_007132547.1|  hypothetical protein PHAVU_011G1037000g            196   3e-60   Phaseolus vulgaris [French bean]
dbj|BAD94991.1|  cytoplasmic aconitate hydratase                        201   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        209   4e-59   Cucumis melo [Oriental melon]
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        209   5e-59   Solanum lycopersicum
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    209   5e-59   Solanum tuberosum [potatoes]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        208   8e-59   Nicotiana tomentosiformis
gb|AFW61053.1|  hypothetical protein ZEAMMB73_482448                    204   2e-58   
ref|NP_001136484.1|  uncharacterized protein LOC100216599               203   2e-58   
gb|EEC83021.1|  hypothetical protein OsI_28098                          204   2e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    206   5e-58   Cucumis sativus [cucumbers]
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        206   5e-58   Nicotiana sylvestris
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    206   6e-58   
dbj|BAG16527.1|  putative aconitase                                     206   9e-58   Capsicum chinense [bonnet pepper]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        205   9e-58   Fragaria vesca subsp. vesca
gb|AFW61054.1|  hypothetical protein ZEAMMB73_482448                    204   1e-57   
gb|ADM34980.1|  cytosolic aconitase                                     204   1e-57   Pyrus pyrifolia [sha li]
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         205   1e-57   Jatropha curcas
ref|XP_010533008.1|  PREDICTED: aconitate hydratase 2, mitochondr...    202   1e-57   
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        205   1e-57   Pyrus x bretschneideri [bai li]
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    204   2e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        204   2e-57   Prunus mume [ume]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             204   2e-57   Prunus persica
gb|EEE68177.1|  hypothetical protein OsJ_26310                          204   2e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    204   2e-57   
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    204   3e-57   
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          204   3e-57   Sorghum bicolor [broomcorn]
ref|XP_004158846.1|  PREDICTED: aconitate hydratase-like                189   3e-57   
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             204   3e-57   Phaseolus vulgaris [French bean]
emb|CDP10817.1|  unnamed protein product                                204   4e-57   Coffea canephora [robusta coffee]
gb|KCW88791.1|  hypothetical protein EUGRSUZ_A01129                     202   4e-57   Eucalyptus grandis [rose gum]
dbj|BAE71240.1|  putative cytoplasmic aconitate hydratase               194   4e-57   Trifolium pratense [peavine clover]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        202   5e-57   Glycine soja [wild soybean]
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        203   5e-57   Sesamum indicum [beniseed]
emb|CDY18054.1|  BnaC07g04160D                                          203   5e-57   Brassica napus [oilseed rape]
ref|XP_010100637.1|  Aconitate hydratase                                202   6e-57   
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    203   6e-57   Glycine max [soybeans]
gb|KDO54658.1|  hypothetical protein CISIN_1g001917mg                   202   7e-57   Citrus sinensis [apfelsine]
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    203   7e-57   Glycine max [soybeans]
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        202   8e-57   
gb|ACU19654.1|  unknown                                                 187   9e-57   Glycine max [soybeans]
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         202   9e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    202   1e-56   Arabis alpina [alpine rockcress]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    202   1e-56   Populus euphratica
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    202   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             202   1e-56   
emb|CBE71058.1|  aconitate hydratase 2                                  201   1e-56   Citrus clementina [clementine]
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             202   1e-56   Populus trichocarpa [western balsam poplar]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   202   1e-56   Citrus sinensis [apfelsine]
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                        201   1e-56   Glycine soja [wild soybean]
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    202   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        202   2e-56   Eucalyptus grandis [rose gum]
ref|NP_178634.2|  aconitate hydratase 3                                 202   2e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97969.1|  BnaA06g07200D                                          202   2e-56   
gb|ADZ57218.1|  aconitase protein                                       201   2e-56   Litchi chinensis [litchi]
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    202   2e-56   Brassica rapa
emb|CDX93088.1|  BnaA03g38100D                                          202   2e-56   
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             202   2e-56   Eutrema salsugineum [saltwater cress]
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        202   2e-56   Populus euphratica
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    201   2e-56   Glycine max [soybeans]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        201   2e-56   Solanum lycopersicum
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             202   2e-56   Citrus clementina [clementine]
sp|O04916.1|ACOC_SOLTU  RecName: Full=Aconitate hydratase, cytopl...    198   3e-56   Solanum tuberosum [potatoes]
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      201   3e-56   Gossypium arboreum [tree cotton]
emb|CAN62964.1|  hypothetical protein VITISV_029521                     196   3e-56   Vitis vinifera
ref|NP_001159192.1|  uncharacterized protein LOC100304277               190   3e-56   
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    201   4e-56   
ref|XP_006376779.1|  aconitate hydratase family protein                 201   4e-56   Populus trichocarpa [western balsam poplar]
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    201   5e-56   Glycine max [soybeans]
gb|KJB60835.1|  hypothetical protein B456_009G327800                    201   5e-56   Gossypium raimondii
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        201   5e-56   Glycine soja [wild soybean]
emb|CDY50945.1|  BnaC03g74450D                                          201   5e-56   Brassica napus [oilseed rape]
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    201   6e-56   Phoenix dactylifera
gb|AAP30039.1|  aconitase                                               199   6e-56   Solanum pennellii
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             200   6e-56   Capsella rubella
gb|AAO62410.1|  aconitase                                               199   7e-56   Solanum pennellii
gb|KHG08189.1|  hypothetical protein F383_11434                         199   8e-56   Gossypium arboreum [tree cotton]
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    199   1e-55   Cicer arietinum [garbanzo]
gb|KJB50479.1|  hypothetical protein B456_008G173400                    200   1e-55   Gossypium raimondii
ref|XP_007045642.1|  Aconitase 3                                        200   1e-55   
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    199   1e-55   Gossypium arboreum [tree cotton]
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           198   1e-55   Nicotiana tabacum [American tobacco]
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    198   2e-55   Cucurbita maxima [Boston marrow]
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    199   2e-55   Nicotiana sylvestris
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                199   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    199   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        199   2e-55   Vitis vinifera
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    198   3e-55   Nicotiana tomentosiformis
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   198   4e-55   Citrus sinensis [apfelsine]
gb|KJB62847.1|  hypothetical protein B456_009G440000                    198   4e-55   Gossypium raimondii
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    198   4e-55   Elaeis guineensis
gb|KHG02134.1|  hypothetical protein F383_25649                         198   4e-55   Gossypium arboreum [tree cotton]
gb|KJB30565.1|  hypothetical protein B456_005G149700                    197   4e-55   Gossypium raimondii
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        198   4e-55   Vitis vinifera
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    198   4e-55   Solanum tuberosum [potatoes]
gb|KJB30569.1|  hypothetical protein B456_005G149700                    198   5e-55   Gossypium raimondii
gb|KJB30566.1|  hypothetical protein B456_005G149700                    198   5e-55   Gossypium raimondii
ref|XP_002524184.1|  aconitase, putative                                197   6e-55   Ricinus communis
gb|KEH27599.1|  cytoplasmic-like aconitate hydratase                    196   8e-55   Medicago truncatula
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    197   1e-54   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB62843.1|  hypothetical protein B456_009G439700                    190   1e-54   Gossypium raimondii
ref|XP_003612247.1|  Aconitate hydratase                                196   1e-54   Medicago truncatula
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    196   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   196   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        196   2e-54   Nelumbo nucifera [Indian lotus]
ref|NP_001159229.1|  uncharacterized protein LOC100304315               194   2e-54   
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    196   2e-54   Brassica rapa
gb|KDO62732.1|  hypothetical protein CISIN_1g001863mg                   194   4e-54   Citrus sinensis [apfelsine]
ref|XP_002870438.1|  predicted protein                                  195   4e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400          195   4e-54   Amborella trichopoda
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    194   7e-54   
emb|CBE71057.1|  aconitate hydratase 3                                  194   8e-54   Citrus clementina [clementine]
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic               193   1e-53   Triticum urartu
gb|KJB48278.1|  hypothetical protein B456_008G061900                    193   1e-53   Gossypium raimondii
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             194   1e-53   Citrus clementina [clementine]
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...    194   1e-53   
ref|XP_007046597.1|  Aconitase 1                                        193   1e-53   
ref|XP_003596988.1|  Aconitate hydratase                                194   1e-53   Medicago truncatula
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    194   2e-53   Nicotiana sylvestris
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        193   2e-53   Gossypium arboreum [tree cotton]
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    193   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    194   2e-53   Nicotiana tomentosiformis
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        192   2e-53   Gossypium arboreum [tree cotton]
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic               192   2e-53   Triticum urartu
ref|XP_003605929.1|  Aconitate hydratase                                193   3e-53   Medicago truncatula
tpg|DAA43249.1|  TPA: hypothetical protein ZEAMMB73_889153              191   3e-53   
ref|XP_008785076.1|  PREDICTED: putative aconitate hydratase, cyt...    186   5e-53   
ref|XP_002530635.1|  aconitase, putative                                191   6e-53   Ricinus communis
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850          192   6e-53   Sorghum bicolor [broomcorn]
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    192   7e-53   Nelumbo nucifera [Indian lotus]
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    192   8e-53   Brachypodium distachyon [annual false brome]
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               191   8e-53   
gb|KDP23953.1|  hypothetical protein JCGZ_25341                         191   8e-53   Jatropha curcas
ref|XP_002532564.1|  aconitase, putative                                192   9e-53   
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               193   9e-53   
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    191   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             191   1e-52   Phaseolus vulgaris [French bean]
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    191   1e-52   Elaeis guineensis
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    191   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010113288.1|  Aconitate hydratase 1                              191   1e-52   
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              190   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              190   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   190   2e-52   
sp|Q42669.1|ACOC_CUCMC  RecName: Full=Aconitate hydratase; Short=...    189   2e-52   Cucumis melo var. conomon [snake cucumber]
dbj|BAJ92965.1|  predicted protein                                      191   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    190   3e-52   Setaria italica
gb|AAC26045.1|  aconitase-iron regulated protein 1                      189   3e-52   Citrus limon [lemon]
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             189   3e-52   Populus trichocarpa [western balsam poplar]
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   189   4e-52   Populus euphratica
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    189   4e-52   Glycine max [soybeans]
gb|KGN48958.1|  Aconitase                                               189   4e-52   Cucumis sativus [cucumbers]
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    189   5e-52   Cicer arietinum [garbanzo]
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like              189   5e-52   Cucumis sativus [cucumbers]
dbj|BAJ85661.1|  predicted protein                                      189   5e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                189   5e-52   Erythranthe guttata [common monkey flower]
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   189   5e-52   Glycine max [soybeans]
gb|ABK25210.1|  unknown                                                 186   6e-52   Picea sitchensis
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    189   7e-52   Sesamum indicum [beniseed]
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                     188   7e-52   Cucumis melo [Oriental melon]
