BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021O05

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABK93253.1|  unknown                                                 167   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009590400.1|  PREDICTED: protein kinase APK1A, chloroplastic     174   8e-48   
ref|XP_009774717.1|  PREDICTED: protein kinase APK1A, chloroplast...    172   4e-47   Nicotiana sylvestris
ref|NP_001234409.1|  protein kinase 1b                                  171   7e-47   
ref|XP_011042707.1|  PREDICTED: protein kinase APK1A, chloroplastic     171   1e-46   Populus euphratica
ref|XP_011035315.1|  PREDICTED: protein kinase APK1B, chloroplast...    167   8e-46   Populus euphratica
ref|XP_002314178.2|  Protein kinase capable of phosphorylating ty...    168   1e-45   
ref|XP_011035309.1|  PREDICTED: protein kinase APK1A, chloroplast...    168   2e-45   Populus euphratica
ref|XP_011035314.1|  PREDICTED: protein kinase APK1A, chloroplast...    168   2e-45   Populus euphratica
ref|XP_002299870.1|  Protein kinase capable of phosphorylating ty...    167   3e-45   Populus trichocarpa [western balsam poplar]
emb|CDP09060.1|  unnamed protein product                                167   3e-45   Coffea canephora [robusta coffee]
emb|CBI16124.3|  unnamed protein product                                165   2e-44   Vitis vinifera
ref|XP_010043547.1|  PREDICTED: protein kinase APK1A, chloroplast...    164   4e-44   Eucalyptus grandis [rose gum]
ref|XP_011089469.1|  PREDICTED: protein kinase APK1B, chloroplastic     163   1e-43   Sesamum indicum [beniseed]
ref|XP_002283646.2|  PREDICTED: protein kinase APK1A, chloroplastic     163   3e-43   Vitis vinifera
ref|XP_004294513.1|  PREDICTED: protein kinase APK1A, chloroplastic     161   5e-43   Fragaria vesca subsp. vesca
ref|XP_010256925.1|  PREDICTED: protein kinase APK1A, chloroplastic     161   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_008240890.1|  PREDICTED: probable serine/threonine-protein...    160   1e-42   Prunus mume [ume]
gb|AFK40483.1|  unknown                                                 153   2e-42   Lotus japonicus
ref|XP_007016403.1|  Kinase 1B isoform 1                                158   1e-41   
ref|XP_002531440.1|  Protein kinase APK1A, chloroplast precursor,...    156   2e-41   
ref|XP_010264446.1|  PREDICTED: protein kinase APK1A, chloroplastic     157   2e-41   Nelumbo nucifera [Indian lotus]
gb|KDP20446.1|  hypothetical protein JCGZ_05291                         156   4e-41   Jatropha curcas
ref|XP_010106485.1|  Protein kinase APK1A                               156   5e-41   Morus notabilis
gb|EYU18976.1|  hypothetical protein MIMGU_mgv1a007452mg                155   8e-41   Erythranthe guttata [common monkey flower]
emb|CDP06608.1|  unnamed protein product                                155   2e-40   Coffea canephora [robusta coffee]
ref|XP_010920578.1|  PREDICTED: protein kinase APK1B, chloroplast...    155   2e-40   Elaeis guineensis
ref|XP_011077648.1|  PREDICTED: protein kinase APK1A, chloroplast...    154   2e-40   Sesamum indicum [beniseed]
ref|XP_008223637.1|  PREDICTED: protein kinase APK1A, chloroplast...    154   3e-40   Prunus mume [ume]
ref|XP_010922319.1|  PREDICTED: probable serine/threonine-protein...    154   4e-40   Elaeis guineensis
gb|KJB55870.1|  hypothetical protein B456_009G099000                    153   5e-40   Gossypium raimondii
gb|KHG10966.1|  Protein kinase APK1B, chloroplastic -like protein       154   5e-40   Gossypium arboreum [tree cotton]
gb|KHG20116.1|  Protein kinase APK1B, chloroplastic -like protein       153   6e-40   Gossypium arboreum [tree cotton]
ref|XP_007027015.1|  Kinase superfamily protein                         153   7e-40   
ref|XP_004302742.1|  PREDICTED: probable serine/threonine-protein...    153   8e-40   Fragaria vesca subsp. vesca
ref|XP_011094865.1|  PREDICTED: protein kinase APK1A, chloroplastic     152   1e-39   Sesamum indicum [beniseed]
ref|XP_002322956.2|  hypothetical protein POPTR_0016s11410g             153   1e-39   
gb|KJB55871.1|  hypothetical protein B456_009G099000                    153   1e-39   Gossypium raimondii
gb|KDO72843.1|  hypothetical protein CISIN_1g046897mg                   151   2e-39   Citrus sinensis [apfelsine]
ref|XP_010047712.1|  PREDICTED: protein kinase APK1B, chloroplast...    151   2e-39   Eucalyptus grandis [rose gum]
ref|XP_006424836.1|  hypothetical protein CICLE_v10028570mg             151   3e-39   Citrus clementina [clementine]
gb|KCW88940.1|  hypothetical protein EUGRSUZ_A01268                     151   3e-39   Eucalyptus grandis [rose gum]
ref|XP_010047703.1|  PREDICTED: probable serine/threonine-protein...    151   3e-39   Eucalyptus grandis [rose gum]
ref|XP_007205264.1|  hypothetical protein PRUPE_ppa006390mg             151   3e-39   
gb|KJB20072.1|  hypothetical protein B456_003G131600                    150   5e-39   Gossypium raimondii
gb|ABD95976.1|  serine/threonine kinase                                 145   5e-39   
gb|KJB83756.1|  hypothetical protein B456_013G263600                    150   6e-39   Gossypium raimondii
gb|KJB20070.1|  hypothetical protein B456_003G131600                    150   6e-39   Gossypium raimondii
ref|XP_009610451.1|  PREDICTED: probable serine/threonine-protein...    151   6e-39   
ref|XP_009610452.1|  PREDICTED: probable serine/threonine-protein...    150   6e-39   
ref|XP_011011763.1|  PREDICTED: probable serine/threonine-protein...    150   1e-38   Populus euphratica
ref|XP_009772470.1|  PREDICTED: probable serine/threonine-protein...    150   1e-38   Nicotiana sylvestris
gb|KHN33381.1|  Protein kinase APK1A, chloroplastic                     149   2e-38   Glycine soja [wild soybean]
ref|NP_001242670.1|  uncharacterized protein LOC100798404               149   2e-38   Glycine max [soybeans]
ref|NP_001240863.1|  protein kinase APK1A, chloroplastic-like           149   3e-38   Glycine max [soybeans]
gb|KJB36715.1|  hypothetical protein B456_006G172600                    148   5e-38   Gossypium raimondii
ref|XP_008387769.1|  PREDICTED: probable serine/threonine-protein...    147   5e-38   
ref|XP_010685751.1|  PREDICTED: protein kinase APK1B, chloroplast...    147   9e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009414410.1|  PREDICTED: probable serine/threonine-protein...    147   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685750.1|  PREDICTED: protein kinase APK1B, chloroplast...    147   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008357182.1|  PREDICTED: protein kinase APK1A, chloroplastic     147   2e-37   
dbj|BAE71262.1|  putative protein kinase APK1A                          147   2e-37   Trifolium pratense [peavine clover]
gb|KHF99777.1|  Protein kinase APK1B, chloroplastic -like protein       146   2e-37   Gossypium arboreum [tree cotton]
ref|XP_007133997.1|  hypothetical protein PHAVU_010G010300g             146   2e-37   Phaseolus vulgaris [French bean]
ref|XP_007150326.1|  hypothetical protein PHAVU_005G144200g             146   2e-37   Phaseolus vulgaris [French bean]
ref|XP_008464125.1|  PREDICTED: protein kinase APK1A, chloroplast...    145   3e-37   Cucumis melo [Oriental melon]
ref|XP_006429091.1|  hypothetical protein CICLE_v10011895mg             145   3e-37   Citrus clementina [clementine]
gb|KDO51148.1|  hypothetical protein CISIN_1g015909mg                   145   4e-37   Citrus sinensis [apfelsine]
ref|XP_004487006.1|  PREDICTED: protein kinase APK1B, chloroplast...    145   4e-37   Cicer arietinum [garbanzo]
ref|XP_006573305.1|  PREDICTED: protein kinase APK1B, chloroplast...    145   4e-37   Glycine max [soybeans]
ref|XP_004143118.1|  PREDICTED: protein kinase APK1A, chloroplast...    145   4e-37   
ref|XP_002533148.1|  Protein kinase APK1B, chloroplast precursor,...    145   4e-37   Ricinus communis
ref|XP_004487004.1|  PREDICTED: protein kinase APK1B, chloroplast...    145   5e-37   
ref|XP_008464124.1|  PREDICTED: protein kinase APK1A, chloroplast...    145   5e-37   Cucumis melo [Oriental melon]
ref|XP_006339025.1|  PREDICTED: protein kinase APK1A, chloroplast...    145   5e-37   Solanum tuberosum [potatoes]
ref|XP_004487002.1|  PREDICTED: protein kinase APK1B, chloroplast...    145   5e-37   
ref|XP_003544233.1|  PREDICTED: protein kinase APK1A, chloroplast...    145   5e-37   Glycine max [soybeans]
ref|XP_002266032.1|  PREDICTED: probable serine/threonine-protein...    145   6e-37   Vitis vinifera
gb|KDP35639.1|  hypothetical protein JCGZ_09077                         144   8e-37   Jatropha curcas
gb|AFK44181.1|  unknown                                                 144   1e-36   Lotus japonicus
ref|XP_009364395.1|  PREDICTED: protein kinase APK1A, chloroplast...    144   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_004165801.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    144   2e-36   
ref|XP_006576543.1|  PREDICTED: protein kinase APK1B, chloroplast...    143   2e-36   Glycine max [soybeans]
gb|KHN47889.1|  Protein kinase APK1B, chloroplastic                     144   2e-36   Glycine soja [wild soybean]
ref|XP_008784589.1|  PREDICTED: protein kinase APK1A, chloroplast...    144   2e-36   Phoenix dactylifera
gb|EYU41728.1|  hypothetical protein MIMGU_mgv1a007413mg                144   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_010557255.1|  PREDICTED: protein kinase APK1A, chloroplast...    144   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_008784588.1|  PREDICTED: protein kinase APK1A, chloroplast...    144   3e-36   Phoenix dactylifera
gb|KJB16969.1|  hypothetical protein B456_002G257500                    142   3e-36   Gossypium raimondii
ref|XP_003522100.1|  PREDICTED: protein kinase APK1B, chloroplast...    143   3e-36   Glycine max [soybeans]