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   188   8e-52   Pyrus x bretschneideri [bai li]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             189   9e-52   Capsella rubella
gb|EEE58288.1|  hypothetical protein OsJ_09326                          188   1e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    189   1e-51   Phoenix dactylifera
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    189   1e-51   Elaeis guineensis
ref|XP_008393748.1|  PREDICTED: aconitate hydratase 1-like              187   1e-51   
ref|XP_008344247.1|  PREDICTED: aconitate hydratase 1                   187   1e-51   
gb|ADP03320.1|  aconitate hydratase                                     181   1e-51   Pinus pinaster [cluster pine]
ref|XP_006383042.1|  aconitate hydratase family protein                 188   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_008363078.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    187   1e-51   
gb|AAL13084.1|  putative aconitase                                      187   1e-51   Prunus avium [gean]
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    188   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             187   1e-51   Prunus persica
gb|KCW56578.1|  hypothetical protein EUGRSUZ_I02307                     186   2e-51   Eucalyptus grandis [rose gum]
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   187   2e-51   Prunus mume [ume]
gb|EEC74472.1|  hypothetical protein OsI_09921                          188   2e-51   Oryza sativa Indica Group [Indian rice]
ref|NP_001048898.1|  Os03g0136900                                       188   2e-51   
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   187   2e-51   Vitis vinifera
gb|ADP03143.1|  aconitate hydratase                                     180   2e-51   Pinus sylvestris [Scotch pine]
gb|ADP03120.1|  aconitate hydratase                                     180   2e-51   Pinus sylvestris [Scotch pine]
emb|CBI24446.3|  unnamed protein product                                187   2e-51   Vitis vinifera
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                        187   3e-51   Glycine soja [wild soybean]
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             187   3e-51   Eutrema salsugineum [saltwater cress]
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    187   3e-51   Arabis alpina [alpine rockcress]
ref|NP_001119125.1|  aconitate hydratase 1                              186   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438674.1|  PREDICTED: aconitate hydratase 3, mitochondr...    186   3e-51   Camelina sativa [gold-of-pleasure]
gb|ADP03134.1|  aconitate hydratase                                     180   3e-51   Pinus sylvestris [Scotch pine]
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...    186   3e-51   
gb|ADP03123.1|  aconitate hydratase                                     180   3e-51   Pinus sylvestris [Scotch pine]
gb|ADP03151.1|  aconitate hydratase                                     180   4e-51   Pinus sylvestris [Scotch pine]
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like              186   4e-51   Cicer arietinum [garbanzo]
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   186   5e-51   Tarenaya hassleriana [spider flower]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                     186   5e-51   Eucalyptus grandis [rose gum]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                   186   5e-51   Eucalyptus grandis [rose gum]
gb|KHN41868.1|  Aconitate hydratase 1                                   186   5e-51   Glycine soja [wild soybean]
gb|ADP03144.1|  aconitate hydratase                                     179   5e-51   Pinus sylvestris [Scotch pine]
emb|CAB36543.1|  putative aconitase                                     186   5e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAA58046.1|  aconitase                                              186   6e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KHG24816.1|  Aconitate hydratase 1 -like protein                     185   7e-51   Gossypium arboreum [tree cotton]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    186   7e-51   Brassica rapa
emb|CDY66424.1|  BnaAnng22230D                                          186   7e-51   Brassica napus [oilseed rape]
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    186   7e-51   Arabis alpina [alpine rockcress]
ref|NP_195308.1|  aconitate hydratase 1                                 186   7e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDP05740.1|  unnamed protein product                                186   7e-51   Coffea canephora [robusta coffee]
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             186   7e-51   Capsella rubella
emb|CDX69174.1|  BnaC01g02790D                                          186   7e-51   
gb|KDO71349.1|  hypothetical protein CISIN_1g002610mg                   183   8e-51   Citrus sinensis [apfelsine]
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    186   8e-51   Phoenix dactylifera
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   186   8e-51   Brassica rapa
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    186   8e-51   Camelina sativa [gold-of-pleasure]
ref|NP_567763.2|  aconitase 2                                           186   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    186   8e-51   Camelina sativa [gold-of-pleasure]
ref|XP_007020807.1|  Aconitase 3                                        185   1e-50   
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             185   1e-50   
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    185   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO71348.1|  hypothetical protein CISIN_1g002610mg                   183   2e-50   Citrus sinensis [apfelsine]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             185   2e-50   
emb|CDY14291.1|  BnaA08g14220D                                          185   2e-50   Brassica napus [oilseed rape]
gb|KDO71347.1|  hypothetical protein CISIN_1g002610mg                   183   3e-50   Citrus sinensis [apfelsine]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             184   4e-50   Eutrema salsugineum [saltwater cress]
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              184   4e-50   Brassica rapa
emb|CDX75532.1|  BnaA01g01700D                                          184   4e-50   
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             183   5e-50   Citrus clementina [clementine]
emb|CBE71056.1|  aconitate hydratase 1                                  183   5e-50   Citrus clementina [clementine]
emb|CDY24823.1|  BnaA08g14870D                                          183   5e-50   Brassica napus [oilseed rape]
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   183   5e-50   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   183   5e-50   Citrus sinensis [apfelsine]
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...    184   5e-50   Brachypodium distachyon [annual false brome]
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                   183   6e-50   Citrus sinensis [apfelsine]
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   183   6e-50   Citrus sinensis [apfelsine]
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         183   9e-50   Jatropha curcas
gb|AAK91447.1|  AT4g26970/F10M23_310                                    183   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   182   1e-49   Fragaria vesca subsp. vesca
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   182   2e-49   Citrus sinensis [apfelsine]
emb|CDY41626.1|  BnaC03g62580D                                          182   2e-49   Brassica napus [oilseed rape]
ref|XP_008660164.1|  PREDICTED: aconitate hydratase, cytoplasmic        167   2e-49   
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   181   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              181   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              181   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    181   5e-49   Solanum tuberosum [potatoes]
gb|ACR36825.1|  unknown                                                 176   2e-48   Zea mays [maize]
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          179   2e-48   Sorghum bicolor [broomcorn]
gb|ACK56134.1|  putative aconitase                                      166   3e-48   Dimocarpus longan [longan]
gb|KEH38306.1|  cytoplasmic-like aconitate hydratase                    178   3e-48   Medicago truncatula
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...    177   1e-47   Zea mays [maize]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...    177   1e-47   Zea mays [maize]
emb|CAN83844.1|  hypothetical protein VITISV_003004                     176   1e-47   Vitis vinifera
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like              176   2e-47   Tarenaya hassleriana [spider flower]
ref|NP_001147431.1|  aconitase2                                         176   2e-47   Zea mays [maize]
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    176   2e-47   Zea mays [maize]
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    176   4e-47   Zea mays [maize]
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907             175   4e-47   
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937             175   5e-47   
ref|XP_004972670.1|  PREDICTED: putative aconitate hydratase, cyt...    159   1e-46   
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like              174   2e-46   Eucalyptus grandis [rose gum]
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                     174   2e-46   Eucalyptus grandis [rose gum]
gb|EMS62033.1|  Putative aconitate hydratase, cytoplasmic               171   1e-45   Triticum urartu
ref|XP_010443094.1|  PREDICTED: aconitate hydratase 3, mitochondr...    169   3e-45   
ref|XP_009361096.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    168   4e-45   
ref|XP_007020811.1|  Aconitase 3                                        170   4e-45   
ref|XP_010443093.1|  PREDICTED: aconitate hydratase 3, mitochondr...    169   4e-45   
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331             170   5e-45   
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572             170   5e-45   
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    169   7e-45   Camelina sativa [gold-of-pleasure]
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic               169   9e-45   
ref|XP_011047267.1|  PREDICTED: aconitate hydratase, cytoplasmic        154   9e-45   Populus euphratica
ref|XP_001780674.1|  predicted protein                                  167   4e-44   
gb|KCW88785.1|  hypothetical protein EUGRSUZ_A01127                     152   5e-44   Eucalyptus grandis [rose gum]
ref|XP_002866068.1|  hypothetical protein ARALYDRAFT_918634             155   5e-43   
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    164   5e-43   
ref|XP_006830449.1|  hypothetical protein AMTR_s00115p00015570          162   2e-42   
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    161   4e-42   Medicago truncatula
ref|XP_003590814.1|  Aconitate hydratase                                161   4e-42   
tpg|DAA43248.1|  TPA: hypothetical protein ZEAMMB73_889153              159   5e-42   
ref|XP_001779205.1|  predicted protein                                  157   1e-40   
ref|XP_008355339.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    153   4e-40   
ref|XP_001770969.1|  predicted protein                                  155   6e-40   
gb|KJB17578.1|  hypothetical protein B456_003G006000                    153   3e-39   Gossypium raimondii
gb|EPQ05177.1|  Cytoplasmic aconitate hydratase                         140   2e-37   Myotis brandtii
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   146   1e-36   
emb|CDY56501.1|  BnaAnng14360D                                          143   1e-35   
ref|XP_006108771.1|  PREDICTED: cytoplasmic aconitate hydratase-like    135   2e-35   
ref|XP_005862173.1|  PREDICTED: cytoplasmic aconitate hydratase-like    134   2e-35   
ref|XP_010290546.1|  PREDICTED: cytoplasmic aconitate hydratase         131   1e-34   
gb|AGC69746.1|  putative iron regulatory protein                        140   2e-34   
dbj|BAM18054.1|  iron regulatory protein 1A                             136   2e-34   
ref|XP_008586142.1|  PREDICTED: cytoplasmic aconitate hydratase         133   3e-34   
ref|XP_004632076.1|  PREDICTED: cytoplasmic aconitate hydratase         138   7e-34   
gb|AAH90777.1|  LOC100150527 protein                                    129   7e-34   
ref|XP_011164631.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    136   2e-33   
gb|KHJ97837.1|  aconitase domain protein                                132   2e-33   
ref|XP_011164630.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    136   2e-33   
ref|XP_004581280.1|  PREDICTED: cytoplasmic aconitate hydratase         136   3e-33   
gb|EGV97063.1|  Cytoplasmic aconitate hydratase                         135   4e-33   
gb|EHJ78892.1|  iron regulatory protein 1                               132   4e-33   
ref|XP_003506017.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    136   4e-33   
ref|XP_004905303.1|  PREDICTED: cytoplasmic aconitate hydratase i...    136   4e-33   
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                   135   4e-33   
gb|EYC17817.1|  hypothetical protein Y032_0029g1886                     127   4e-33   
ref|XP_005401176.1|  PREDICTED: cytoplasmic aconitate hydratase         135   4e-33   
ref|XP_007614514.1|  PREDICTED: cytoplasmic aconitate hydratase         135   5e-33   
ref|XP_010611189.1|  PREDICTED: cytoplasmic aconitate hydratase         135   5e-33   
gb|EZA62627.1|  Cytoplasmic aconitate hydratase                         135   5e-33   
gb|KFM82338.1|  hypothetical protein X975_14216                         135   6e-33   
gb|ERE84356.1|  cytoplasmic aconitate hydratase-like protein            135   7e-33   
ref|XP_005326228.1|  PREDICTED: cytoplasmic aconitate hydratase         135   7e-33   
ref|XP_011347824.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    135   8e-33   
ref|XP_011347901.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    135   8e-33   
gb|KFO19757.1|  Cytoplasmic aconitate hydratase                         135   8e-33   
ref|XP_006975385.1|  PREDICTED: cytoplasmic aconitate hydratase         135   9e-33   
gb|AAF29447.1|AF127457_1  aconitase                                     126   1e-32   
ref|XP_011148978.1|  PREDICTED: cytoplasmic aconitate hydratase-like    134   1e-32   
ref|XP_006759955.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    134   1e-32   
ref|XP_006759954.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    134   1e-32   
pdb|3SNP|A  Chain A, Crystal Structure Analysis Of Iron Regulator...    134   1e-32   
ref|XP_006123150.1|  PREDICTED: cytoplasmic aconitate hydratase i...    134   2e-32   
ref|XP_008517260.1|  PREDICTED: cytoplasmic aconitate hydratase         134   2e-32   
gb|ELU03714.1|  hypothetical protein CAPTEDRAFT_153788                  134   2e-32   
ref|XP_004392229.1|  PREDICTED: cytoplasmic aconitate hydratase         134   2e-32   
ref|XP_005078925.1|  PREDICTED: cytoplasmic aconitate hydratase         134   2e-32   
ref|XP_008246563.1|  PREDICTED: cytoplasmic aconitate hydratase i...    134   2e-32   
ref|XP_010746424.1|  PREDICTED: cytoplasmic aconitate hydratase         134   2e-32   
ref|XP_006759953.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    134   2e-32   
gb|ELK33131.1|  Cytoplasmic aconitate hydratase                         134   2e-32   
ref|XP_004658446.1|  PREDICTED: cytoplasmic aconitate hydratase         134   2e-32   
ref|XP_392993.2|  PREDICTED: cytoplasmic aconitate hydratase-like...    134   2e-32   
gb|AFI44047.1|  iron regulatory protein                                 134   2e-32   
ref|XP_006609084.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    133   3e-32   
ref|XP_008849314.1|  PREDICTED: cytoplasmic aconitate hydratase         133   3e-32   
ref|XP_010787894.1|  PREDICTED: cytoplasmic aconitate hydratase-like    129   3e-32   
ref|XP_008693317.1|  PREDICTED: cytoplasmic aconitate hydratase         133   4e-32   
ref|XP_001016756.1|  aconitate hydratase                                133   4e-32   
ref|XP_004428435.1|  PREDICTED: cytoplasmic aconitate hydratase i...    133   4e-32   
ref|XP_003695791.1|  PREDICTED: cytoplasmic aconitate hydratase         133   4e-32   
ref|XP_004428436.1|  PREDICTED: cytoplasmic aconitate hydratase i...    133   4e-32   
ref|XP_002643981.1|  C. briggsae CBR-ACO-1 protein                      133   4e-32   
ref|XP_010965659.1|  PREDICTED: cytoplasmic aconitate hydratase i...    132   4e-32   
ref|XP_004482427.1|  PREDICTED: cytoplasmic aconitate hydratase         133   4e-32   
ref|XP_010974111.1|  PREDICTED: cytoplasmic aconitate hydratase i...    132   4e-32   
gb|AAF99681.1|AF261088_1  iron regulatory protein 1                     132   5e-32   
gb|AAA69900.1|  iron-responsive regulatory protein/iron regulator...    132   5e-32   
emb|CAP35039.2|  Protein CBR-ACO-1                                      133   5e-32   
ref|XP_006216897.1|  PREDICTED: cytoplasmic aconitate hydratase         132   5e-32   
ref|XP_002784977.1|  aconitase, putative                                124   5e-32   
ref|XP_002928311.1|  PREDICTED: cytoplasmic aconitate hydratase         132   6e-32   
ref|XP_003699654.1|  PREDICTED: cytoplasmic aconitate hydratase         132   6e-32   
ref|XP_008154889.1|  PREDICTED: cytoplasmic aconitate hydratase         132   6e-32   
gb|ETN69391.1|  aconitase domain protein                                124   6e-32   
ref|XP_006716840.1|  PREDICTED: cytoplasmic aconitate hydratase i...    132   6e-32   
gb|AAA03251.1|  chimeric iron-responsive element-binding protein,...    132   6e-32   
ref|XP_005362039.1|  PREDICTED: cytoplasmic aconitate hydratase         132   6e-32   
ref|XP_003357777.1|  PREDICTED: cytoplasmic aconitate hydratase         132   6e-32   
ref|XP_004047955.1|  PREDICTED: cytoplasmic aconitate hydratase         132   6e-32   
ref|XP_003830146.1|  PREDICTED: cytoplasmic aconitate hydratase i...    132   7e-32   
pdb|2B3X|A  Chain A, Structure Of An Orthorhombic Crystal Form Of...    132   7e-32   
ref|XP_007076652.1|  PREDICTED: cytoplasmic aconitate hydratase         132   7e-32   
ref|NP_002188.1|  cytoplasmic aconitate hydratase                       132   7e-32   
ref|XP_006727401.1|  PREDICTED: cytoplasmic aconitate hydratase         132   7e-32   
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase         132   7e-32   
ref|XP_010965658.1|  PREDICTED: cytoplasmic aconitate hydratase i...    132   8e-32   
ref|XP_010974110.1|  PREDICTED: cytoplasmic aconitate hydratase i...    132   8e-32   
ref|XP_003884224.1|  Iron regulatory protein-like protein, related      132   8e-32   
gb|AJQ30117.1|  aconitate hydratase 1                                   132   8e-32   
ref|XP_011404037.1|  PREDICTED: cytoplasmic aconitate hydratase         132   8e-32   
ref|XP_006143153.1|  PREDICTED: cytoplasmic aconitate hydratase         132   9e-32   
ref|XP_008996396.1|  PREDICTED: cytoplasmic aconitate hydratase         132   9e-32   
ref|XP_004677765.1|  PREDICTED: cytoplasmic aconitate hydratase         132   9e-32   
gb|EHH57327.1|  hypothetical protein EGM_06925                          132   1e-31   
gb|AAH05454.1|  Aconitase 1                                             132   1e-31   
gb|EHH24050.1|  hypothetical protein EGK_07631                          132   1e-31   
emb|CAA43455.1|  iron response element binding protein                  132   1e-31   
ref|NP_001244794.1|  cytoplasmic aconitate hydratase                    132   1e-31   
ref|XP_007464993.1|  PREDICTED: cytoplasmic aconitate hydratase i...    132   1e-31   
ref|NP_001075784.1|  cytoplasmic aconitate hydratase                    132   1e-31   
ref|NP_031412.2|  cytoplasmic aconitate hydratase                       132   1e-31   
ref|XP_007464992.1|  PREDICTED: cytoplasmic aconitate hydratase i...    132   1e-31   
emb|CAD20353.1|  cytoplasmic aconitase                                  132   1e-31   
ref|XP_002670969.1|  aconitase                                          132   1e-31   
ref|XP_003263352.1|  PREDICTED: cytoplasmic aconitate hydratase         132   1e-31   
gb|KHN74276.1|  putative cytoplasmic aconitate hydratase                132   1e-31   
ref|XP_001464867.1|  putative aconitase                                 132   1e-31   
ref|XP_005492744.1|  PREDICTED: cytoplasmic aconitate hydratase         131   1e-31   
gb|ENN73657.1|  hypothetical protein YQE_09735                          125   1e-31   
ref|XP_003109738.1|  CRE-ACO-1 protein                                  131   1e-31   
ref|XP_010724498.1|  PREDICTED: cytoplasmic aconitate hydratase         131   1e-31   
ref|XP_007433435.1|  PREDICTED: cytoplasmic aconitate hydratase         121   1e-31   
ref|XP_010352748.1|  PREDICTED: cytoplasmic aconitate hydratase         131   1e-31   
ref|XP_005425054.1|  PREDICTED: cytoplasmic aconitate hydratase         131   1e-31   
gb|EGT30572.1|  CBN-ACO-1 protein                                       131   1e-31   
ref|XP_004275114.1|  PREDICTED: cytoplasmic aconitate hydratase i...    131   1e-31   
ref|XP_005963977.1|  PREDICTED: cytoplasmic aconitate hydratase         131   2e-31   
emb|CEF64620.1|  Cytoplasmic aconitate hydratase                        131   2e-31   
ref|XP_003427264.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    131   2e-31   
ref|XP_003911667.1|  PREDICTED: cytoplasmic aconitate hydratase         131   2e-31   
ref|XP_008487142.1|  PREDICTED: cytoplasmic aconitate hydratase-like    121   2e-31   
ref|XP_004765422.1|  PREDICTED: cytoplasmic aconitate hydratase         131   2e-31   
ref|XP_003800343.1|  PREDICTED: cytoplasmic aconitate hydratase         131   2e-31   
ref|XP_003470870.1|  PREDICTED: cytoplasmic aconitate hydratase         131   2e-31   
ref|XP_007531304.1|  PREDICTED: cytoplasmic aconitate hydratase         131   2e-31   
ref|XP_003407686.1|  PREDICTED: cytoplasmic aconitate hydratase         131   2e-31   
gb|ETE68888.1|  Iron-responsive element-binding protein 2               131   2e-31   
ref|XP_008545838.1|  PREDICTED: cytoplasmic aconitate hydratase-like    131   2e-31   
ref|XP_010081789.1|  PREDICTED: cytoplasmic aconitate hydratase         129   2e-31   
ref|XP_006939263.1|  PREDICTED: cytoplasmic aconitate hydratase         131   2e-31   
gb|EDL98627.1|  rCG55067                                                131   2e-31   
gb|KFV01523.1|  Cytoplasmic aconitate hydratase                         129   2e-31   
ref|XP_001682457.1|  putative aconitase                                 131   2e-31   
ref|XP_005209909.1|  PREDICTED: cytoplasmic aconitate hydratase i...    131   2e-31   
ref|XP_007967222.1|  PREDICTED: cytoplasmic aconitate hydratase         131   2e-31   
ref|XP_007116533.1|  PREDICTED: cytoplasmic aconitate hydratase i...    131   2e-31   
ref|XP_010806017.1|  PREDICTED: cytoplasmic aconitate hydratase i...    131   2e-31   
ref|XP_006809760.1|  PREDICTED: cytoplasmic aconitate hydratase-like    130   2e-31   
ref|XP_010837907.1|  PREDICTED: cytoplasmic aconitate hydratase         130   2e-31   
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137              130   2e-31   
ref|XP_001952191.1|  PREDICTED: cytoplasmic aconitate hydratase-like    130   2e-31   
ref|XP_005909205.1|  PREDICTED: cytoplasmic aconitate hydratase         130   2e-31   
tpg|DAA27049.1|  TPA: cytoplasmic aconitate hydratase                   130   2e-31   
ref|NP_001069059.1|  cytoplasmic aconitate hydratase                    130   2e-31   
ref|XP_007116532.1|  PREDICTED: cytoplasmic aconitate hydratase i...    130   2e-31   
ref|XP_008059371.1|  PREDICTED: cytoplasmic aconitate hydratase         130   2e-31   
ref|XP_007065257.1|  PREDICTED: cytoplasmic aconitate hydratase         130   3e-31   
ref|NP_001025707.1|  cytoplasmic aconitate hydratase                    130   3e-31   
ref|XP_010888583.1|  PREDICTED: cytoplasmic aconitate hydratase-like    129   3e-31   
gb|KFQ12070.1|  Cytoplasmic aconitate hydratase                         129   3e-31   
gb|ELR46544.1|  Cytoplasmic aconitate hydratase                         130   3e-31   
ref|XP_008882045.1|  aconitate hydratase ACN/IRP                        130   3e-31   
ref|XP_005530013.1|  PREDICTED: cytoplasmic aconitate hydratase         130   3e-31   
ref|XP_009927267.1|  PREDICTED: cytoplasmic aconitate hydratase         129   3e-31   
ref|XP_010136118.1|  PREDICTED: cytoplasmic aconitate hydratase i...    130   3e-31   
ref|XP_007020856.1|  Aconitase 3, putative                              127   3e-31   
ref|XP_010136119.1|  PREDICTED: cytoplasmic aconitate hydratase i...    130   3e-31   
ref|XP_009898602.1|  PREDICTED: cytoplasmic aconitate hydratase         130   3e-31   
gb|EMP30789.1|  Cytoplasmic aconitate hydratase                         130   3e-31   
ref|XP_008494051.1|  PREDICTED: cytoplasmic aconitate hydratase         130   4e-31   
ref|XP_005683624.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    130   4e-31   
ref|XP_004004476.1|  PREDICTED: cytoplasmic aconitate hydratase i...    130   4e-31   
ref|XP_002766275.1|  Aconitate hydratase, cytoplasmic, putative         125   4e-31   
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase         130   4e-31   
ref|XP_002126781.1|  PREDICTED: cytoplasmic aconitate hydratase         130   4e-31   
ref|XP_004004477.1|  PREDICTED: cytoplasmic aconitate hydratase i...    130   5e-31   
ref|XP_011411873.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    130   5e-31   
ref|XP_004390991.1|  PREDICTED: cytoplasmic aconitate hydratase         130   5e-31   
ref|XP_009675962.1|  PREDICTED: cytoplasmic aconitate hydratase i...    130   5e-31   
gb|KFQ88200.1|  Cytoplasmic aconitate hydratase                         129   5e-31   
ref|XP_004600431.1|  PREDICTED: cytoplasmic aconitate hydratase         129   6e-31   
ref|XP_004086812.1|  PREDICTED: cytoplasmic aconitate hydratase i...    130   6e-31   
ref|XP_538698.2|  PREDICTED: cytoplasmic aconitate hydratase            129   6e-31   
gb|KFQ42707.1|  Cytoplasmic aconitate hydratase                         129   6e-31   
ref|XP_011471732.1|  PREDICTED: cytoplasmic aconitate hydratase i...    129   6e-31   
ref|XP_009675961.1|  PREDICTED: cytoplasmic aconitate hydratase i...    129   6e-31   
ref|XP_010013993.1|  PREDICTED: cytoplasmic aconitate hydratase         129   6e-31   
ref|XP_005141537.1|  PREDICTED: cytoplasmic aconitate hydratase         129   6e-31   
ref|XP_005581618.1|  PREDICTED: cytoplasmic aconitate hydratase i...    129   6e-31   
ref|XP_011411874.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    129   7e-31   
ref|XP_011411872.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    129   7e-31   
ref|XP_008166967.1|  PREDICTED: cytoplasmic aconitate hydratase         129   7e-31   
ref|XP_009094283.1|  PREDICTED: cytoplasmic aconitate hydratase         129   7e-31   
ref|XP_010576405.1|  PREDICTED: cytoplasmic aconitate hydratase         129   7e-31   
ref|XP_009818682.1|  PREDICTED: cytoplasmic aconitate hydratase         128   7e-31   
ref|XP_010348726.1|  PREDICTED: cytoplasmic aconitate hydratase         129   7e-31   
ref|XP_006863078.1|  PREDICTED: cytoplasmic aconitate hydratase         129   8e-31   
ref|XP_011312352.1|  PREDICTED: cytoplasmic aconitate hydratase-like    129   8e-31   
ref|XP_009485700.1|  PREDICTED: cytoplasmic aconitate hydratase         129   8e-31   
gb|KFP56261.1|  Cytoplasmic aconitate hydratase                         129   8e-31   
ref|XP_008921492.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    129   8e-31   
ref|XP_009946591.1|  PREDICTED: cytoplasmic aconitate hydratase         129   8e-31   
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase         129   9e-31   
ref|XP_011261917.1|  PREDICTED: cytoplasmic aconitate hydratase-like    129   9e-31   
ref|XP_003459702.1|  PREDICTED: cytoplasmic aconitate hydratase         129   9e-31   
ref|XP_011058028.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    129   9e-31   
ref|XP_006025029.1|  PREDICTED: cytoplasmic aconitate hydratase         129   9e-31   
ref|XP_003874065.1|  putative aconitase                                 129   9e-31   
ref|XP_008200453.1|  PREDICTED: cytoplasmic aconitate hydratase-like    129   9e-31   
ref|XP_005061122.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
ref|XP_004922163.1|  PREDICTED: cytoplasmic aconitate hydratase-like    129   1e-30   
gb|KFQ08457.1|  Cytoplasmic aconitate hydratase                         129   1e-30   
gb|KFG60936.1|  aconitate hydratase ACN/IRP                             129   1e-30   
ref|XP_010398395.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
gb|KFB40343.1|  AGAP007258-PA-like protein                              129   1e-30   
gb|KFG42597.1|  aconitate hydratase ACN/IRP                             129   1e-30   
ref|XP_009872328.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
ref|XP_009968191.1|  PREDICTED: cytoplasmic aconitate hydratase         128   1e-30   
gb|ESS32610.1|  aconitate hydratase ACN/IRP                             129   1e-30   
ref|XP_002366326.1|  aconitate hydratase, putative                      129   1e-30   
ref|XP_005172430.1|  PREDICTED: cytoplasmic aconitate hydratase i...    129   1e-30   
gb|KFH13093.1|  aconitate hydratase ACN/IRP                             129   1e-30   
gb|KFV55230.1|  Cytoplasmic aconitate hydratase                         128   1e-30   
gb|EPR62226.1|  aconitate hydratase ACN/IRP                             129   1e-30   
ref|XP_010224488.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
ref|XP_009075233.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
ref|XP_006265526.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
ref|XP_001563981.1|  putative aconitase                                 129   1e-30   
ref|XP_010151037.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
emb|CCW61236.1|  unnamed protein product                                129   1e-30   
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
gb|KFZ58431.1|  Cytoplasmic aconitate hydratase                         128   1e-30   
ref|XP_006060333.1|  PREDICTED: cytoplasmic aconitate hydratase i...    129   1e-30   
ref|XP_010169631.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
ref|XP_009462533.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
ref|XP_001509375.1|  PREDICTED: cytoplasmic aconitate hydratase         129   1e-30   
ref|NP_509898.1|  Protein ACO-1                                         129   1e-30   