ref|XP_010557252.1|  PREDICTED: protein kinase APK1A, chloroplast...    144   3e-36   
ref|XP_010111458.1|  putative serine/threonine-protein kinase NAK       143   3e-36   Morus notabilis
ref|XP_004249535.1|  PREDICTED: probable serine/threonine-protein...    143   3e-36   Solanum lycopersicum
ref|XP_010557253.1|  PREDICTED: protein kinase APK1A, chloroplast...    143   4e-36   
ref|XP_002534306.1|  Protein kinase APK1B, chloroplast precursor,...    142   4e-36   
ref|XP_009588344.1|  PREDICTED: probable serine/threonine-protein...    143   4e-36   Nicotiana tomentosiformis
emb|CDP00097.1|  unnamed protein product                                142   6e-36   Coffea canephora [robusta coffee]
ref|XP_009353659.1|  PREDICTED: protein kinase APK1A, chloroplast...    142   9e-36   Pyrus x bretschneideri [bai li]
ref|XP_009766459.1|  PREDICTED: probable serine/threonine-protein...    142   1e-35   Nicotiana sylvestris
ref|XP_007141880.1|  hypothetical protein PHAVU_008G233400g             141   2e-35   Phaseolus vulgaris [French bean]
ref|XP_008802716.1|  PREDICTED: protein kinase APK1B, chloroplast...    140   3e-35   Phoenix dactylifera
ref|XP_006846202.1|  hypothetical protein AMTR_s00012p00221000          140   3e-35   Amborella trichopoda
ref|NP_001274846.1|  protein kinase APK1B, chloroplastic-like           140   4e-35   Solanum tuberosum [potatoes]
ref|XP_004307510.1|  PREDICTED: protein kinase APK1A, chloroplast...    140   4e-35   Fragaria vesca subsp. vesca
ref|XP_009414323.1|  PREDICTED: probable serine/threonine-protein...    140   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414322.1|  PREDICTED: probable serine/threonine-protein...    140   7e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006435539.1|  hypothetical protein CICLE_v10031723mg             139   7e-35   Citrus clementina [clementine]
ref|XP_006486482.1|  PREDICTED: protein kinase APK1B, chloroplast...    139   7e-35   Citrus sinensis [apfelsine]
ref|XP_010521843.1|  PREDICTED: protein kinase APK1A, chloroplast...    139   7e-35   Tarenaya hassleriana [spider flower]
ref|XP_008343582.1|  PREDICTED: protein kinase APK1A, chloroplast...    139   8e-35   
ref|XP_002466186.1|  hypothetical protein SORBIDRAFT_01g003130          139   1e-34   Sorghum bicolor [broomcorn]
ref|XP_008354131.1|  PREDICTED: protein kinase APK1A, chloroplast...    139   1e-34   
ref|XP_003616404.1|  Serine/threonine protein kinase                    135   1e-34   
ref|XP_004490898.1|  PREDICTED: protein kinase APK1A, chloroplast...    138   2e-34   Cicer arietinum [garbanzo]
ref|XP_003519344.1|  PREDICTED: protein kinase APK1A, chloroplast...    138   2e-34   Glycine max [soybeans]
ref|XP_009343547.1|  PREDICTED: protein kinase APK1A, chloroplast...    137   3e-34   
gb|KEH39440.1|  kinase 1B                                               137   3e-34   Medicago truncatula
ref|XP_011091519.1|  PREDICTED: probable serine/threonine-protein...    137   4e-34   Sesamum indicum [beniseed]
dbj|BAJ98795.1|  predicted protein                                      134   7e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010558327.1|  PREDICTED: probable serine/threonine-protein...    136   7e-34   
ref|XP_009626085.1|  PREDICTED: protein kinase APK1A, chloroplastic     136   9e-34   Nicotiana tomentosiformis
ref|XP_007208720.1|  hypothetical protein PRUPE_ppa015273mg             135   9e-34   
ref|XP_006365700.1|  PREDICTED: protein kinase APK1A, chloroplast...    136   9e-34   Solanum tuberosum [potatoes]
ref|XP_009759469.1|  PREDICTED: protein kinase APK1A, chloroplast...    136   1e-33   Nicotiana sylvestris
ref|XP_010558326.1|  PREDICTED: probable serine/threonine-protein...    136   1e-33   Tarenaya hassleriana [spider flower]
ref|XP_010658583.1|  PREDICTED: protein kinase APK1A, chloroplast...    135   1e-33   Vitis vinifera
ref|XP_002283701.1|  PREDICTED: protein kinase APK1A, chloroplast...    135   2e-33   Vitis vinifera
ref|NP_001169424.1|  uncharacterized protein LOC100383293               130   2e-33   
ref|XP_008810614.1|  PREDICTED: protein kinase APK1A, chloroplastic     135   2e-33   Phoenix dactylifera
ref|XP_004246420.1|  PREDICTED: probable serine/threonine-protein...    135   2e-33   Solanum lycopersicum
gb|ACU19261.1|  unknown                                                 135   2e-33   Glycine max [soybeans]
gb|ACL52762.1|  unknown                                                 132   2e-33   Zea mays [maize]
gb|ACF85751.1|  unknown                                                 132   2e-33   Zea mays [maize]
ref|XP_010325852.1|  PREDICTED: probable serine/threonine-protein...    135   3e-33   Solanum lycopersicum
ref|XP_004490921.1|  PREDICTED: protein kinase APK1A, chloroplast...    130   3e-33   
ref|NP_001241128.1|  probable serine/threonine-protein kinase NAK...    135   3e-33   Glycine max [soybeans]
ref|XP_008233629.1|  PREDICTED: protein kinase APK1A, chloroplast...    134   4e-33   Prunus mume [ume]
ref|XP_004981243.1|  PREDICTED: protein kinase APK1B, chloroplast...    134   5e-33   Setaria italica
dbj|BAJ95924.1|  predicted protein                                      135   5e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009404596.1|  PREDICTED: protein kinase APK1A, chloroplast...    134   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010487686.1|  PREDICTED: protein kinase APK1A, chloroplast...    129   5e-33   
ref|XP_004236745.1|  PREDICTED: protein kinase APK1A, chloroplastic     134   6e-33   Solanum lycopersicum
gb|EYU33216.1|  hypothetical protein MIMGU_mgv1a011111mg                132   8e-33   Erythranthe guttata [common monkey flower]
ref|XP_003616403.1|  Serine/threonine protein kinase                    134   8e-33   Medicago truncatula
ref|XP_004239839.1|  PREDICTED: probable serine/threonine-protein...    134   9e-33   Solanum lycopersicum
ref|XP_002316286.1|  hypothetical protein POPTR_0010s21090g             134   1e-32   Populus trichocarpa [western balsam poplar]
gb|AET14353.1|  protein kinase 1b                                       134   1e-32   Glycine max [soybeans]
ref|XP_006590337.1|  PREDICTED: uncharacterized protein LOC100809...    133   1e-32   Glycine max [soybeans]
gb|EMS53821.1|  putative serine/threonine-protein kinase NAK            134   1e-32   Triticum urartu
ref|NP_001242718.1|  protein kinase APK1A, chloroplastic-like           133   1e-32   Glycine max [soybeans]
ref|XP_010231839.1|  PREDICTED: protein kinase APK1B, chloroplast...    133   1e-32   Brachypodium distachyon [annual false brome]
gb|ACG32116.1|  protein kinase APK1B                                    133   2e-32   Zea mays [maize]
gb|KDP44953.1|  hypothetical protein JCGZ_01453                         133   2e-32   Jatropha curcas
gb|ACF87678.1|  unknown                                                 133   2e-32   Zea mays [maize]
gb|EYU26593.1|  hypothetical protein MIMGU_mgv1a007265mg                133   2e-32   Erythranthe guttata [common monkey flower]
gb|KHN21952.1|  Protein kinase APK1A, chloroplastic                     133   2e-32   Glycine soja [wild soybean]
gb|KEH30160.1|  kinase 1B                                               133   2e-32   Medicago truncatula
ref|XP_002311169.2|  hypothetical protein POPTR_0008s05650g             132   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006379595.1|  hypothetical protein POPTR_0008s05650g             132   2e-32   
gb|AGU99598.1|  protein kinase                                          133   3e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004171473.1|  PREDICTED: probable serine/threonine-protein...    132   3e-32   
ref|XP_004142067.1|  PREDICTED: probable serine/threonine-protein...    132   3e-32   Cucumis sativus [cucumbers]
gb|EMT32058.1|  Protein kinase APK1A, chloroplastic                     132   3e-32   
gb|KHN32126.1|  Protein kinase APK1B, chloroplastic                     131   4e-32   Glycine soja [wild soybean]
ref|XP_010678047.1|  PREDICTED: probable serine/threonine-protein...    132   4e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006650809.1|  PREDICTED: protein kinase APK1B, chloroplast...    132   4e-32   
ref|XP_006591904.1|  PREDICTED: protein kinase APK1A, chloroplast...    132   4e-32   
gb|AFK41166.1|  unknown                                                 132   4e-32   Medicago truncatula
ref|XP_010678048.1|  PREDICTED: probable serine/threonine-protein...    132   4e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001145874.1|  uncharacterized protein LOC100279389               132   5e-32   Zea mays [maize]
ref|XP_008675653.1|  PREDICTED: probable serine/threonine-protein...    125   5e-32   Zea mays [maize]
ref|NP_001240055.1|  protein kinase APK1A, chloroplastic-like           132   5e-32   Glycine max [soybeans]
gb|ABC74580.1|  rust resistance gene ABC1041                            132   5e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001241432.1|  probable serine/threonine-protein kinase NAK...    132   5e-32   Glycine max [soybeans]
ref|XP_006654906.1|  PREDICTED: protein kinase APK1A, chloroplast...    132   5e-32   
ref|NP_001141912.1|  uncharacterized LOC100274061                       131   6e-32   Zea mays [maize]
ref|NP_001054444.1|  Os05g0110900                                       131   6e-32   
gb|EEC78387.1|  hypothetical protein OsI_18165                          131   7e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_008447952.1|  PREDICTED: probable serine/threonine-protein...    131   7e-32   Cucumis melo [Oriental melon]
ref|XP_007218037.1|  hypothetical protein PRUPE_ppa006035mg             130   9e-32   
ref|XP_004142761.1|  PREDICTED: protein kinase APK1A, chloroplast...    130   1e-31   Cucumis sativus [cucumbers]
ref|XP_007218038.1|  hypothetical protein PRUPE_ppa006035mg             130   1e-31   