>ref|XP_010046453.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=137

 Score =   200 bits (508),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERYSIDLPSNI+E
Sbjct  30   GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYSIDLPSNISE  89

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+F CT RF+TEVELAYFNHGGI PYVIR L  Q
Sbjct  90   IRPGQDVTVTTDTGKSFICTARFETEVELAYFNHGGILPYVIRNLFNQ  137



>ref|XP_007132547.1| hypothetical protein PHAVU_011G1037000g, partial [Phaseolus vulgaris]
 gb|ESW04541.1| hypothetical protein PHAVU_011G1037000g, partial [Phaseolus vulgaris]
Length=135

 Score =   196 bits (498),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTG ERY+ID+PS I++
Sbjct  29   GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGQERYTIDIPSKISD  88

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSK  252
            IRPGQDVTV TDNGK+FTCTVRFDTEVE+AYFNHGGI PYVIR L K
Sbjct  89   IRPGQDVTVTTDNGKSFTCTVRFDTEVEIAYFNHGGILPYVIRNLIK  135



>dbj|BAD94991.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=328

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  221  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  280

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  281  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  328



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLPSNI+E
Sbjct  882  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPSNISE  941

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+FTCTVRFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  942  IRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLIKQ  989



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDADSLGLTGHERY+IDLP NI+E
Sbjct  874  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYTIDLPDNISE  933

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGI PYVIRQLS+Q
Sbjct  934  IRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILPYVIRQLSQQ  981



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDADSLGLTGHERY+IDLP NI+E
Sbjct  874  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYTIDLPDNISE  933

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGI PYVIRQLS+Q
Sbjct  934  IRPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQLSQQ  981



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   208 bits (530),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+IDLP NI+E
Sbjct  890  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPENISE  949

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV+T+ GK+FTCTVRFDTEVELAYFNHGGI PYVIRQL+KQ
Sbjct  950  IRPGQDVTVRTETGKSFTCTVRFDTEVELAYFNHGGILPYVIRQLTKQ  997



>gb|AFW61053.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=617

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP+N++E
Sbjct  508  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSE  567

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLS  255
            IRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGI PYVIR L+
Sbjct  568  IRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLA  613



>ref|NP_001136484.1| uncharacterized protein LOC100216599 [Zea mays]
 gb|ACF82029.1| unknown [Zea mays]
Length=565

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP+N++E
Sbjct  456  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSE  515

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLS  255
            IRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGI PYVIR L+
Sbjct  516  IRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLA  561



>gb|EEC83021.1| hypothetical protein OsI_28098 [Oryza sativa Indica Group]
Length=621

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERY+IDLP+N++E
Sbjct  514  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTIDLPTNVSE  573

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV TDNGK+FTCT+RFDTEVELAYFNHGGI PYVIR L++ 
Sbjct  574  IRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNLAQN  621



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP NI+E
Sbjct  882  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPDNISE  941

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDV+V TD+GK+FTCTVRFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  942  IRPGQDVSVTTDSGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLIKQ  989



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+IDLP NI+E
Sbjct  889  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPENISE  948

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDV V+TD GK+FTC VRFDTEVELAYFNHGGI PYVIRQL+KQ
Sbjct  949  IRPGQDVAVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQLTKQ  996



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP NI+E
Sbjct  882  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPDNISE  941

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDV++ TD+GK+FTCTVRFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  942  IRPGQDVSITTDSGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLIKQ  989



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+IDLP NI+E
Sbjct  888  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPENISE  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDV+V+TD GK+FTCTVRFDTEVELAYFNHGGI  YVIRQL+KQ
Sbjct  948  IRPGQDVSVQTDTGKSFTCTVRFDTEVELAYFNHGGILQYVIRQLTKQ  995



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPSNI+E
Sbjct  883  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISE  942

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TD+GK+F CTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  943  IKPGQDVTVTTDSGKSFVCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  990



>gb|AFW61054.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=797

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP+N++E
Sbjct  688  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSE  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLS  255
            IRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGI PYVIR L+
Sbjct  748  IRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLA  793



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPSNI+E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGI  YVIR LSKQ
Sbjct  851  IKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYVIRNLSKQ  898



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAG+DAD+LGLTGHERY+IDLPSNI++
Sbjct  891  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLTGHERYTIDLPSNISD  950

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR L K+
Sbjct  951  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLMKE  998



>ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Tarenaya 
hassleriana]
Length=658

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+I LP+NI E
Sbjct  551  GPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIHLPTNILE  610

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAY+NHGGI PYVIR LSKQ
Sbjct  611  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYYNHGGILPYVIRNLSKQ  658



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPSNI+E
Sbjct  887  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISE  946

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGI  YVIR LSKQ
Sbjct  947  IKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYVIRNLSKQ  994



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERY+IDLP+N++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTIDLPTNVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV TDNGK+FTCT+RFDTEVELAYFNHGGI PYVIR L++ 
Sbjct  851  IRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNLAQN  898



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+IDLPS+I+E
Sbjct  887  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPSSISE  946

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI  YVIR LSKQ
Sbjct  947  IKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILHYVIRNLSKQ  994



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/108 (90%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+IDLPS+I+E
Sbjct  889  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPSSISE  948

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI  YVIR LSKQ
Sbjct  949  IKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILHYVIRNLSKQ  996



>gb|EEE68177.1| hypothetical protein OsJ_26310 [Oryza sativa Japonica Group]
Length=956

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERY+IDLP+N++E
Sbjct  849  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTIDLPTNVSE  908

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV TDNGK+FTCT+RFDTEVELAYFNHGGI PYVIR L++ 
Sbjct  909  IRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNLAQN  956



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP+N++E
Sbjct  878  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSE  937

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLS  255
            IRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGI PYVIR L+
Sbjct  938  IRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLA  983



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPSNI+E
Sbjct  885  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISE  944

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK FTCTVRFDTEVEL YFNHGGI  YVIR LSKQ
Sbjct  945  IKPGQDVTVTTDNGKAFTCTVRFDTEVELEYFNHGGILQYVIRNLSKQ  992



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERYSIDLP+N++E
Sbjct  887  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPANLSE  946

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLS  255
            IRPGQDVTV TDNGK+FTCT+RFDTEVELAYFNHGGI PYVIR L+
Sbjct  947  IRPGQDVTVITDNGKSFTCTLRFDTEVELAYFNHGGILPYVIRNLA  992



>ref|XP_004158846.1| PREDICTED: aconitate hydratase-like [Cucumis sativus]
Length=178

 Score =   189 bits (481),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDADSLGLTGHER++IDLPSN+ E
Sbjct  69   GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERFTIDLPSNVGE  128

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGI  YVIR L
Sbjct  129  IRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  173



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS I+E
Sbjct  876  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSKISE  935

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCT RFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  936  IRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHGGILPYVIRNLIKQ  983



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPML GVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPS I+E
Sbjct  902   GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKIDE  961

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
             IRPGQDVTV TD GK+FTCT RFDTEVELAYFNHGGI PYV+RQL+KQ
Sbjct  962   IRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHGGILPYVVRQLTKQ  1009



>gb|KCW88791.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=795

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGED D+LGLTGHERYSIDLPSNI+E
Sbjct  688  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDTDTLGLTGHERYSIDLPSNISE  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+FTCT RFDTEVELAYFNHGGI PYVIR L  Q
Sbjct  748  IRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHGGILPYVIRNLINQ  795



>dbj|BAE71240.1| putative cytoplasmic aconitate hydratase [Trifolium pratense]
Length=316

 Score =   194 bits (492),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I+E
Sbjct  208  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISE  267

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQDVTV TDNGK+FTCT RFDTEVEL YFNHGGI PYVIR L
Sbjct  268  IKPGQDVTVTTDNGKSFTCTARFDTEVELEYFNHGGILPYVIRNL  312



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTGHERYSIDLPS I+E
Sbjct  796  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYSIDLPSKISE  855

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGI PYVIR L KQ
Sbjct  856  IRPGQDVTVTTDNGKSFTCTVRFDTEVELDYFNHGGILPYVIRNLIKQ  903



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTGHERY+IDLPS I++
Sbjct  894   GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPSKISD  953

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
             IRPGQDVTV TD+GK FTCTVRFDTEVELAYFNHGGI PYVIRQL+KQ
Sbjct  954   IRPGQDVTVVTDSGKQFTCTVRFDTEVELAYFNHGGILPYVIRQLTKQ  1001



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDADSLGLTGHERY+I LP++I+E
Sbjct  879  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLTGHERYTIHLPTDISE  938

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  939  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  986



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI KSFERI RSNLVGMGI+PLCFKAGEDA++LGLTGHERY+IDLPSNI++
Sbjct  831  GPMLLGVKAVITKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGHERYTIDLPSNISD  890

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PY IR L KQ
Sbjct  891  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYAIRNLIKQ  938



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTGHERYSIDLPS I+E
Sbjct  872  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYSIDLPSKISE  931

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGI PYVIR L KQ
Sbjct  932  IRPGQDVTVTTDNGKSFTCTVRFDTEVELDYFNHGGILPYVIRNLIKQ  979



>gb|KDO54658.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=795

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHER+SIDLPS I+E
Sbjct  688  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISE  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGI P+VIR L KQ
Sbjct  748  IRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLIKQ  795



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFK+GEDAD+LGLTGHERY+IDLPSNI+E
Sbjct  877  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSNISE  936

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV T  GK+FTCTVRFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  937  IRPGQDVTVTTTTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLIKQ  984



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPS+I+E
Sbjct  887  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSSISE  946

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGI  YVIR LSKQ
Sbjct  947  IKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYVIRNLSKQ  994



>gb|ACU19654.1| unknown [Glycine max]
Length=130

 Score =   187 bits (474),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPSN+NE
Sbjct  21   GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGQERYTIDLPSNVNE  80

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IR GQDVTV TD GK+F  T+RFDTEVELAYFNHGGI  YVIR L
Sbjct  81   IRSGQDVTVVTDTGKSFVSTLRFDTEVELAYFNHGGILQYVIRNL  125



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  791  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  851  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  898



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP+NI+E
Sbjct  879  GPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTNISE  938

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  939  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  986



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAG+DAD+LGLTGHERY+IDLPSNI+E
Sbjct  888  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLTGHERYTIDLPSNISE  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDT VEL YFNHGGI PY IR L KQ
Sbjct  948  IRPGQDVTVTTDNGKSFTCTVRFDTAVELEYFNHGGILPYAIRNLMKQ  995



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTGHERY+I LP+NI E
Sbjct  891  GPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGHERYTIHLPTNILE  950

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAY+NHGGI PYVIR LSKQ
Sbjct  951  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYYNHGGILPYVIRNLSKQ  998



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I+LP++I+E
Sbjct  886  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTINLPTDISE  945

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  946  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  993



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHER+SIDLPS I+E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGI P+VIR L KQ
Sbjct  851  IRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLIKQ  898



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK G+DAD+LGLTGHERYSIDLPSNI E
Sbjct  892  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKDGQDADTLGLTGHERYSIDLPSNIGE  951

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+F CTVRFDTEVELAYFNHGGI PY IR L KQ
Sbjct  952  IRPGQDVTVTTDNGKSFICTVRFDTEVELAYFNHGGILPYAIRNLMKQ  999



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHER+SIDLPS I+E
Sbjct  889  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISE  948

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGI P+VIR L KQ
Sbjct  949  IRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLIKQ  996



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTGHERY+I+LPS INE
Sbjct  811  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIELPSIINE  870

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCT RFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  871  IRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHGGILPYVIRNLIKQ  918



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  884  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  943

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  944  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  991



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGED D+LGLTGHERYSIDLPSNI+E
Sbjct  889  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDTDTLGLTGHERYSIDLPSNISE  948

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+FTCT RFDTEVELAYFNHGGI PYVIR L  Q
Sbjct  949  IRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHGGILPYVIRNLINQ  996



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  883  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  942

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  943  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  990



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  884  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  943

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  944  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  991



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLP++I+E
Sbjct  776  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPNSISE  835

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGI PYVIR L +Q
Sbjct  836  IRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLIEQ  883



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  884  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  943

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  944  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  991



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  887  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  946

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  947  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  994



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  888  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  948  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  995



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAG+DAD+LGLTGHERYSIDLPSNI+E
Sbjct  894   GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLTGHERYSIDLPSNIDE  953

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
             IRPGQDVTV TDNGK+F CTVRFDTEVELAYFNHGGI  Y IR L KQ
Sbjct  954   IRPGQDVTVTTDNGKSFICTVRFDTEVELAYFNHGGILQYAIRNLMKQ  1001



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTGHERY+I+LPS INE
Sbjct  877  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIELPSIINE  936

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCT RFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  937  IRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHGGILPYVIRNLIKQ  984



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTG ERY+IDLP NI+E
Sbjct  888  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISE  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGI  YVIRQL+KQ
Sbjct  948  IRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYVIRQLTKQ  995



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHER+SIDLPS I+E
Sbjct  893  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISE  952

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGI P+VIR L KQ
Sbjct  953  IRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLIKQ  1000



>sp|O04916.1|ACOC_SOLTU RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase, partial [Solanum tuberosum]
 emb|CAA65735.1| aconitate hydratase [Solanum tuberosum]
Length=616

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTG ERY+IDLP NI+E
Sbjct  509  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISE  568

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGI  YVIRQL+++
Sbjct  569  IRPGQDVTVQTDTGKSFTCIVRFDTEVELAYFNHGGILQYVIRQLTQR  616



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS I +
Sbjct  826  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSKITD  885

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  886  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  933



>emb|CAN62964.1| hypothetical protein VITISV_029521 [Vitis vinifera]
Length=520

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKA IAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTGHERY+IDLPSNI+E
Sbjct  413  GPMLLGVKAXIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPSNIDE  472

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV T+ GK+F CT RFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  473  IRPGQDITVTTNTGKSFICTARFDTEVELAYFNHGGILPYVIRNLIKQ  520



>ref|NP_001159192.1| uncharacterized protein LOC100304277 [Zea mays]
 gb|ACN25362.1| unknown [Zea mays]
Length=287

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLC+KAGEDAD+LGLTGHERY++ LP+N++E
Sbjct  180  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKAGEDADTLGLTGHERYTVHLPTNVSE  239

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGI PYV R++++Q
Sbjct  240  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVARKIAEQ  287



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  884  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  943

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  944  IKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  991



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAG+DAD+LGLTGHERY+IDLPSNI+E
Sbjct  888  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADTLGLTGHERYTIDLPSNISE  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCT RFDT VEL YFNHGGI PY IR L KQ
Sbjct  948  IRPGQDVTVTTDNGKSFTCTARFDTAVELEYFNHGGILPYAIRSLMKQ  995



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFK+GEDAD+LGLTGHERY+IDLPSNI+E
Sbjct  877  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSNISE  936

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV T+ GK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  937  IRPGQDVTVTTNTGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  984



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS I +
Sbjct  883  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSKITD  942

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  943  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  990



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFK+GEDAD+LGLTGHERY+IDLPSNI+E
Sbjct  877  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSNISE  936

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV T+ GK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  937  IRPGQDVTVTTNTGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  984



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  888  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+F+CTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  948  IRPGQDVTVTTDNGKSFSCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  995



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPMLLGVKAVIAKSFERI RSNLVGMG++PLCFK G+DADSLGLTGHERY+IDLPSNINE
Sbjct  901   GPMLLGVKAVIAKSFERIHRSNLVGMGVIPLCFKPGQDADSLGLTGHERYTIDLPSNINE  960

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
             IRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGI PYVIR L
Sbjct  961   IRPGQDVTVVTDAGKSFTCTVRFDTEVELAYFNHGGILPYVIRNL  1005



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTG ERY+IDLP NI+E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGI  YVIRQL+K 
Sbjct  851  IRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYVIRQLTKH  898



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHER++I LP++I+E
Sbjct  881  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERFTIHLPTDISE  940

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  941  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  988



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTG ERY+IDLP NI+E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGI  YVIRQL+K 
Sbjct  851  IRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYVIRQLTKH  898



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I++
Sbjct  772  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISD  831

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  832  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  879



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLC+K+GEDAD+LGLTGHERY+IDLPS I+E
Sbjct  872  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCYKSGEDADTLGLTGHERYTIDLPSKISE  931

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDV V TDNGK+FTC VRFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  932  IRPGQDVKVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLIKQ  979



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP  I+E
Sbjct  889  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPRKIDE  948

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGI PYVIR L +Q
Sbjct  949  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIRQ  996



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPSNI  
Sbjct  888  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSNITH  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDV+V T+NGK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  948  IRPGQDVSVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  995



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I++
Sbjct  866  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISD  925

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  926  IRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  973



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDA++LGLTGHERY+IDLP  I+E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETLGLTGHERYTIDLPEKISE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I PGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGI PYVIRQL +Q
Sbjct  851  IHPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQLIQQ  898



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDADSLGLTGHERY+IDLP +I++
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLTGHERYTIDLPDDISK  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  851  IRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  898



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDA++LGLTGHERY+IDLP  I+E
Sbjct  882  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETLGLTGHERYTIDLPEKISE  941

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I PGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGI PYVIRQL +Q
Sbjct  942  IHPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQLIQQ  989



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFK+GEDAD+LGLTGHERY+IDLPS++++
Sbjct  889  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSSVSD  948

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TVKTD GK FTCTVRFDTEVELAYFNHGGI  YVIRQL+ +
Sbjct  949  IRPGQDITVKTDTGKQFTCTVRFDTEVELAYFNHGGILQYVIRQLAAK  996



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  887  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  946

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDV+V TDNGK+F CTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  947  IRPGQDVSVTTDNGKSFNCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  994



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTGHERY+IDLPSNI+E
Sbjct  880  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPSNIDE  939

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV T+ GK+F CT RFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  940  IRPGQDITVTTNTGKSFICTARFDTEVELAYFNHGGILPYVIRNLIKQ  987



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDA++ GLTGHERY+IDLP NI+E
Sbjct  878  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETHGLTGHERYTIDLPKNISE  937

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGI PYVIRQL
Sbjct  938  IRPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYVIRQL  982



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLL +KAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHER+SIDLPS I+E
Sbjct  889  GPMLLVIKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISE  948

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGI P+VIR L KQ
Sbjct  949  IRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLIKQ  996



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML+GVKAVIAKSFERI RSNLVGMGI+PLCFK GEDADSLGLTGHERYSIDLP+ I+E
Sbjct  886  GPMLVGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGHERYSIDLPNKISE  945

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+FTCTVRFDTEVELAYF+HGGI P+VIR L+K+
Sbjct  946  IRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLNKE  993



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK G+DADSLGLTGHE Y+IDLPSNINE
Sbjct  900   GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDADSLGLTGHELYTIDLPSNINE  959

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
             IRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGI PYVIR L
Sbjct  960   IRPGQDVTVVTDAGKSFTCTVRFDTEVELAYFNHGGILPYVIRSL  1004



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDADSLGLTGHERYSIDLP+ I+E
Sbjct  886  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGHERYSIDLPNKISE  945

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+FTCTVRFDTEVELAYF+HGGI P+VIR L+++
Sbjct  946  IRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLNRE  993



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I++
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISD  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV T+NGK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  851  IRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  898



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPML GVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPS I+E
Sbjct  902   GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYNIDLPSKISE  961

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
             IRPGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGI PY IR L  Q
Sbjct  962   IRPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILPYAIRNLINQ  1009



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDAD+LGLTG ERY+IDLP NI+E
Sbjct  890  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISE  949

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGI  YVIRQL+++
Sbjct  950  IRPGQDVTVQTDTGKSFTCIVRFDTEVELAYFNHGGILQYVIRQLTQR  997



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I++
Sbjct  878  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISD  937

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV T+NGK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  938  IRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  985



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I++
Sbjct  885  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISD  944

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV T+NGK+FTCTVRFDTEVELAYFN+GGI PYVIR L KQ
Sbjct  945  IRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYVIRNLIKQ  992



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK G+DAD+LGL+GHERY+IDLPSNI+E
Sbjct  889  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDADTLGLSGHERYTIDLPSNISE  948

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSK  252
            I+PGQDVTV TDNGK+FTCT RFDTEVEL YFNHGGI PYVIR L K
Sbjct  949  IKPGQDVTVTTDNGKSFTCTARFDTEVELEYFNHGGILPYVIRNLMK  995



>gb|KEH27599.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=797

 Score =   196 bits (497),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS++NE
Sbjct  688  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSSVNE  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQD+TV TDNGKTF+CT+RFDTEVELAYFNHGGI  Y IR L
Sbjct  748  IRPGQDITVVTDNGKTFSCTLRFDTEVELAYFNHGGILQYAIRNL  792



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPML GVKAVIAKSFERI RSNLVGMG++PLCFKAGEDAD+LGLTGHERY+IDLPS ++E
Sbjct  908   GPMLQGVKAVIAKSFERIHRSNLVGMGVIPLCFKAGEDADTLGLTGHERYTIDLPSKVSE  967

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSK  252
             IRPGQD+TV TD GK+FTCT+RFDTEVELAYF+HGGI PYVIRQL K
Sbjct  968   IRPGQDITVTTDTGKSFTCTLRFDTEVELAYFDHGGILPYVIRQLMK  1014



>gb|KJB62843.1| hypothetical protein B456_009G439700, partial [Gossypium raimondii]
Length=417

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            G MLLGVKAVI KSFERI RSNLVGMGI+PLCFK GEDADSLGLTGHERYSIDLP+ I+E
Sbjct  310  GQMLLGVKAVITKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGHERYSIDLPNKISE  369

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV T  GK+FTCTVRFDTEVELAYF+HGGI P+VIR L+K+
Sbjct  370  IRPGQDVTVTTVTGKSFTCTVRFDTEVELAYFDHGGILPFVIRNLNKE  417



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS++NE
Sbjct  792  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSSVNE  851

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQD+TV TDNGKTF+CT+RFDTEVELAYFNHGGI  Y IR L
Sbjct  852  IRPGQDITVVTDNGKTFSCTLRFDTEVELAYFNHGGILQYAIRNL  896



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNLVGMGI+PLCFK+GEDADSLGLTG ERY+I LP++I+E
Sbjct  874  GPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLTGKERYTIHLPTDISE  933

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  934  IRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  981



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHERYSI+LPSN++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYSINLPSNVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGI PYVIR L
Sbjct  851  IRPGQDVTVVTDSGKSFTCTVRFDTEVELAYFDHGGILPYVIRNL  895



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTG ERY+IDLPS ++E
Sbjct  885  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGQERYTIDLPSKVSE  944

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGI PYVIR L K 
Sbjct  945  IRPGQDVTVVTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLMKH  992



>ref|NP_001159229.1| uncharacterized protein LOC100304315 [Zea mays]
 gb|ACN25517.1| unknown [Zea mays]
 gb|AFW89612.1| hypothetical protein ZEAMMB73_646589 [Zea mays]
Length=685

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+N++E
Sbjct  578  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTNVSE  637

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGI PYVIR++++Q
Sbjct  638  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVIRKIAEQ  685



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+I LP++I+E
Sbjct  888  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISE  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I P QDVTV TDNGK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  948  ISPCQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  995



>gb|KDO62732.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=795

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGL GHERY+I+LP+ ++E
Sbjct  688  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLAGHERYTINLPNKVSE  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGI PYVIR L KQ
Sbjct  748  IRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNLIKQ  795



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTG ERY+I LP++I+E
Sbjct  870  GPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGKERYTIHLPTDISE  929

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGI PYVIR LSKQ
Sbjct  930  IRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSKQ  977



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLPS ++E
Sbjct  868  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSTVSE  927

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TD+GK+FTCT RFDTEVELAYF+HGGI PYVIR L
Sbjct  928  IRPGQDVTVVTDSGKSFTCTARFDTEVELAYFDHGGILPYVIRNL  972



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTGHERY+IDLP+ I++
Sbjct  791  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPTKISD  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGI  YVIR L+KQ
Sbjct  851  IRPGQDITVTTDNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLTKQ  898