ref|XP_002892407.1|  hypothetical protein ARALYDRAFT_470784             130   1e-31   
ref|XP_009412594.1|  PREDICTED: probable serine/threonine-protein...    130   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004492356.1|  PREDICTED: probable serine/threonine-protein...    130   1e-31   
ref|XP_009380641.1|  PREDICTED: probable serine/threonine-protein...    130   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007140532.1|  hypothetical protein PHAVU_008G120600g             130   2e-31   Phaseolus vulgaris [French bean]
ref|XP_011030315.1|  PREDICTED: protein kinase APK1A, chloroplast...    130   2e-31   Populus euphratica
gb|KEH30163.1|  kinase 1B                                               130   2e-31   Medicago truncatula
ref|XP_011027201.1|  PREDICTED: protein kinase APK1A, chloroplastic     130   2e-31   Populus euphratica
gb|AAO18450.1|  putative protein kinase                                 130   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006417790.1|  hypothetical protein EUTSA_v10007756mg             130   2e-31   Eutrema salsugineum [saltwater cress]
ref|NP_001051730.1|  Os03g0821900                                       130   2e-31   
ref|XP_010501359.1|  PREDICTED: protein kinase APK1A, chloroplast...    128   2e-31   
ref|XP_007009313.1|  Kinase superfamily protein isoform 2               129   2e-31   
ref|XP_010111129.1|  Protein kinase APK1A                               130   3e-31   
ref|XP_008464126.1|  PREDICTED: protein kinase APK1A, chloroplast...    129   4e-31   Cucumis melo [Oriental melon]
ref|XP_009118427.1|  PREDICTED: protein kinase APK1A, chloroplastic     129   4e-31   Brassica rapa
ref|NP_172237.1|  protein kinase APK1A                                  129   5e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542646.1|  PREDICTED: protein kinase APK1A, chloroplast...    129   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_010487664.1|  PREDICTED: protein kinase APK1A, chloroplastic     129   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006307674.1|  hypothetical protein CARUB_v10009302mg             129   6e-31   
ref|XP_007009312.1|  Kinase superfamily protein isoform 1               129   6e-31   Theobroma cacao [chocolate]
ref|XP_010543301.1|  PREDICTED: probable serine/threonine-protein...    128   6e-31   Tarenaya hassleriana [spider flower]
gb|ABK24429.1|  unknown                                                 129   6e-31   Picea sitchensis
ref|XP_008458866.1|  PREDICTED: protein kinase APK1A, chloroplastic     128   7e-31   Cucumis melo [Oriental melon]
ref|XP_009140954.1|  PREDICTED: protein kinase APK1B, chloroplastic     129   7e-31   Brassica rapa
ref|NP_001184929.1|  protein kinase APK1A                               129   7e-31   
ref|XP_004505862.1|  PREDICTED: protein kinase APK1B, chloroplast...    129   7e-31   
ref|XP_004505860.1|  PREDICTED: protein kinase APK1B, chloroplast...    129   7e-31   
ref|XP_010937617.1|  PREDICTED: protein kinase APK1A, chloroplast...    128   7e-31   Elaeis guineensis
emb|CDX77220.1|  BnaC04g40150D                                          128   7e-31   
gb|EPS63220.1|  protein kinase 1b                                       127   8e-31   Genlisea aurea
ref|XP_010475518.1|  PREDICTED: protein kinase APK1A, chloroplast...    128   8e-31   Camelina sativa [gold-of-pleasure]
gb|EPS59398.1|  hypothetical protein M569_15409                         128   8e-31   Genlisea aurea
ref|XP_001758139.1|  predicted protein                                  129   8e-31   
ref|XP_010937616.1|  PREDICTED: protein kinase APK1A, chloroplast...    128   9e-31   Elaeis guineensis
ref|XP_010030960.1|  PREDICTED: protein kinase APK1A, chloroplast...    128   9e-31   Eucalyptus grandis [rose gum]
ref|XP_006649840.1|  PREDICTED: protein kinase APK1B, chloroplast...    127   1e-30   Oryza brachyantha
ref|XP_010457947.1|  PREDICTED: protein kinase APK1A, chloroplast...    128   1e-30   Camelina sativa [gold-of-pleasure]
emb|CDY31741.1|  BnaA04g16770D                                          128   1e-30   Brassica napus [oilseed rape]
gb|AGP76187.1|  MLPK                                                    128   1e-30   Brassica rapa subsp. chinensis [bok-choy]
ref|NP_001049704.1|  Os03g0274800                                       127   1e-30   
ref|XP_006398693.1|  hypothetical protein EUTSA_v10013737mg             128   1e-30   Eutrema salsugineum [saltwater cress]
gb|ACJ85391.1|  unknown                                                 125   1e-30   Medicago truncatula
ref|XP_009357737.1|  PREDICTED: probable serine/threonine-protein...    127   1e-30   Pyrus x bretschneideri [bai li]
ref|NP_001149364.1|  protein kinase APK1A                               127   1e-30   Zea mays [maize]
ref|XP_010067409.1|  PREDICTED: probable serine/threonine-protein...    127   1e-30   Eucalyptus grandis [rose gum]
gb|ABF95246.1|  Protein kinase APK1B, chloroplast precursor, puta...    127   1e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ84948.1|  unknown                                                 127   2e-30   Medicago truncatula
gb|ACF79269.1|  unknown                                                 127   2e-30   Zea mays [maize]
gb|KEH30165.1|  kinase 1B                                               127   2e-30   Medicago truncatula
gb|KEH30164.1|  kinase 1B                                               127   2e-30   Medicago truncatula
gb|ACF82794.1|  unknown                                                 126   2e-30   Zea mays [maize]
ref|XP_006400026.1|  hypothetical protein EUTSA_v10013316mg             127   3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_008677038.1|  PREDICTED: protein kinase APK1A isoform X1         127   3e-30   Zea mays [maize]
ref|XP_001776496.1|  predicted protein                                  127   3e-30   
ref|XP_006294292.1|  hypothetical protein CARUB_v10023308mg             127   3e-30   Capsella rubella
ref|XP_008372383.1|  PREDICTED: serine/threonine-protein kinase B...    121   3e-30   
ref|XP_009122790.1|  PREDICTED: probable serine/threonine-protein...    126   3e-30   Brassica rapa
gb|KFK25744.1|  hypothetical protein AALP_AA8G154000                    127   3e-30   Arabis alpina [alpine rockcress]
gb|KDO82763.1|  hypothetical protein CISIN_1g010432mg                   125   3e-30   Citrus sinensis [apfelsine]
emb|CDY40347.1|  BnaA10g27210D                                          126   4e-30   Brassica napus [oilseed rape]
ref|XP_004143117.1|  PREDICTED: protein kinase APK1A, chloroplast...    126   4e-30   Cucumis sativus [cucumbers]
gb|KDO82764.1|  hypothetical protein CISIN_1g010432mg                   125   4e-30   Citrus sinensis [apfelsine]
ref|XP_010066960.1|  PREDICTED: probable receptor-like protein ki...    127   5e-30   Eucalyptus grandis [rose gum]
ref|XP_010066959.1|  PREDICTED: probable receptor-like protein ki...    127   5e-30   Eucalyptus grandis [rose gum]
ref|XP_010420160.1|  PREDICTED: probable receptor-like protein ki...    127   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010492331.1|  PREDICTED: probable receptor-like protein ki...    127   5e-30   Camelina sativa [gold-of-pleasure]
gb|KDP35640.1|  hypothetical protein JCGZ_09078                         125   5e-30   Jatropha curcas
emb|CDX70589.1|  BnaC03g06730D                                          126   5e-30   
gb|KHG15912.1|  Protein kinase APK1A, chloroplastic                     125   5e-30   Gossypium arboreum [tree cotton]
gb|KDP45058.1|  hypothetical protein JCGZ_01558                         125   6e-30   Jatropha curcas
ref|NP_197012.1|  probable receptor-like protein kinase                 126   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003633841.1|  PREDICTED: probable receptor-like protein ki...    126   7e-30   Vitis vinifera
gb|KFK24748.1|  hypothetical protein AALP_AA8G019600                    125   7e-30   Arabis alpina [alpine rockcress]
ref|XP_008457480.1|  PREDICTED: protein kinase APK1B, chloroplast...    125   7e-30   Cucumis melo [Oriental melon]
ref|XP_008457478.1|  PREDICTED: protein kinase APK1B, chloroplast...    125   7e-30   Cucumis melo [Oriental melon]
ref|XP_009131434.1|  PREDICTED: probable receptor-like protein ki...    126   8e-30   Brassica rapa
emb|CDY10453.1|  BnaCnng03540D                                          125   8e-30   Brassica napus [oilseed rape]
ref|XP_002871647.1|  hypothetical protein ARALYDRAFT_909477             126   8e-30   Arabidopsis lyrata subsp. lyrata
gb|AAF79545.1|AC022464_3  F22G5.5                                       125   8e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490647.1|  PREDICTED: probable serine/threonine-protein...    125   8e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008371735.1|  PREDICTED: probable serine/threonine-protein...    125   9e-30   Malus domestica [apple tree]
ref|XP_006409926.1|  hypothetical protein EUTSA_v10016722mg             125   9e-30   Eutrema salsugineum [saltwater cress]
emb|CDX95143.1|  BnaC05g05280D                                          125   9e-30   
emb|CDY06715.1|  BnaA10g04940D                                          125   9e-30   
ref|XP_009338575.1|  PREDICTED: probable receptor-like protein ki...    120   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_010227588.1|  PREDICTED: probable serine/threonine-protein...    125   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_006286494.1|  hypothetical protein CARUB_v10000765mg             125   1e-29   Capsella rubella
gb|KDO82762.1|  hypothetical protein CISIN_1g010432mg                   125   1e-29   Citrus sinensis [apfelsine]
ref|XP_003631281.1|  PREDICTED: probable receptor-like protein ki...    125   1e-29   Vitis vinifera
emb|CDY09904.1|  BnaC08g45470D                                          125   1e-29   Brassica napus [oilseed rape]