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGL GHERY+I+LP+ ++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLAGHERYTINLPNKVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGI PYVIR L KQ
Sbjct  851  IRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNLIKQ  898



>gb|EMS48231.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=860

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGIVPLCFKAGEDAD+LGLTGHERY+I LP+++NE
Sbjct  752  GPMLQGVKAVIAKSFERIHRSNLAGMGIVPLCFKAGEDADTLGLTGHERYTIQLPTDVNE  811

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVELAY+ HGGI PYVIR+++ +
Sbjct  812  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYTHGGILPYVIRKIAAE  859



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS ++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSCVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TD+G++FTCTVRFDTEVELAYFNHGGI  YVIR L
Sbjct  851  IRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHGGILQYVIRNL  895



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGL GHERY+I+LP+ ++E
Sbjct  895   GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLAGHERYTINLPNKVSE  954

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
             IRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGI PYVIR L KQ
Sbjct  955   IRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNLIKQ  1002



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+N++E
Sbjct  882  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTNVSE  941

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGI PYVIR++++Q
Sbjct  942  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVIRKIAEQ  989



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 101/110 (92%), Gaps = 2/110 (2%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDAD+LGLTGHERY+IDLP+ ++E
Sbjct  791  GPVLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPNTVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL--SKQ  249
            IRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGI  YVIR L  SKQ
Sbjct  851  IRPGQDVTVATDCGKSFTCTVRFDTEVELAYFNHGGILQYVIRNLIGSKQ  900



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I+E
Sbjct  872  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISE  931

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TD GK+FTCT RFDTEVEL YFNHGGI PYVIR L K+
Sbjct  932  IKPGQDVTVTTDTGKSFTCTARFDTEVELEYFNHGGILPYVIRNLIKK  979



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GED ++LGLTGHERY+IDLP +I++
Sbjct  910   GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDTETLGLTGHERYTIDLPHSISD  969

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
             IRPGQD+TV TDNG++FTC +RFDTEVELAYF+HGGI PYVIR LSKQ
Sbjct  970   IRPGQDITVTTDNGRSFTCILRFDTEVELAYFDHGGILPYVIRNLSKQ  1017



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 2/110 (2%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKA IAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS ++E
Sbjct  791  GPMLLGVKAAIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSCVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL--SKQ  249
            IRPGQDVTV TD+G++FTCTVRFDTEVELAYFNHGGI  YVIR L  SKQ
Sbjct  851  IRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHGGILQYVIRNLIGSKQ  900



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNLVGMGI+PLCFK+GEDA+SLGLTG ERY+I LP++I+E
Sbjct  873  GPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLTGKERYTIHLPTDISE  932

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGI PYVIR LS+Q
Sbjct  933  IRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYVIRNLSRQ  980



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHERY+IDLP  I++
Sbjct  957   GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAEALGLTGHERYTIDLPQRISD  1016

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSK  252
             IRPGQD+TV TD+GK+FTCT+RFDTEVELAYF+HGGI PYVIR LSK
Sbjct  1017  IRPGQDLTVTTDSGKSFTCTLRFDTEVELAYFDHGGILPYVIRNLSK  1063



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 2/110 (2%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKA IAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLPS ++E
Sbjct  820  GPMLLGVKAAIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSCVSE  879

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL--SKQ  249
            IRPGQDVTV TD+G++FTCTVRFDTEVELAYFNHGGI  YVIR L  SKQ
Sbjct  880  IRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHGGILQYVIRNLIGSKQ  929



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERY+I+LP++++E
Sbjct  749  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTINLPTDVSE  808

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLS  255
            IRPGQDVT+ TDN K+FTC +RFDTEVELAY+NHGGI PYVIR ++
Sbjct  809  IRPGQDVTISTDNDKSFTCILRFDTEVELAYYNHGGILPYVIRNMA  854



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLC+K GEDAD+LGLTGHER++IDLPS I+E
Sbjct  872  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCYKPGEDADTLGLTGHERFTIDLPSKISE  931

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDV V TD+GK+FTC  RFDTEVELAYFNHGGI PYVIR L KQ
Sbjct  932  IKPGQDVKVTTDSGKSFTCIARFDTEVELAYFNHGGILPYVIRNLIKQ  979



>tpg|DAA43249.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=685

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLC+KAGEDAD+LGLTGHERY++ LP+N++E
Sbjct  578  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKAGEDADTLGLTGHERYTVHLPTNVSE  637

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGI PYV R++++Q
Sbjct  638  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVARKIAEQ  685



>ref|XP_008785076.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=437

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAV+AKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHERY+I+LP+++++
Sbjct  328  GPMLLGVKAVVAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPNSVSD  387

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQDVTV TDNGK F CTVRFDTEVELAY+NHGGI P+VIR L
Sbjct  388  IKPGQDVTVVTDNGKQFACTVRFDTEVELAYYNHGGILPFVIRNL  432



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS++ E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETFGLTGHERYNIDLPSSVAE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TDNGK+FTCT+RFDTEVELAYF+HGGI P+VIR L
Sbjct  851  IRPGQDVTVTTDNGKSFTCTLRFDTEVELAYFDHGGILPFVIRNL  895



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+N++E
Sbjct  884  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTNVSE  943

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGI PYV R++++Q
Sbjct  944  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYVTRKIAEQ  991



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGV+AVIAKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHERY+IDLPS I+E
Sbjct  890  GPMLLGVQAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTIDLPSKISE  949

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+FTCTVRFDTEVEL YFN+GGI PYVIR L K 
Sbjct  950  IRPGQDVTVVTDTGKSFTCTVRFDTEVELEYFNNGGILPYVIRNLMKH  997



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLC+K GEDADSLGLTGHER++I+LP+++++
Sbjct  878  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCYKTGEDADSLGLTGHERFTINLPTDVSK  937

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVT+ TDNGK+F+CT+RFDTEVELAY+NHGGI PYVIR L+ Q
Sbjct  938  IRPGQDVTITTDNGKSFSCTLRFDTEVELAYYNHGGILPYVIRSLAGQ  985



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHERY+I+LP++++E
Sbjct  828  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERYTINLPTDVSE  887

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLS  255
            IRPGQDVT+ TDN K+FTC +RFDTEVELAY+NHGGI PYVIR ++
Sbjct  888  IRPGQDVTITTDNDKSFTCILRFDTEVELAYYNHGGILPYVIRNMA  933



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTGHERYSIDLP++++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLTGHERYSIDLPNSVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TDNGK+FTCT+RFDTEVELAYF+HGGI  YVIR L
Sbjct  851  IRPGQDVKVLTDNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNL  895



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   192 bits (487),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI R NLVGMGI+PLCFK GEDAD+LGLTGHERY+IDLP  I+E
Sbjct  883  GPMLLGVKAVIAKSFERIHRGNLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPDKISE  942

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQ+V VKTD GK+F C VRFDTEVELAYF+HGGI PYVIR LSK+
Sbjct  943  IRPGQEVGVKTDTGKSFACRVRFDTEVELAYFDHGGILPYVIRNLSKE  990



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score =   193 bits (491),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPML GVKAVIAKSFERI RSNL GMGIVPLCFKAGEDAD+LGLTGHERY+I LP+++NE
Sbjct  1859  GPMLQGVKAVIAKSFERIHRSNLAGMGIVPLCFKAGEDADTLGLTGHERYTIQLPTDVNE  1918

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
             I+PGQDVTV TDNGK+FTCT+RFDTEVELAY+ HGGI PYVIR+++ +
Sbjct  1919  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYTHGGILPYVIRKIAAE  1966



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHERY+IDLPS+I +
Sbjct  894  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTIDLPSSITD  953

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQD+TV  DNGK+FTCT+RFDTEVELAYFNHGGI P+VIR L
Sbjct  954  IRPGQDITVVVDNGKSFTCTLRFDTEVELAYFNHGGILPFVIRNL  998



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDADSLGLTGHERY+IDLPS++NE
Sbjct  792  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADSLGLTGHERYTIDLPSDVNE  851

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TD GKTF  T+RFDTEVELAYFNHGGI  Y IR L
Sbjct  852  IRPGQDVTVVTDTGKTFVSTLRFDTEVELAYFNHGGILQYAIRNL  896



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHERY+I+LP N+++
Sbjct  886  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPDNVSD  945

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQDVTV TDNGK+FTCTVRFDTEVELAY+NHGGI P+VIR L
Sbjct  946  IKPGQDVTVVTDNGKSFTCTVRFDTEVELAYYNHGGILPFVIRNL  990



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDA++LGLTGHERY+I LPSN+++
Sbjct  877  GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLTGHERYTIHLPSNVSD  936

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSK  252
            I+PGQDVTV TD GK+FTCTVRFDTEVELAY+NHGGI PYVIR L K
Sbjct  937  IKPGQDVTVTTDTGKSFTCTVRFDTEVELAYYNHGGILPYVIRSLIK  983



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMG++PLCFK GEDA++LGLTGHERY+IDLPS+++E
Sbjct  868  GPMLLGVKAVIAKSFERIHRSNLVGMGVIPLCFKPGEDAETLGLTGHERYTIDLPSSVSE  927

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVT+ TD+GK+FTCT+RFDTEVELAYF+HGGI PYVIR L K 
Sbjct  928  IKPGQDVTMVTDDGKSFTCTLRFDTEVELAYFDHGGILPYVIRNLIKS  975



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPS+++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV TDNGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  851  IRPGQDITVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  898



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPS+++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV TDNGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  851  IRPGQDITVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  898



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPS+++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV TDNGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  851  IRPGQDITVVTDNGKSFICTLRFDTEVELAYFDHGGILQYVIRNLIKS  898



>sp|Q42669.1|ACOC_CUCMC RecName: Full=Aconitate hydratase; Short=Aconitase; AltName: 
Full=Citrate hydro-lyase, partial [Cucumis melo var. conomon]
 emb|CAA58047.1| aconitase [Cucumis melo]
Length=764

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHER++IDLPSN+ E
Sbjct  655  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFTIDLPSNVGE  714

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGI  YVIR L
Sbjct  715  IRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  759



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNL GMGIVPLCFKAGEDAD+LGLTGHERY+I LP+++NE
Sbjct  891  GPMLQGVKAVISKSFERIHRSNLAGMGIVPLCFKAGEDADTLGLTGHERYTIQLPTDVNE  950

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVE+AY+ HGGI PYVIR+++ +
Sbjct  951  IKPGQDVTVTTDNGKSFTCTLRFDTEVEIAYYTHGGILPYVIRKIAAE  998



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLCFKAGEDAD+LGLTGHERY+I LP+N++E
Sbjct  879  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTIHLPTNVSE  938

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TD GK+FTCT+RFDTEVELAY++HGGI PYV R++++Q
Sbjct  939  IKPGQDVTVTTDTGKSFTCTLRFDTEVELAYYDHGGILPYVTRKIAEQ  986



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+ LCFK GEDAD+LGL GHERY+I+LP+ ++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIILLCFKPGEDADTLGLAGHERYTINLPNKVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGI PYVIR L KQ
Sbjct  851  IRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYVIRNLIKQ  898



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAV+AKSFERI RSNLVGMGI+PLCFK+GEDA++LGLTGHERYS+DLPSN++E
Sbjct  790  GPMLLGVKAVMAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLTGHERYSLDLPSNVSE  849

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TDNGK FTCT+R+DTEVELAYF+HGGI  Y IR L
Sbjct  850  IRPGQDVTVVTDNGKQFTCTLRYDTEVELAYFDHGGILQYAIRNL  894



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHE YSIDLPSN++E
Sbjct  790  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHECYSIDLPSNVSE  849

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TDNGK+FTCT+RFDTEVELAYF+HGGI  Y IR L
Sbjct  850  IRPGQDVTVVTDNGKSFTCTLRFDTEVELAYFDHGGILQYAIRNL  894



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK G+DADSLGLTGHERY+IDLPSN+NE
Sbjct  792  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGDDADSLGLTGHERYTIDLPSNVNE  851

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGI  YVIR +
Sbjct  852  IRPGQDVTVVTDAGKSFVSTLRFDTEVELAYFNHGGILQYVIRNM  896



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDADSLGLTGHER++IDLPSN+ E
Sbjct  772  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERFTIDLPSNVGE  831

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGI  YVIR L
Sbjct  832  IRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  876



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTG ERY+IDLP  I+E
Sbjct  878  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGRERYTIDLPDKISE  937

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSK  252
            I+PGQDVTV TD GK+FTC  RFDTEVEL YFNHGGI PYVIR L+K
Sbjct  938  IKPGQDVTVTTDTGKSFTCKARFDTEVELEYFNHGGILPYVIRNLAK  984



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDADSLGLTGHER++IDLPSN+ E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERFTIDLPSNVGE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGI  YVIR L
Sbjct  851  IRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  895



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+P+CFKAGEDADSLGLTGHERY+I+LP+++ +
Sbjct  875  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPMCFKAGEDADSLGLTGHERYTINLPTDVGQ  934