ref|XP_010470021.1|  PREDICTED: protein kinase APK1B, chloroplast...    125   1e-29   
ref|XP_007132065.1|  hypothetical protein PHAVU_011G064000g             125   1e-29   Phaseolus vulgaris [French bean]
gb|ACF83789.1|  unknown                                                 124   1e-29   Zea mays [maize]
ref|XP_010470020.1|  PREDICTED: protein kinase APK1B, chloroplast...    125   1e-29   Camelina sativa [gold-of-pleasure]
gb|AAL14379.1|  AT3g01300/T22N4_7                                       120   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470019.1|  PREDICTED: protein kinase APK1B, chloroplast...    125   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009366802.1|  PREDICTED: protein kinase APK1A, chloroplast...    122   1e-29   
ref|XP_002963908.1|  hypothetical protein SELMODRAFT_79963              124   1e-29   
ref|XP_010510560.1|  PREDICTED: protein kinase APK1B, chloroplast...    125   1e-29   
ref|XP_003551987.1|  PREDICTED: probable receptor-like protein ki...    125   1e-29   
ref|NP_001031439.1|  protein kinase APK1B                               125   1e-29   
ref|XP_010510562.1|  PREDICTED: protein kinase APK1B, chloroplast...    125   1e-29   
ref|XP_006842103.1|  hypothetical protein AMTR_s00078p00087780          125   1e-29   
gb|KDO82759.1|  hypothetical protein CISIN_1g010432mg                   125   1e-29   
ref|XP_009345494.1|  PREDICTED: protein kinase APK1A, chloroplast...    118   2e-29   
ref|NP_001031440.1|  protein kinase APK1B                               125   2e-29   
ref|XP_006438612.1|  hypothetical protein CICLE_v10031362mg             125   2e-29   
gb|KDO82757.1|  hypothetical protein CISIN_1g010432mg                   125   2e-29   
ref|XP_006483236.1|  PREDICTED: probable receptor-like protein ki...    125   2e-29   
ref|XP_002988311.1|  hypothetical protein SELMODRAFT_127709             124   2e-29   
gb|ABR18367.1|  unknown                                                 125   2e-29   
gb|KHG05986.1|  hypothetical protein F383_32908                         125   2e-29   
ref|XP_008654993.1|  PREDICTED: LOC100283086 isoform X2                 124   2e-29   
gb|KJB75753.1|  hypothetical protein B456_012G055500                    125   2e-29   
ref|NP_180459.2|  protein kinase APK1B                                  124   2e-29   
ref|XP_007032485.1|  Kinase superfamily protein isoform 2               125   2e-29   
ref|XP_007032484.1|  Kinase superfamily protein isoform 1               125   2e-29   
ref|NP_001149460.1|  LOC100283086                                       124   2e-29   
ref|XP_002879189.1|  hypothetical protein ARALYDRAFT_481810             124   2e-29   
emb|CAN82516.1|  hypothetical protein VITISV_008843                     125   2e-29   
ref|XP_009118950.1|  PREDICTED: protein kinase APK1A, chloroplast...    124   2e-29   
ref|XP_011469758.1|  PREDICTED: probable serine/threonine-protein...    124   2e-29   
gb|ADE76633.1|  unknown                                                 119   3e-29   
gb|KDO82758.1|  hypothetical protein CISIN_1g010432mg                   124   3e-29   
gb|KEH19837.1|  receptor-like kinase plant                              124   3e-29   
gb|KHG15911.1|  Protein kinase APK1A, chloroplastic                     125   3e-29   
ref|XP_002520138.1|  Protein kinase APK1B, chloroplast precursor,...    124   3e-29   
ref|XP_007046228.1|  Kinase superfamily protein                         124   3e-29   
ref|XP_004165824.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    124   3e-29   
ref|XP_004145296.1|  PREDICTED: protein kinase APK1A, chloroplast...    124   3e-29   
ref|XP_010250180.1|  PREDICTED: probable receptor-like protein ki...    124   3e-29   
ref|XP_002311801.1|  hypothetical protein POPTR_0008s19920g             124   3e-29   
ref|XP_009125442.1|  PREDICTED: probable serine/threonine-protein...    124   3e-29   
emb|CDY48100.1|  BnaC02g03570D                                          124   3e-29   
ref|XP_008654992.1|  PREDICTED: LOC100283086 isoform X1                 124   3e-29   
ref|XP_004297338.1|  PREDICTED: probable receptor-like protein ki...    124   3e-29   
ref|XP_007139605.1|  hypothetical protein PHAVU_008G043900g             124   3e-29   
ref|XP_007139604.1|  hypothetical protein PHAVU_008G043900g             124   3e-29   
ref|XP_011463101.1|  PREDICTED: probable receptor-like protein ki...    124   3e-29   
ref|XP_006431067.1|  hypothetical protein CICLE_v10011575mg             124   3e-29   
ref|XP_006431066.1|  hypothetical protein CICLE_v10011575mg             124   3e-29   
ref|XP_006431068.1|  hypothetical protein CICLE_v10011575mg             124   3e-29   
ref|XP_006482531.1|  PREDICTED: probable receptor-like protein ki...    124   4e-29   
ref|XP_006378157.1|  hypothetical protein POPTR_0010s04270g             124   4e-29   
gb|KJB80036.1|  hypothetical protein B456_013G077800                    124   4e-29   
ref|XP_003532048.1|  PREDICTED: probable receptor-like protein ki...    124   4e-29   
ref|XP_010414460.1|  PREDICTED: protein kinase APK1B, chloroplast...    123   4e-29   
emb|CDY04848.1|  BnaAnng00300D                                          123   5e-29   
ref|XP_009384874.1|  PREDICTED: protein kinase APK1B, chloroplast...    123   5e-29   
ref|XP_002873046.1|  hypothetical protein ARALYDRAFT_487008             123   5e-29   
ref|XP_004984728.1|  PREDICTED: protein kinase APK1B, chloroplast...    123   5e-29   
ref|NP_195849.1|  putative serine/threonine-protein kinase NAK          123   5e-29   
emb|CDX80814.1|  BnaC03g00680D                                          123   5e-29   
ref|XP_010414461.1|  PREDICTED: protein kinase APK1B, chloroplast...    123   5e-29   
ref|XP_010423878.1|  PREDICTED: probable serine/threonine-protein...    123   5e-29   
gb|KJB80035.1|  hypothetical protein B456_013G077800                    124   5e-29   
ref|XP_010452063.1|  PREDICTED: probable serine/threonine-protein...    122   5e-29   
ref|XP_009121617.1|  PREDICTED: probable receptor-like protein ki...    124   5e-29   
gb|KHG18602.1|  hypothetical protein F383_24083                         124   6e-29   
ref|XP_009384873.1|  PREDICTED: protein kinase APK1A, chloroplast...    123   6e-29   
emb|CDY59664.1|  BnaCnng35380D                                          123   6e-29   
ref|XP_010452061.1|  PREDICTED: probable serine/threonine-protein...    123   6e-29   
ref|XP_007222609.1|  hypothetical protein PRUPE_ppa004933mg             123   6e-29   
ref|XP_002465484.1|  hypothetical protein SORBIDRAFT_01g039630          122   7e-29   
gb|KDP21228.1|  hypothetical protein JCGZ_21699                         123   7e-29   
ref|XP_002458067.1|  hypothetical protein SORBIDRAFT_03g026370          123   7e-29   
ref|XP_011034212.1|  PREDICTED: probable receptor-like protein ki...    123   7e-29   
ref|XP_009360398.1|  PREDICTED: probable receptor-like protein ki...    123   7e-29   
ref|XP_008389526.1|  PREDICTED: probable receptor-like protein ki...    123   7e-29   
gb|ACN35886.1|  unknown                                                 123   7e-29   
ref|NP_001150552.1|  LOC100284184                                       123   7e-29   
ref|XP_006587767.1|  PREDICTED: probable receptor-like protein ki...    123   8e-29   
ref|XP_009384872.1|  PREDICTED: probable serine/threonine-protein...    122   8e-29   
ref|XP_003534465.1|  PREDICTED: probable receptor-like protein ki...    123   8e-29   
ref|XP_004489995.1|  PREDICTED: probable receptor-like protein ki...    123   8e-29   
ref|XP_009130691.1|  PREDICTED: probable serine/threonine-protein...    122   8e-29   
ref|XP_011003188.1|  PREDICTED: probable receptor-like protein ki...    123   8e-29   
ref|XP_011003187.1|  PREDICTED: probable receptor-like protein ki...    123   8e-29   
ref|XP_003558236.1|  PREDICTED: protein kinase APK1B, chloroplast...    122   9e-29   
emb|CDY55560.1|  BnaA03g54910D                                          122   9e-29   
ref|XP_010683263.1|  PREDICTED: probable receptor-like protein ki...    123   9e-29   
tpg|DAA58731.1|  TPA: putative protein kinase superfamily protein       123   9e-29   
ref|XP_008339937.1|  PREDICTED: probable receptor-like protein ki...    123   9e-29   
ref|XP_010683262.1|  PREDICTED: probable receptor-like protein ki...    123   1e-28   
gb|ACU18313.1|  unknown                                                 118   1e-28   
ref|XP_004509947.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_006357263.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_004489165.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_010096340.1|  putative receptor-like protein kinase              122   1e-28   
ref|XP_010242357.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_010242356.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_010485514.1|  PREDICTED: receptor-like serine/threonine-pr...    122   1e-28   
ref|XP_004489164.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_010242353.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_010242355.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_004969384.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_003569281.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_008459298.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_006287879.1|  hypothetical protein CARUB_v10001106mg             122   1e-28   
gb|EMT24219.1|  Protein kinase APK1A, chloroplastic                     122   1e-28   
ref|XP_010510371.1|  PREDICTED: receptor-like serine/threonine-pr...    122   1e-28   
ref|XP_004148688.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_002527168.1|  Protein kinase APK1B, chloroplast precursor,...    122   1e-28   
emb|CDM83073.1|  unnamed protein product                                122   1e-28   
ref|XP_010935290.1|  PREDICTED: probable serine/threonine-protein...    122   1e-28   
ref|XP_010463545.1|  PREDICTED: receptor-like serine/threonine-pr...    122   1e-28   
dbj|BAJ91316.1|  predicted protein                                      122   1e-28   
ref|XP_006363918.1|  PREDICTED: probable receptor-like protein ki...    122   1e-28   
ref|XP_010112470.1|  Receptor-like serine/threonine-protein kinase      122   2e-28   
gb|KGN52446.1|  hypothetical protein Csa_5G635410                       122   2e-28   
ref|XP_008459299.1|  PREDICTED: probable receptor-like protein ki...    122   2e-28   
ref|XP_004228384.1|  PREDICTED: probable receptor-like protein ki...    122   2e-28   
gb|AFK35549.1|  unknown                                                 117   2e-28   
ref|XP_003517927.1|  PREDICTED: probable receptor-like protein ki...    122   2e-28   
ref|XP_002323831.2|  hypothetical protein POPTR_0017s11370g             122   2e-28   
ref|XP_002323829.2|  hypothetical protein POPTR_0017s11370g             122   2e-28   
ref|XP_009762091.1|  PREDICTED: probable receptor-like protein ki...    121   2e-28   
ref|XP_009124366.1|  PREDICTED: protein kinase APK1B, chloroplast...    121   2e-28   
ref|XP_009124367.1|  PREDICTED: protein kinase APK1B, chloroplast...    121   2e-28   
gb|EYU19909.1|  hypothetical protein MIMGU_mgv11b010947mg               118   2e-28   
ref|XP_008443961.1|  PREDICTED: probable receptor-like protein ki...    121   2e-28   
ref|XP_004150205.1|  PREDICTED: probable receptor-like protein ki...    121   2e-28   
ref|NP_001238522.1|  serine/threonine protein kinase-like protein       122   2e-28   
gb|KHN13655.1|  Putative receptor-like protein kinase                   121   3e-28   
ref|XP_011086394.1|  PREDICTED: probable receptor-like protein ki...    121   3e-28   
ref|XP_006601719.1|  PREDICTED: serine/threonine protein kinase-l...    121   3e-28   
gb|ABR16311.1|  unknown                                                 121   3e-28   
ref|XP_009762090.1|  PREDICTED: probable receptor-like protein ki...    121   3e-28   
ref|XP_009599240.1|  PREDICTED: probable receptor-like protein ki...    121   3e-28   
ref|XP_006646742.1|  PREDICTED: protein kinase APK1A, chloroplast...    121   3e-28   
gb|KEH34698.1|  tyrosine kinase family protein                          120   3e-28   
ref|XP_010320662.1|  PREDICTED: probable receptor-like protein ki...    121   4e-28   
ref|XP_003609389.1|  Protein kinase 2B                                  121   4e-28   
emb|CDY40221.1|  BnaA09g35030D                                          120   4e-28   
ref|XP_009116240.1|  PREDICTED: probable receptor-like protein ki...    120   4e-28   
ref|XP_004238768.1|  PREDICTED: probable receptor-like protein ki...    121   4e-28   
gb|AAU89742.1|  serine/threonine protein kinase-like                    122   4e-28   
ref|XP_009116239.1|  PREDICTED: probable receptor-like protein ki...    120   4e-28   
emb|CDP00286.1|  unnamed protein product                                121   4e-28   
ref|NP_001235470.1|  serine/threonine protein kinase-like protein       121   4e-28   
emb|CDP10443.1|  unnamed protein product                                120   4e-28   
ref|XP_010554040.1|  PREDICTED: probable receptor-like protein ki...    121   4e-28   
gb|KEH34699.1|  tyrosine kinase family protein                          120   4e-28   
ref|XP_007155041.1|  hypothetical protein PHAVU_003G168000g             120   4e-28   
ref|XP_007155042.1|  hypothetical protein PHAVU_003G168000g             120   4e-28   
gb|EEC72262.1|  hypothetical protein OsI_05407                          120   5e-28   
ref|XP_011071028.1|  PREDICTED: probable receptor-like protein ki...    121   5e-28   
ref|XP_003613590.1|  Serine/threonine protein kinase-like protein       121   5e-28   
ref|XP_010927375.1|  PREDICTED: probable receptor-like protein ki...    120   5e-28   
ref|XP_006574323.1|  PREDICTED: serine/threonine protein kinase-l...    121   5e-28   
ref|XP_002305368.1|  kinase family protein                              120   5e-28   
ref|XP_009797575.1|  PREDICTED: probable receptor-like protein ki...    120   6e-28   
ref|XP_009587494.1|  PREDICTED: probable receptor-like protein ki...    120   6e-28   
gb|KEH34700.1|  tyrosine kinase family protein                          120   7e-28   
ref|XP_011009452.1|  PREDICTED: probable receptor-like protein ki...    120   7e-28   
gb|KEH34697.1|  tyrosine kinase family protein                          120   7e-28   
ref|XP_011009453.1|  PREDICTED: probable receptor-like protein ki...    120   7e-28   
emb|CDY65043.1|  BnaA10g29770D                                          124   7e-28   
gb|KEH30161.1|  kinase 1B                                               120   8e-28   
gb|KEH30162.1|  kinase 1B                                               120   8e-28   
ref|XP_010456541.1|  PREDICTED: probable receptor-like protein ki...    120   8e-28   
ref|XP_011013709.1|  PREDICTED: probable receptor-like protein ki...    120   8e-28   
gb|KJB40826.1|  hypothetical protein B456_007G078700                    120   8e-28   
ref|XP_007157381.1|  hypothetical protein PHAVU_002G065500g             120   8e-28   
ref|XP_004508467.1|  PREDICTED: probable receptor-like protein ki...    120   8e-28   
gb|KJB40825.1|  hypothetical protein B456_007G078700                    120   8e-28   
ref|XP_007157391.1|  hypothetical protein PHAVU_002G066400g             120   9e-28   
gb|AES77326.2|  receptor-like kinase plant                              120   9e-28   
ref|XP_003621108.1|  Protein kinase 2B                                  120   9e-28   
ref|XP_009594393.1|  PREDICTED: probable receptor-like protein ki...    120   9e-28   
ref|XP_009594394.1|  PREDICTED: probable receptor-like protein ki...    120   1e-27   
ref|XP_011013708.1|  PREDICTED: probable receptor-like protein ki...    120   1e-27   
emb|CDY41231.1|  BnaC08g26270D                                          119   1e-27   
emb|CDY39519.1|  BnaC04g15180D                                          119   1e-27   
ref|XP_006856462.1|  hypothetical protein AMTR_s00046p00017580          117   1e-27   
gb|EYU34980.1|  hypothetical protein MIMGU_mgv1a0051511mg               114   1e-27   
gb|AAA18853.1|  protein kinase                                          119   1e-27   
ref|NP_186779.1|  receptor-like serine/threonine-protein kinase         120   1e-27   
ref|NP_001235430.1|  protein kinase                                     119   1e-27   
gb|AAM64595.1|  putative protein kinase                                 119   1e-27   
ref|XP_006646050.1|  PREDICTED: probable receptor-like protein ki...    119   1e-27   
gb|EAZ12511.1|  hypothetical protein OsJ_02407                          119   1e-27   
ref|XP_002517468.1|  Protein kinase APK1B, chloroplast precursor,...    119   1e-27   
ref|NP_001045548.1|  Os01g0973500                                       119   1e-27   
ref|XP_010927374.1|  PREDICTED: probable receptor-like protein ki...    119   1e-27   
ref|XP_006593328.1|  PREDICTED: protein kinase isoform X2               119   1e-27   
gb|EAY74738.1|  hypothetical protein OsI_02628                          119   1e-27   
ref|NP_001043435.1|  Os01g0588500                                       119   1e-27   
ref|XP_004159424.1|  PREDICTED: probable receptor-like protein ki...    119   1e-27   
ref|XP_010925062.1|  PREDICTED: probable receptor-like protein ki...    119   1e-27   
ref|XP_006593327.1|  PREDICTED: protein kinase isoform X1               119   2e-27   
ref|XP_006408482.1|  hypothetical protein EUTSA_v10020609mg             119   2e-27   
ref|XP_010925061.1|  PREDICTED: probable receptor-like protein ki...    119   2e-27   
ref|NP_001235445.1|  protein kinase                                     119   2e-27   
gb|KCW52800.1|  hypothetical protein EUGRSUZ_J02135                     119   2e-27   
ref|XP_006297525.1|  hypothetical protein CARUB_v10013549mg             119   2e-27   
ref|XP_010033218.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    119   2e-27   
gb|KJB54000.1|  hypothetical protein B456_009G015800                    119   2e-27   
ref|XP_002305322.2|  hypothetical protein POPTR_0004s13410g             119   2e-27   
ref|XP_008457019.1|  PREDICTED: probable receptor-like protein ki...    119   2e-27   
gb|KDP45472.1|  hypothetical protein JCGZ_09721                         119   2e-27   
ref|NP_001151952.1|  LOC100285589                                       119   2e-27   
ref|XP_008457027.1|  PREDICTED: probable serine/threonine-protein...    119   2e-27   
ref|XP_004135195.1|  PREDICTED: probable receptor-like protein ki...    119   2e-27   
ref|XP_004155324.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    119   2e-27   
ref|XP_002440455.1|  hypothetical protein SORBIDRAFT_09g001190          119   2e-27   
gb|EAZ15004.1|  hypothetical protein OsJ_04942                          119   2e-27   
ref|XP_010524324.1|  PREDICTED: probable receptor-like protein ki...    119   2e-27   
ref|XP_006601720.1|  PREDICTED: protein kinase isoform X1               118   2e-27   
ref|XP_008446315.1|  PREDICTED: probable receptor-like protein ki...    119   2e-27   
ref|XP_006600745.1|  PREDICTED: probable receptor-like protein ki...    119   2e-27   
ref|XP_006600744.1|  PREDICTED: probable receptor-like protein ki...    119   2e-27   
ref|XP_004139295.1|  PREDICTED: receptor-like serine/threonine-pr...    118   3e-27   
ref|XP_008230724.1|  PREDICTED: probable receptor-like protein ki...    119   3e-27   
ref|XP_011020169.1|  PREDICTED: probable receptor-like protein ki...    118   3e-27   
emb|CDP02215.1|  unnamed protein product                                119   3e-27   
ref|XP_007217722.1|  hypothetical protein PRUPE_ppa005147mg             119   3e-27   