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLS  255
            IRPGQDVT+ T++GK+FTC +RFDTEVELAY+NHGGI PYVIR ++
Sbjct  935  IRPGQDVTITTEDGKSFTCILRFDTEVELAYYNHGGILPYVIRNMA  980



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPML GVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDA++LGLTGHERY+IDLP   ++
Sbjct  903   GPMLQGVKAVIAKSFERIHRSNLVGMGILPLCFKAGEDAETLGLTGHERYTIDLPEKTSD  962

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
             I+PGQD+TV TDNGK+FTCT+RFDTEVEL YF+HGGI  YVIR LSKQ
Sbjct  963   IKPGQDITVTTDNGKSFTCTLRFDTEVELTYFDHGGILQYVIRNLSKQ  1010



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPSN+NE
Sbjct  792  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGQERYTIDLPSNVNE  851

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGI  YVIR L
Sbjct  852  IRPGQDVTVVTDTGKSFVSTLRFDTEVELAYFNHGGILQYVIRNL  896



>gb|ABK25210.1| unknown [Picea sitchensis]
Length=565

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNLVGMGI+PLCFK+GEDA+SLGLTGHERYSIDLP++I +
Sbjct  456  GPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLTGHERYSIDLPNDIAQ  515

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            ++PGQD+TV TD GK+FTC  RFDT+VEL YFNHGGI PYVIRQL
Sbjct  516  LKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHGGILPYVIRQL  560



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTG ERY+IDLP+  ++
Sbjct  904   GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGQERYTIDLPTKKSD  963

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
             IRPGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGI  YVIR LSKQ
Sbjct  964   IRPGQDITVTTDNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLSKQ  1011



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTGHER++IDLPSN+ E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFTIDLPSNVGE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGI  YVIR L
Sbjct  851  IRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  895



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDADSLGLTG ERY+I+LPS ++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  851  IRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  898



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNL GMGI+PLCFKAGEDA+SLGLTGHERY++ LP+ ++E
Sbjct  888  GPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAESLGLTGHERYTVHLPTKVSE  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  948  IRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  995



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLCFK+GEDAD+LGLTGHER+++ LP+N++E
Sbjct  800  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSE  859

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGI PYVIR++++Q
Sbjct  860  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKIAEQ  907



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHERY+I+LPS++++
Sbjct  888  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPSSVSD  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQDVTV TDNGK+FTC VRFDTEVELAY+NHGGI P+VIR L
Sbjct  948  IKPGQDVTVVTDNGKSFTCIVRFDTEVELAYYNHGGILPFVIRNL  992



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHERY+I+LPS++++
Sbjct  883  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPSSVSD  942

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQDVTV TDNGK+FTC VRFDTEVELAY+NHGGI P+VIR L
Sbjct  943  IKPGQDVTVVTDNGKSFTCIVRFDTEVELAYYNHGGILPFVIRNL  987



>ref|XP_008393748.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=795

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDADSLGLTG ERY+I+LPS ++E
Sbjct  688  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSE  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  748  IRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  795



>ref|XP_008344247.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=779

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDADSLGLTG ERY+I+LPS ++E
Sbjct  672  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSE  731

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  732  IRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  779



>gb|ADP03320.1| aconitate hydratase [Pinus pinaster]
Length=371

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNLVGMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I +
Sbjct  262  GPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQ  321

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            ++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GI PYV+RQL
Sbjct  322  LKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHE YSIDLPSN++E
Sbjct  790  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHECYSIDLPSNVSE  849

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGI  Y IR L
Sbjct  850  IRPGQDVTVVTDNGKSFACTLRFDTEVELAYFDHGGILQYAIRNL  894



>ref|XP_008363078.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase 1-like [Malus 
domestica]
Length=795

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDADSLGLTG ERY+I+LPS ++E
Sbjct  688  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSE  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  748  IRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  795



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTG ERY+IDLPS++ E
Sbjct  795  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLTGEERYTIDLPSSVGE  854

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  855  IKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  902



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNLVGMGIVPLCFK GEDAD+LGLTGHERY+I+LPSN+++
Sbjct  868  GPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKPGEDADTLGLTGHERYTINLPSNVSD  927

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQDVTV TD GK FTCTVRFDTEVELAY+ HGGI PYV+R L
Sbjct  928  IKPGQDVTVTTDTGKLFTCTVRFDTEVELAYYGHGGILPYVVRSL  972



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTG ERY+IDLPS++ E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLTGEERYTIDLPSSVGE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  851  IKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  898



>gb|KCW56578.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=797

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDA++LGLTGHERY+I+LP++++E
Sbjct  688  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLTGHERYTINLPNSVSE  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQD+TV+TDNGK+F CT+RFDTEVELAYF+HGGI  Y IR L
Sbjct  748  IRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHGGILQYAIRNL  792



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTG ERY+IDLPS++ E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADTLGLTGEERYTIDLPSSVGE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  851  IKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  898



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLCFK+GEDAD+LGLTGHER+++ LP+N++E
Sbjct  879  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSE  938

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGI PYVIR++++Q
Sbjct  939  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKIAEQ  986



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLCFK+GEDAD+LGLTGHER+++ LP+N++E
Sbjct  879  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSE  938

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGI PYVIR++++Q
Sbjct  939  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKIAEQ  986



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK G+DA++LGLTGHERY+IDLPS+++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAETLGLTGHERYTIDLPSSVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGI  Y IR L
Sbjct  851  IKPGQDITVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYAIRNL  895



>gb|ADP03143.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I++
Sbjct  262  GPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDISQ  321

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            ++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GI PYV+RQL
Sbjct  322  LKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>gb|ADP03120.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03121.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03122.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03125.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03127.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03128.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03129.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03130.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03131.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03135.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03137.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03138.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03140.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03145.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03147.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03148.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03150.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I++
Sbjct  262  GPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDISQ  321

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            ++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GI PYV+RQL
Sbjct  322  LKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK G+DA++LGLTGHERY+IDLPS+++E
Sbjct  809  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAETLGLTGHERYTIDLPSSVSE  868

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGI  Y IR L
Sbjct  869  IKPGQDITVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYAIRNL  913



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAK FERI RSNLVGMGI+PLCFK GEDADSLGLTG ERY+IDLPSN+NE
Sbjct  799  GPMLLGVKAVIAKGFERIHRSNLVGMGIIPLCFKPGEDADSLGLTGQERYTIDLPSNVNE  858

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGI  YVIR L
Sbjct  859  IRPGQDVTVVTDTGKSFVSTLRFDTEVELAYFNHGGILQYVIRNL  903



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+ +++
Sbjct  892  GPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSD  951

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  952  IRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  999



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTG E Y+IDLP+N++E
Sbjct  791  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIDLPNNVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQD+TV T+NGK+FTCT+RFDTEVELAYFNHGGI  YVIR L KQ
Sbjct  851  IKPGQDITVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  898



>ref|NP_001119125.1| aconitate hydratase 1 [Arabidopsis thaliana]
 gb|AEE86577.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=795

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFKAGEDA++LGLTG E Y+I+LP+N++E
Sbjct  688  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGQELYTIELPNNVSE  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGI  YVIR L KQ
Sbjct  748  IKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  795



>ref|XP_010438674.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=795

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++
Sbjct  688  GPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSD  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  748  IRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  795



>gb|ADP03134.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03139.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I +
Sbjct  262  GPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQ  321

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            ++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GI PYV+RQL
Sbjct  322  LKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLCFK+GEDAD+LGLTGHER+++ LP+N+++
Sbjct  799  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSD  858

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGI PYVIR++++Q
Sbjct  859  IKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYVIRKIAEQ  906



>gb|ADP03123.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03124.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03126.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03132.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03133.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03136.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03141.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03142.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03146.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03149.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03152.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03153.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I +
Sbjct  262  GPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQ  321

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            ++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GI PYV+RQL
Sbjct  322  LKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>gb|ADP03151.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I +
Sbjct  262  GPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQ  321

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            ++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GI PYV+RQL
Sbjct  322  LKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP LLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHER++IDLPSN+NE
Sbjct  792  GPKLLGVKAVISKSFERIHRSNLVGMGIIPLCFKDGEDAETLGLTGHERFTIDLPSNVNE  851

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQD+ V TDNGKTF CT+RFDTEVELAYFNHGGI  Y IR L
Sbjct  852  IRPGQDIAVVTDNGKTFLCTLRFDTEVELAYFNHGGILQYAIRNL  896



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP LLGVKAVIAKSFERI RSNLVGMGIVPLCFKAGEDA++LGLTGHE+Y+I+LPSN+ E
Sbjct  791  GPKLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETLGLTGHEQYNIELPSNVGE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQDVTV T+NGK+F+CT+RFDTEVELAYFNHGGI  YVIR L
Sbjct  851  IKPGQDVTVVTNNGKSFSCTLRFDTEVELAYFNHGGILQYVIRNL  895



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDA++LGLTGHERY+I+LP++++E
Sbjct  789  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLTGHERYTINLPNSVSE  848

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQD+TV+TDNGK+F CT+RFDTEVELAYF+HGGI  Y IR L
Sbjct  849  IRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHGGILQYAIRNL  893



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK+GEDA++LGLTGHERY+I+LP++++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAETLGLTGHERYTINLPNSVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQD+TV+TDNGK+F CT+RFDTEVELAYF+HGGI  Y IR L
Sbjct  851  IRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHGGILQYAIRNL  895



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK G+DADSLGLTG ERY+IDLPSN+NE
Sbjct  792  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGDDADSLGLTGQERYTIDLPSNVNE  851

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGI  YVIR +
Sbjct  852  IRPGQDVTVVTDAGKSFVSTLRFDTEVELAYFNHGGILQYVIRNM  896



>gb|ADP03144.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVI+KSFERI RSNL GMGI+PLCFK+GEDA+SLGLTGHERY+ID+P++I +
Sbjct  262  GPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITK  321

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            ++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GI PYV+RQL
Sbjct  322  LKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYVMRQL  366



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++
Sbjct  800  GPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSD  859

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  860  IRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  907



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFKAGEDA++LGLTG E Y+I+LP+N++E
Sbjct  812  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGQELYTIELPNNVSE  871

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGI  YVIR L KQ
Sbjct  872  IKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  919



>gb|KHG24816.1| Aconitate hydratase 1 -like protein [Gossypium arboreum]
Length=813

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 100/110 (91%), Gaps = 2/110 (2%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPM+LG+KAVIAKSFE+I RSNLVGMGI+PLCFK G+DAD+LGLTGHERY+I+LP++++E
Sbjct  704  GPMMLGIKAVIAKSFEQIHRSNLVGMGIIPLCFKPGDDADTLGLTGHERYTINLPNSVSE  763

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL--SKQ  249
            IRPGQDVTV TD  K+F+CTVRFDTEVELAYFNHGGI  YVIR L  SKQ
Sbjct  764  IRPGQDVTVATDTSKSFSCTVRFDTEVELAYFNHGGILQYVIRNLVGSKQ  813



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+ +++
Sbjct  888  GPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSD  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TD GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  948  IKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+ +++
Sbjct  888  GPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSD  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TD GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  948  IKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVI+KSFERI RSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ ++E
Sbjct  892  GPLLLGVKAVISKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSE  951

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  952  IRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  999



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   186 bits (471),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFKAGEDA++LGLTG E Y+I+LP+N++E
Sbjct  791  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGQELYTIELPNNVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGI  YVIR L KQ
Sbjct  851  IKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  898



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -2

Query  572   GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
             GPML GVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD+LGLTG+ERYSIDLP  +++
Sbjct  903   GPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADTLGLTGYERYSIDLPKKVSD  962

Query  392   IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSK  252
             +RPGQD+TV TD+GK+FTC VRFDT+VEL YF+HGGI PYVIR L+K
Sbjct  963   VRPGQDITVTTDDGKSFTCVVRFDTQVELTYFDHGGILPYVIRNLAK  1009



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   186 bits (471),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++E
Sbjct  791  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNNVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGI  YVIR L KQ
Sbjct  851  IKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  898



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   186 bits (471),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++E
Sbjct  794  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSE  853

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGI  YVIR L KQ
Sbjct  854  IKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  901



>gb|KDO71349.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=565

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++E
Sbjct  456  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSE  515

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGI  YVIR L
Sbjct  516  IRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  560



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAV+AKSFERI RSNLVGMGI+PLCFK GEDA++LGLTGHERY+I+LP+++++
Sbjct  889  GPMLLGVKAVVAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPNSVSD  948

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQDVTV TDNGK F CTVRFDTEVELAY+NHGGI P+VIR L
Sbjct  949  IKPGQDVTVVTDNGKQFACTVRFDTEVELAYYNHGGILPFVIRNL  993



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   186 bits (471),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++E
Sbjct  791  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGI  YVIR L KQ
Sbjct  851  IKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  898