>gb|ABK93253.1| unknown [Populus trichocarpa]
Length=159

 Score =   167 bits (424),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 106/159 (67%), Gaps = 26/159 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKRK+FR+LDSRLEGQY+++V+ KV+
Sbjct  27   GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLANKRKIFRILDSRLEGQYSMDVAYKVS  86

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS + +FRPTMD+VV  LEQL++SK+  T +N H G++   R   A +      
Sbjct  87   TLALRCLSIETKFRPTMDEVVTALEQLQDSKETGT-ANGHVGNKPRIRRRSAND------  139

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                               A    + AAYPRPS SPLYA
Sbjct  140  -------------------ATGGGSIAAYPRPSASPLYA  159



>ref|XP_009590400.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009590401.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009590402.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
Length=404

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 109/161 (68%), Gaps = 27/161 (17%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYL NKRKVFRVLD+RLEGQY+++V+ KVA
Sbjct  270  GVVLLEMLSGRRAIDKNRPSGEHNLVEWAKPYLGNKRKVFRVLDTRLEGQYSMDVASKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQL-KESKDMTTLSNKHDGSRHHRRSDGAVEELAQL  403
            NLAL CLSKDPRFR +M D+VKELEQL ++SKD             + RS G      + 
Sbjct  330  NLALRCLSKDPRFRSSMSDIVKELEQLYQQSKDAG-----------NTRSHGNNRPRPRR  378

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYAK  280
            + + D                 +++A+ AYPRPS SPLYAK
Sbjct  379  RSAGDVG---------------NKHASVAYPRPSASPLYAK  404



>ref|XP_009774717.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
 ref|XP_009774718.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
Length=404

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 108/161 (67%), Gaps = 27/161 (17%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYL NKRKVFRVLD+RLEGQY+++V+ KVA
Sbjct  270  GVVLLEMLSGRRAIDKNRPSGEHNLVEWAKPYLGNKRKVFRVLDTRLEGQYSMDVASKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQL-KESKDMTTLSNKHDGSRHHRRSDGAVEELAQL  403
            NLAL CLSKDPRFR +M D+VKELEQL ++SKD             + RS G      + 
Sbjct  330  NLALRCLSKDPRFRSSMSDIVKELEQLYQQSKDAG-----------NTRSHGNNRPRPRR  378

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYAK  280
            + + D                 +++ + AYPRPS SPLYAK
Sbjct  379  RSAGDVG---------------NKHTSVAYPRPSASPLYAK  404



>ref|NP_001234409.1| protein kinase 1b [Solanum lycopersicum]
 gb|ACD77110.1| protein kinase 1b [Solanum lycopersicum]
Length=401

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 109/163 (67%), Gaps = 31/163 (19%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYL NKRKVFRVLD+RLEGQY++EV+ KVA
Sbjct  267  GVVLLEMLSGRRAIDKNRPSGEHNLVEWAKPYLGNKRKVFRVLDTRLEGQYSMEVASKVA  326

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLAL CLSKDPRFRP+M D+VKE+EQL +                            Q K
Sbjct  327  NLALRCLSKDPRFRPSMSDIVKEMEQLYQ----------------------------QSK  358

Query  399  ESEDTTT---LgsrrrrrsdgDAISRNATAAYPRPSTSPLYAK  280
            ES +T +      R RRRS  D  +RN + AYPRPS SP YAK
Sbjct  359  ESGNTRSHASNRPRPRRRSANDVANRNPSVAYPRPSASPPYAK  401



>ref|XP_011042707.1| PREDICTED: protein kinase APK1A, chloroplastic [Populus euphratica]
Length=405

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 107/159 (67%), Gaps = 26/159 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+++V+ KV+
Sbjct  273  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSMDVAYKVS  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS D +FRPTMD+VV  L QL++SK+  T +N H G++H  R   A +      
Sbjct  333  TLALRCLSVDTKFRPTMDEVVTALVQLQDSKETGT-ANGHVGNKHRIRRRSAND------  385

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                               A    +TAAYPRPS SPLYA
Sbjct  386  -------------------ATGGGSTAAYPRPSASPLYA  405



>ref|XP_011035315.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Populus euphratica]
Length=337

 Score =   167 bits (423),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 110/161 (68%), Gaps = 30/161 (19%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+++V+ K +
Sbjct  205  GVVLLEMLSGRRAIDKNRPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSMDVAFKAS  264

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKH--DGSRHHRRSDGAVEELAQ  406
             LAL CLS + +FRPTMD+VV  +EQL++SK+ T  +N H  +  R HRRS         
Sbjct  265  TLALRCLSIETKFRPTMDEVVTAMEQLQDSKE-TGSANGHASNAPRIHRRS---------  314

Query  405  LKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
               ++DT               IS   TAAYPRPSTS LYA
Sbjct  315  ---ADDT---------------ISGRNTAAYPRPSTSALYA  337



>ref|XP_002314178.2| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
 gb|EEE88133.2| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
Length=382

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 106/159 (67%), Gaps = 26/159 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKRK+FR+LDSRLEGQY+++V+ KV+
Sbjct  250  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLANKRKIFRILDSRLEGQYSMDVAYKVS  309

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS + +FRPTMD+VV  LEQL++SK+  T +N H G++   R   A +      
Sbjct  310  TLALRCLSIETKFRPTMDEVVTALEQLQDSKETGT-ANGHVGNKPRIRRRSAND------  362

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                               A    + AAYPRPS SPLYA
Sbjct  363  -------------------ATGGGSIAAYPRPSASPLYA  382



>ref|XP_011035309.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035310.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035311.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
 ref|XP_011035312.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Populus euphratica]
Length=407

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 110/161 (68%), Gaps = 30/161 (19%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+++V+ K +
Sbjct  275  GVVLLEMLSGRRAIDKNRPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSMDVAFKAS  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKH--DGSRHHRRSDGAVEELAQ  406
             LAL CLS + +FRPTMD+VV  +EQL++SK+ T  +N H  +  R HRRS         
Sbjct  335  TLALRCLSIETKFRPTMDEVVTAMEQLQDSKE-TGSANGHASNAPRIHRRS---------  384

Query  405  LKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
               ++DT               IS   TAAYPRPSTS LYA
Sbjct  385  ---ADDT---------------ISGRNTAAYPRPSTSALYA  407



>ref|XP_011035314.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Populus euphratica]
Length=405

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 110/161 (68%), Gaps = 30/161 (19%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+++V+ K +
Sbjct  273  GVVLLEMLSGRRAIDKNRPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSMDVAFKAS  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKH--DGSRHHRRSDGAVEELAQ  406
             LAL CLS + +FRPTMD+VV  +EQL++SK+ T  +N H  +  R HRRS         
Sbjct  333  TLALRCLSIETKFRPTMDEVVTAMEQLQDSKE-TGSANGHASNAPRIHRRS---------  382

Query  405  LKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
               ++DT               IS   TAAYPRPSTS LYA
Sbjct  383  ---ADDT---------------ISGRNTAAYPRPSTSALYA  405



>ref|XP_002299870.1| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
 gb|EEE84675.1| Protein kinase capable of phosphorylating tyrosine family protein 
[Populus trichocarpa]
Length=405

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 110/161 (68%), Gaps = 30/161 (19%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+++V+ K +
Sbjct  273  GVVLLEMLSGRRAIDKNRPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSMDVAFKAS  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKH--DGSRHHRRSDGAVEELAQ  406
             LAL CLS + +FRPTMD+VV  +EQL++SK+ T  +N H  +  R  RRS         
Sbjct  333  TLALRCLSIETKFRPTMDEVVTAMEQLQDSKE-TGSANGHASNAPRIRRRS---------  382

Query  405  LKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
               ++DT               IS   TAAYPRPSTSPLYA
Sbjct  383  ---ADDT---------------ISGRNTAAYPRPSTSPLYA  405



>emb|CDP09060.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 102/160 (64%), Gaps = 26/160 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYL NKRK+FR+LD+RLEGQY+L+V  K A
Sbjct  273  GVVLLEMLSGRRAIDKNRPTGEHNLVEWAKPYLTNKRKIFRILDNRLEGQYSLDVGYKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLA  C+S DPRFRPTM+++VKELE +++S     + N        RR            
Sbjct  333  NLAFRCISMDPRFRPTMNEIVKELEHIQDSNSKEKIGNNAPARSRPRR-----------L  381

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYAK  280
             ++D               A  RN  AAYPRPS SPL++K
Sbjct  382  SADD---------------ARKRNIPAAYPRPSASPLFSK  406



>emb|CBI16124.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 102/158 (65%), Gaps = 27/158 (17%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+LE + K +
Sbjct  273  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSLEGAHKAS  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLAL CLS + +FRPTM +VV  LEQL++ K+    +N+  G +H RRS       A  K
Sbjct  333  NLALRCLSTEAKFRPTMTEVVTALEQLQDCKEPEITNNRSGGMKHRRRS-------ADDK  385

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
            E   T                      AYPRPS SPLY
Sbjct  386  EKPTTAI--------------------AYPRPSASPLY  403



>ref|XP_010043547.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043548.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043549.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010043550.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW85564.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
 gb|KCW85565.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
 gb|KCW85566.1| hypothetical protein EUGRSUZ_B02363 [Eucalyptus grandis]
Length=406

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 103/161 (64%), Gaps = 29/161 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYL+NKRKVFRVLD+RL+GQY++E + + A
Sbjct  273  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLSNKRKVFRVLDNRLQGQYSMEGAYRTA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTL--SNKHDGSRHHRRSDGAVEELAQ  406
             LAL CLS D +FRPTMD+VV ELEQL+ESK       S    G R  RRS         
Sbjct  333  TLALRCLSMDAKFRPTMDEVVTELEQLQESKVSKNAGDSRPSSGQRMRRRS---------  383

Query  405  LKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
               ++D                 +R    AYPRPSTSPLYA
Sbjct  384  ---ADDGN---------------ARTRAVAYPRPSTSPLYA  406



>ref|XP_011089469.1| PREDICTED: protein kinase APK1B, chloroplastic [Sesamum indicum]
 ref|XP_011089470.1| PREDICTED: protein kinase APK1B, chloroplastic [Sesamum indicum]
Length=406

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 110/164 (67%), Gaps = 34/164 (21%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID NRP GEH LVEW++PYLANKRKV+R++D+RLEGQYT++V+QKVA
Sbjct  273  GVVLLEILSGRRAIDKNRPPGEHKLVEWSRPYLANKRKVYRIMDNRLEGQYTMDVAQKVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKH----DGSRHHRRSDGAVEEL  412
            NLA  C+S +PR RP M+++VKELEQL++S +M    N H    +GSR  RRS G     
Sbjct  333  NLASRCISLEPRLRPKMEEIVKELEQLQDSNNM---DNNHIKTQNGSRQRRRSAG-----  384

Query  411  AQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYAK  280
                                  DA ++ A AAYPRPS SP ++K
Sbjct  385  ----------------------DAGNKIANAAYPRPSASPPHSK  406



>ref|XP_002283646.2| PREDICTED: protein kinase APK1A, chloroplastic [Vitis vinifera]
 ref|XP_010651014.1| PREDICTED: protein kinase APK1A, chloroplastic [Vitis vinifera]
Length=442

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 111/169 (66%), Gaps = 11/169 (7%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY+LE + K +
Sbjct  273  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYSLEGAHKAS  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEE-----  415
            NLAL CLS + +FRPTM +VV  LEQL++ K+    +N+  G +H RRS   V       
Sbjct  333  NLALRCLSTEAKFRPTMTEVVTALEQLQDCKEPEITNNRSGGMKHRRRSADDVRNEKPPI  392

Query  414  -----LAQLKESEDTTTLgsrrrrrsdgDAISRNATA-AYPRPSTSPLY  286
                 L+     ++   + S   + +D     +  TA AYPRPS SPLY
Sbjct  393  ATPYPLSADDARKEKPVIPSAHPQSADYAKKEKPTTAIAYPRPSASPLY  441



>ref|XP_004294513.1| PREDICTED: protein kinase APK1A, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011461211.1| PREDICTED: protein kinase APK1A, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 107/161 (66%), Gaps = 22/161 (14%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKP+LANKRK+FRV+D+RLEGQY+++ + K A
Sbjct  267  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPFLANKRKIFRVIDNRLEGQYSMDGAYKAA  326

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEEL--AQ  406
             LAL CLS + + RPTMD+VVK LEQL++S    T SN+    R  RRS   V +   A 
Sbjct  327  TLALRCLSTESKLRPTMDEVVKALEQLQDSN--VTTSNQSHAHRMRRRSADDVSKARRAS  384

Query  405  LKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            + E+                   +RN T AYPRPS SPLYA
Sbjct  385  IDEANK-----------------ARN-TVAYPRPSASPLYA  407



>ref|XP_010256925.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
 ref|XP_010256926.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
Length=415

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 106/161 (66%), Gaps = 20/161 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYL NKRK+FRVLDSRLEGQY++  +QK A
Sbjct  273  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLTNKRKIFRVLDSRLEGQYSMGGAQKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLAL CLS + RFRP MD+VV  LEQL++ KD+    N  +G+ H  R++ +       +
Sbjct  333  NLALQCLSTEARFRPNMDEVVTTLEQLQDLKDVE--RNTQNGN-HPNRANHSTGGTRSRR  389

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAA-YPRPSTSPLYAK  280
             + D                  +N  AA YPRPS SPLY++
Sbjct  390  RNADE----------------GQNGKAASYPRPSASPLYSR  414



>ref|XP_008240890.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=396

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 101/159 (64%), Gaps = 28/159 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYL NKR+VFRV+DSRLEGQY+L  +QK A
Sbjct  266  GVVLLEMLSGRRAIDKNRPTGEHNLVEWAKPYLRNKRRVFRVIDSRLEGQYSLNRAQKAA  325

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLAL CLS D ++RP +++VV  LE+L+E+KDM   + K +    H  S+GA        
Sbjct  326  NLALQCLSIDSKYRPDVNEVVTTLEELQETKDMQKSTQKENHVTSHGHSNGAPNA-----  380

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                                 SR    AYPRPS SPL+A
Sbjct  381  ---------------------SR--VTAYPRPSASPLFA  396



>gb|AFK40483.1| unknown [Lotus japonicus]
Length=163

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 100/159 (63%), Gaps = 28/159 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG++ +D NRP G+HNLVEWAKPYLANKRKVFRVLDSRLEGQY+ + + KVA
Sbjct  27   GVVLLEMLSGKKAVDKNRPSGQHNLVEWAKPYLANKRKVFRVLDSRLEGQYSSDEAYKVA  86

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKH-DGSRHHRRSDGAVEELAQL  403
             LAL CLS + +FRP MD+VVK LEQL+ SK      N   +G+R  R+S   V  +  L
Sbjct  87   TLALRCLSTESKFRPNMDEVVKALEQLQVSKVKGGNQNASANGARMRRKSADDVGRVRTL  146

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
                                       ++YPRPS SPLY
Sbjct  147  ---------------------------SSYPRPSASPLY  158



>ref|XP_007016403.1| Kinase 1B isoform 1 [Theobroma cacao]
 gb|EOY34022.1| Kinase 1B isoform 1 [Theobroma cacao]
Length=405

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 103/161 (64%), Gaps = 32/161 (20%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKRK+FRVLD+RLEGQY++E + K A
Sbjct  273  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLANKRKLFRVLDNRLEGQYSMEGAHKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGS---RHHRRSDGAVEELA  409
             LAL CLS D +FRP M++VV  LEQL+ S +  + SN+ D S   R  RRS G      
Sbjct  333  TLALRCLSIDAKFRPRMNEVVTALEQLQNSNE--SGSNQIDISSTPRVRRRSAG------  384

Query  408  QLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
                                 DAI   +T AYPRPS SPLY
Sbjct  385  ---------------------DAIGGKSTVAYPRPSASPLY  404



>ref|XP_002531440.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF30952.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
Length=336

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 100/159 (63%), Gaps = 25/159 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYLANKRK+FR+LD+RLEGQY +EV+ K A
Sbjct  203  GVVLLEMLSGRRAIDKNRPSGEHNLVEWAKPYLANKRKIFRILDNRLEGQYPMEVAYKAA  262

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L L C+S +P+FRP MD++V  LEQL++SK   + +   +  R  RR           +
Sbjct  263  TLTLRCISTEPKFRPNMDEIVTSLEQLQDSKGTESNNTNSNNVRRIRR-----------R  311

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
             ++D                  RN    YPRPS SPLYA
Sbjct  312  SADDACN-------------GGRN-VVTYPRPSPSPLYA  336



>ref|XP_010264446.1| PREDICTED: protein kinase APK1A, chloroplastic [Nelumbo nucifera]
Length=413

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 102/160 (64%), Gaps = 20/160 (13%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEH LVEWAKPYL NKRK+FR+LD+RLEGQY+L  +QK A
Sbjct  273  GVVLLEMLSGRRAVDKNRPSGEHILVEWAKPYLTNKRKIFRILDNRLEGQYSLTGAQKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRR-SDGAVEELAQL  403
            NLAL CLS + ++RPTMD+VV  LEQL++SKD    +   +   H  R + G        
Sbjct  333  NLALQCLSTEAKYRPTMDEVVAALEQLQDSKDTVRDTQNGNHPNHESRPTSGTRPRRRSA  392

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
             ES++                  R A A YPRPS SPLYA
Sbjct  393  DESQN------------------RKA-APYPRPSASPLYA  413



>gb|KDP20446.1| hypothetical protein JCGZ_05291 [Jatropha curcas]
Length=404

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 99/158 (63%), Gaps = 26/158 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEH LVEWAKPYL NKRK+FR+LD+RLEGQY+++++ K A
Sbjct  272  GVVLLEMLSGRRAIDKNRPTGEHVLVEWAKPYLGNKRKIFRILDNRLEGQYSMDIANKAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS + +FRP MD+VV  LEQL++SK++  + N H GS    R           +
Sbjct  332  TLALRCLSIESKFRPNMDEVVTSLEQLQDSKEIGNV-NTHSGSAQRMR-----------R  379