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++
Sbjct  891  GPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSD  950

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLS  255
            IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGI PYVIR LS
Sbjct  951  IRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLS  996



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++
Sbjct  888  GPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSD  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  948  IRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++
Sbjct  890  GPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSD  949

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  950  IRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  997



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            G MLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDAD LGLTGHERY+IDLPS I E
Sbjct  776  GSMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADFLGLTGHERYTIDLPSKIKE  835

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSK  252
            IRPGQDVT+ TD GK+FTCT  FDT+VEL YF+HGGI PYVIR L+K
Sbjct  836  IRPGQDVTITTDTGKSFTCTAWFDTKVELEYFDHGGILPYVIRNLNK  882



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAV AKSFERI RSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+ +++
Sbjct  855  GPLLLGVKAVTAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSD  914

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  915  IRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSTK  962



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++LGLTG+E Y+IDLPS I++
Sbjct  884  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETLGLTGYESYTIDLPSCISD  943

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQD+TV TD+GK+FTCT+RFDTEVELAYFNHGGI P+VIR L
Sbjct  944  IRPGQDITVVTDSGKSFTCTLRFDTEVELAYFNHGGILPFVIRNL  988



>gb|KDO71348.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=702

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++E
Sbjct  593  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSE  652

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGI  YVIR L
Sbjct  653  IRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  697



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSFERI RSNL GMGI+PLCFK+GEDA++LGLTGHERY++ LP+ +++
Sbjct  888  GPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDAETLGLTGHERYTVHLPTKVSD  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  948  IRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVI+KSFERI RSNL GMGI+PLCFKAGEDAD+LGLTGHERY++ LP+ +++
Sbjct  888  GPLLLGVKAVISKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSD  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TD GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  948  IKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>gb|KDO71347.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=797

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++E
Sbjct  688  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSE  747

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGI  YVIR L
Sbjct  748  IRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  792



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++E
Sbjct  791  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNNVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVEL YFNHGGI  YVIR L KQ
Sbjct  851  IKPGQDVTVITNNGKSFTCTLRFDTEVELEYFNHGGILQYVIRNLIKQ  898



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++L LTG E Y+I+LPSN++E
Sbjct  791  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLRLTGEELYTIELPSNVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGI  YVIR L KQ
Sbjct  851  IKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  898



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++E
Sbjct  818  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSE  877

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGI  YVIR L KQ
Sbjct  878  IKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  925



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGI  YVIR L
Sbjct  851  IRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGI  YVIR L
Sbjct  851  IRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++L LTG E Y+I+LPSN++E
Sbjct  815  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLRLTGEELYTIELPSNVSE  874

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGI  YVIR L KQ
Sbjct  875  IKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHGGILQYVIRNLIKQ  922



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++E
Sbjct  772  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSE  831

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGI  YVIR L
Sbjct  832  IRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  876



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGI  YVIR L
Sbjct  851  IRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPML GVKAVIAKSFERI RSNL GMGI+PLCFKAGEDAD+LGLTGHER++I LP+N+++
Sbjct  886  GPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADTLGLTGHERFTIQLPTNVSD  945

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV TD GK+FTCT+RFDTEVELAY+ +GGI PYVIR+++ +
Sbjct  946  IKPGQDVTVTTDAGKSFTCTLRFDTEVELAYYTNGGILPYVIRKIAAE  993



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++E
Sbjct  780  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSE  839

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGI  YVIR L
Sbjct  840  IRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  884



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLPS+++E
Sbjct  789  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSE  848

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGI  YVIR L
Sbjct  849  IRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  893



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFE I RSNLVGMGI+PLCFK GEDAD+LGLTG+ERY+IDLP  I+E
Sbjct  892  GPMLLGVKAVIAKSFETIHRSNLVGMGIIPLCFKPGEDADTLGLTGNERYTIDLPDKISE  951

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TDNG +FTC  RFDT+VELAYF+HGGI  YVIR L K+
Sbjct  952  IRPGQDVTVTTDNGNSFTCIARFDTQVELAYFDHGGILQYVIRNLIKE  999



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP+LLGVKAVIAKSF RI RSNL GMGI+PLCFKAGEDA++LGLTGHERY++ LP+ +++
Sbjct  888  GPLLLGVKAVIAKSFGRIHRSNLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSD  947

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGI PYVIR LS +
Sbjct  948  IRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYVIRSLSAK  995



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP LLGVKAVIAKSFERI RSNLVGMGI+PLCFKAGEDA++LGLTG ERY+IDLPS ++E
Sbjct  791  GPKLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDAETLGLTGEERYTIDLPSTVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQD+TV T NGK+F CT+RFDTEVELAYF+HGGI  YVIR L K 
Sbjct  851  IKPGQDITVVTSNGKSFVCTLRFDTEVELAYFDHGGILQYVIRNLIKS  898



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGI+PLCFK GEDA++ GLTGHERY+IDLP++++E
Sbjct  791  GPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPNSVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            IRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGI  YVIR L
Sbjct  851  IRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYVIRNL  895



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+N++E
Sbjct  798  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSE  857

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FT T+RFDTEVELAYFNHGGI  YVIR L KQ
Sbjct  858  IKPGQDVTVITNNGKSFTSTLRFDTEVELAYFNHGGILQYVIRNLIKQ  905



>ref|XP_008660164.1| PREDICTED: aconitate hydratase, cytoplasmic [Zea mays]
Length=109

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  566  MLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIR  387
            MLLGVKAVIAKSFERI RSNLVGMG++PLCFK GEDADSLGLTGHERY+I LP+ ++EI+
Sbjct  1    MLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADSLGLTGHERYTIRLPTKVSEIQ  60

Query  386  PGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            PGQDV V +D GK+FTC +R DT VELA F+HGGI  YV+R L +Q
Sbjct  61   PGQDVQVLSDTGKSFTCKLRIDTMVELACFDHGGILHYVLRNLVRQ  106



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+ ++E
Sbjct  791  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNKVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGI  YVIR L KQ
Sbjct  851  IKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  898



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+ ++E
Sbjct  791  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNKVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGI  YVIR L KQ
Sbjct  851  IKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  898



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK GEDA++LGLTG E Y+I+LP+ ++E
Sbjct  791  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNKVSE  850

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGI  YVIR L KQ
Sbjct  851  IKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHGGILQYVIRNLIKQ  898



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMG++PL FK GEDA++LGLTGHE Y+IDLP  I++
Sbjct  873  GPMLLGVKAVIAKSFERIHRSNLVGMGLIPLSFKHGEDAETLGLTGHECYTIDLPQKISD  932

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            IRPGQDV V TD+GK+F CT+RFDTEVEL YF HGGI PYVIR L+KQ
Sbjct  933  IRPGQDVAVTTDSGKSFICTLRFDTEVELTYFEHGGILPYVIRNLTKQ  980



>gb|ACR36825.1| unknown [Zea mays]
Length=565

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVK+VIAKSFERI RSNLVGMGI+PLCF+AGEDADSLGLTG ERY+I LP++  E
Sbjct  456  GPMLLGVKSVIAKSFERIHRSNLVGMGIIPLCFQAGEDADSLGLTGRERYTIHLPTSTAE  515

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I PGQDVTV T +G++FTCT+R DT++E+ YFNHGGI PY++R L+ Q
Sbjct  516  ISPGQDVTVTTHDGRSFTCTLRLDTQLEVTYFNHGGILPYMVRNLAAQ  563



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMG++PLCFK GEDADSLGLTGHERY+I LP+N++E
Sbjct  868  GPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADSLGLTGHERYTIRLPTNVSE  927

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDV V TD GK+FTC +R DT VELAYF+HGGI  YV+R L KQ
Sbjct  928  IQPGQDVQVVTDTGKSFTCKLRIDTLVELAYFDHGGILHYVLRNLVKQ  975



>gb|ACK56134.1| putative aconitase, partial [Dimocarpus longan]
Length=167

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMGIVPLCFK GEDA++L LTGHERY+IDLPS+++E
Sbjct  78   GPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKPGEDAETLSLTGHERYTIDLPSSVSE  137

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELA  303
            IRPGQDV+V TDNGK+FTCTVRFDTEVELA
Sbjct  138  IRPGQDVSVVTDNGKSFTCTVRFDTEVELA  167



>gb|KEH38306.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=865

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 99/138 (72%), Gaps = 30/138 (22%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVI+KSFERI RSNLVGMGI+PLCFK+GEDAD+LGLTGHERY+IDLP+ I+E
Sbjct  728  GPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISE  787

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTE------------------------------VELA  303
            I+PGQDVTV TD GK+FTCT RFDTE                              VEL 
Sbjct  788  IKPGQDVTVTTDTGKSFTCTARFDTEDRAFIQHFEKLVSEIYIFPCASLLTCPYFQVELE  847

Query  302  YFNHGGIXPYVIRQLSKQ  249
            YFNHGGI PYVIR L K+
Sbjct  848  YFNHGGILPYVIRNLIKK  865



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMG++PLCFK GEDADSLGLTGHERY+I LP+N++E
Sbjct  870  GPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADSLGLTGHERYTIRLPTNVSE  929

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDV V +D GK+FTC +R DT VELAYF+HGGI  YV+R L +Q
Sbjct  930  IQPGQDVQVLSDTGKSFTCKLRIDTMVELAYFDHGGILHYVLRNLVRQ  977



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVKAVIAKSFERI RSNLVGMG++PLCFK GEDADSLGLTGHERY+I LP+N++E
Sbjct  872  GPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADSLGLTGHERYTIRLPTNVSE  931

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I+PGQDV V +D GK+FTC +R DT VELAYF+HGGI  YV+R L +Q
Sbjct  932  IQPGQDVQVLSDTGKSFTCKLRIDTMVELAYFDHGGILHYVLRNLVRQ  979



>emb|CAN83844.1| hypothetical protein VITISV_003004 [Vitis vinifera]
Length=885

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = -2

Query  557  GVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQ  378
            GVKAVIAKSFERI RSNLVGMGI+PLCFK G+DA++LGLTGHERY+IDLPS+++EI+PGQ
Sbjct  781  GVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAETLGLTGHERYTIDLPSSVSEIKPGQ  840

Query  377  DVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            D+TV TDNGK+FTCT+RFDTEVELAYF+HGGI  Y IR L
Sbjct  841  DITVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYAIRNL  880



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GP LLGVKAVIAKSFERI RSNLVGMGIVPLCFK GEDA++LGLTG E+Y+++LP+ INE
Sbjct  793  GPKLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKVGEDAETLGLTGFEQYNVELPNEINE  852

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQL  258
            I+PGQDV V TD+GK+F CT+RFDTEVELAYFNHGGI  YVIR L
Sbjct  853  IKPGQDVKVITDDGKSFVCTLRFDTEVELAYFNHGGILQYVIRNL  897



>ref|NP_001147431.1| aconitase2 [Zea mays]
 gb|ACG27495.1| aconitate hydratase, cytoplasmic [Zea mays]
 gb|ACN28210.1| unknown [Zea mays]
 gb|AFW57775.1| aconitate hydratase, cytoplasmic [Zea mays]
Length=905

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVK+VIAKSFERI RSNLVGMGI+PLCFKAGEDADSLGLTG ERY+I LP++  E
Sbjct  796  GPMLLGVKSVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGRERYTIHLPTSTAE  855

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            + PGQDVTV T +G++FTCT+R DT++E+ YFNHGGI PY++R L+ Q
Sbjct  856  LSPGQDVTVTTHDGRSFTCTLRLDTQLEVTYFNHGGILPYMVRNLAAQ  903



>ref|XP_008669747.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA38798.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=905

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVK+VIAKSFERI RSNLVGMGI+PLCF+AGEDADSLGLTG ERY+I LP++  E
Sbjct  796  GPMLLGVKSVIAKSFERIHRSNLVGMGIIPLCFQAGEDADSLGLTGRERYTIHLPTSTAE  855

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I PGQDVTV T +G++FTCT+R DT++E+ YFNHGGI PY++R L+ Q
Sbjct  856  ISPGQDVTVTTHDGRSFTCTLRLDTQLEVTYFNHGGILPYMVRNLAAQ  903



>ref|XP_008669746.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
 tpg|DAA38797.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=975

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  572  GPMLLGVKAVIAKSFERIXRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINE  393
            GPMLLGVK+VIAKSFERI RSNLVGMGI+PLCF+AGEDADSLGLTG ERY+I LP++  E
Sbjct  866  GPMLLGVKSVIAKSFERIHRSNLVGMGIIPLCFQAGEDADSLGLTGRERYTIHLPTSTAE  925

Query  392  IRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGIXPYVIRQLSKQ  249
            I PGQDVTV T +G++FTCT+R DT++E+ YFNHGGI PY++R L+ Q
Sbjct  926  ISPGQDVTVTTHDGRSFTCTLRLDTQLEVTYFNHGGILPYMVRNLAAQ  973



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750