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             S D               A      AAYPRPS  PLY
Sbjct  380  HSADD--------------ASGGRTAAAYPRPSAFPLY  403



>ref|XP_010106485.1| Protein kinase APK1A [Morus notabilis]
 gb|EXC10661.1| Protein kinase APK1A [Morus notabilis]
Length=402

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 100/158 (63%), Gaps = 25/158 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAK Y+ANKRK+FR+LD+RLEGQY+++V+ K A
Sbjct  269  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKSYMANKRKIFRILDNRLEGQYSMDVAYKAA  328

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS +P+FRP M++VV  LEQL++S +     N  +  R   R   A E      
Sbjct  329  TLALRCLSTEPKFRPNMEEVVTVLEQLQDSNEPNNRRNSGNAPRPRTRRRSADE------  382

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
                               A++R +  +YPRPS SPLY
Sbjct  383  -------------------ALTRRSVGSYPRPSASPLY  401



>gb|EYU18976.1| hypothetical protein MIMGU_mgv1a007452mg [Erythranthe guttata]
Length=407

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++SGRR ID NRP GEH LV+W+KPYLANKRKV+RV+D+RLEGQYT++V+QKVA
Sbjct  269  GVVLLELMSGRRAIDKNRPTGEHKLVDWSKPYLANKRKVYRVMDNRLEGQYTIDVAQKVA  328

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM-TTLSNKHDGSRHHRRSDG  427
             LAL C+S +PR RP M++VVKE+EQL++  ++ +  S  H+GSR  RRS G
Sbjct  329  ALALKCISLEPRLRPKMEEVVKEIEQLQDFSNLDSNRSGSHNGSRQRRRSVG  380



>emb|CDP06608.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 101/169 (60%), Gaps = 40/169 (24%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG++ ID NRP GEHNLVEWAKPYL NKR++FR+LD+RLEGQY++  + +VA
Sbjct  275  GVVLLEMLSGKKAIDKNRPTGEHNLVEWAKPYLTNKRRIFRILDARLEGQYSMGRALRVA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTL----------SNKHDGSRHHRRSD  430
            NLA+HCLS DP+ RP+MD+VV  LEQL++ K  +             N   G RH RRS 
Sbjct  335  NLAIHCLSVDPKVRPSMDEVVTTLEQLQDLKGTSNHDQKDSQLNLDGNSGGGPRHCRRS-  393

Query  429  GAVEELAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
               EE   +                            AYPRPS SPLYA
Sbjct  394  --AEEAPGM---------------------------TAYPRPSASPLYA  413



>ref|XP_010920578.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Elaeis guineensis]
Length=420

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 101/167 (60%), Gaps = 37/167 (22%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYLA+KRK+FR+LD+RL GQY+L  +QK A
Sbjct  283  GVVLLEMLSGRRAVDKNRPPGEHNLVEWARPYLASKRKIFRILDTRLGGQYSLGGAQKAA  342

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTT--------LSNKHDGSRHHRRSDGA  424
             +A+ CLS + ++RP MD+VV  LEQL+++KD            S   +  RHHRRS   
Sbjct  343  GIAVQCLSAEAKYRPNMDEVVSALEQLQDAKDAGKNPQTERKLSSQSSNAQRHHRRS---  399

Query  423  VEELAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                     SE+                   N   AYPRPS SPLYA
Sbjct  400  ---------SEEAG-----------------NRKGAYPRPSASPLYA  420



>ref|XP_011077648.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Sesamum 
indicum]
Length=417

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 103/159 (65%), Gaps = 19/159 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+L+G++ ID NRP GEHNLVEWAKPYL NKR++FRVLD+RLEGQY+L  + K A
Sbjct  278  GVVLLEILTGKKAIDKNRPSGEHNLVEWAKPYLTNKRRIFRVLDARLEGQYSLGQAVKAA  337

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLAL CL  D R RPTMD+VV  LEQL++SKD +    KH  S    +++GA +  +  +
Sbjct  338  NLALQCLYVDARSRPTMDEVVTALEQLQDSKDTSKNDQKHHRSSRRNQTNGAPK--SWRR  395

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
             +E+T                 R    AYPRPS S  YA
Sbjct  396  SAEET-----------------RRGKPAYPRPSASSRYA  417



>ref|XP_008223637.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
 ref|XP_008223643.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
Length=414

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 103/159 (65%), Gaps = 15/159 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKP+LANKRK+FR++D+RLEGQY+++ + K A
Sbjct  271  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPFLANKRKIFRIIDNRLEGQYSMDGAYKAA  330

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            +LA  CLS + + RP MD+VV  LEQL++  + +   N  +G R  RRS           
Sbjct  331  SLASRCLSTESKLRPNMDEVVTALEQLQD--NGSGQGNASNGQRMRRRS-----------  377

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
             ++D           +     SRN T AYPRPS SPLYA
Sbjct  378  -ADDAIKAKRAAADATKAANESRN-TVAYPRPSASPLYA  414



>ref|XP_010922319.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=409

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L V+QK A
Sbjct  277  GVVLLEMLSGRRAIDKNRPPGEHNLVEWARPYLPHKRKIFRVLDTRLEGQYSLGVAQKAA  336

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQ  406
             LALHCLS + RFRPTMD+VV  LEQL+++KD T   ++ +   H R    +  EL+Q
Sbjct  337  ALALHCLSTEARFRPTMDEVVSTLEQLQDNKD-TAKKSESEPKEHSRSLGNSGHELSQ  393



>gb|KJB55870.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
 gb|KJB55872.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
Length=404

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 102/160 (64%), Gaps = 28/160 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANK K+FRVLD+RLEGQY++E + K A
Sbjct  272  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLANKCKIFRVLDNRLEGQYSMEAAFKAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM-TTLSNKHDGSRHHRRSDGAVEELAQL  403
             LAL CLS + +FRP M +VV  LEQL++S +  +  +N     R  RRS G        
Sbjct  332  TLALRCLSAEAKFRPRMKEVVTALEQLQDSGECGSNPNNISSKPRIRRRSTG--------  383

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                DT+               +  +TAAYPRPS SPLYA
Sbjct  384  ----DTS---------------NGRSTAAYPRPSASPLYA  404



>gb|KHG10966.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=418

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 99/159 (62%), Gaps = 26/159 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEH LVEWAKPYLANKRK+FRVLD+RLEGQYT+E + K A
Sbjct  286  GVVLLEMLSGRRAVDKNRPSGEHKLVEWAKPYLANKRKIFRVLDNRLEGQYTIEGAFKAA  345

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CL  D +FRP+M++VV  LEQL++S D     N  +     RR           +
Sbjct  346  TLALRCLLIDAKFRPSMNEVVTALEQLQDSNDSRINHNNTNSVPRRRR-----------Q  394

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
             ++D T                  +T AYP+PS SPLYA
Sbjct  395  SADDAT---------------GGRSTTAYPQPSASPLYA  418



>gb|KHG20116.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=404

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 102/160 (64%), Gaps = 28/160 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKRK+FRVLD+RLE QY++E + K A
Sbjct  272  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLANKRKIFRVLDNRLERQYSMEAAFKAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM-TTLSNKHDGSRHHRRSDGAVEELAQL  403
             LAL CLS + +FRP M++VV  LEQL++S +  +  +N     R  RRS G        
Sbjct  332  TLALRCLSAEAKFRPRMNEVVTALEQLQDSGECGSNPNNISSKPRIRRRSTG--------  383

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                DT                +  +TAAYPRPS SPLYA
Sbjct  384  ----DTN---------------NGRSTAAYPRPSASPLYA  404



>ref|XP_007027015.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY07517.1| Kinase superfamily protein [Theobroma cacao]
Length=398

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYL NKR++FRVLD+RL+GQY+L   QKVA
Sbjct  273  GVVLLEMLSGRRAIDKNRPQGEHNLVEWAKPYLTNKRRIFRVLDTRLQGQYSLNRVQKVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM  481
            NLAL CL+ +P+FRP+MD+VV ELEQ +E  DM
Sbjct  333  NLALQCLAVEPKFRPSMDEVVTELEQFQEPGDM  365



>ref|XP_004302742.1| PREDICTED: probable serine/threonine-protein kinase NAK [Fragaria 
vesca subsp. vesca]
Length=403

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 100/160 (63%), Gaps = 25/160 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYL NKR+V RV+D RLEGQY+L  +QK A
Sbjct  268  GVVLLEMLSGRRAIDRNRPAGEHNLVEWAKPYLTNKRRVLRVIDPRLEGQYSLNRAQKAA  327

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKE-SKDMTTLSNKHDGSRHHRRSDGAVEELAQL  403
            +LAL CLS DP++RP M++VV  LEQL++ +KDM     K     HH  S+G    L + 
Sbjct  328  SLALQCLSTDPKYRPDMNEVVTTLEQLQDTTKDMPKGGQK----EHHATSNG----LPKR  379

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
              + D                     T  YPRPS +PL+A
Sbjct  380  SSANDAPN----------------RVTVNYPRPSANPLFA  403



>ref|XP_011094865.1| PREDICTED: protein kinase APK1A, chloroplastic [Sesamum indicum]
Length=414

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 102/159 (64%), Gaps = 20/159 (13%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+L+G++ ID NRP GEHNL+EWAKPYL NKR++FRVLD+RLEGQYT+  + K A
Sbjct  276  GVVLLEILTGKKAIDKNRPTGEHNLIEWAKPYLTNKRRIFRVLDARLEGQYTVGRAVKAA  335

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLAL CLS D R RP MD+VV  LEQL+ESKD TTL N     R +R S       +   
Sbjct  336  NLALQCLSMDARSRPNMDEVVIALEQLQESKD-TTLKNDQKDHRLNRHSQSNGGPKSCRS  394

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
             +E+T                   A +AYPRPS S LYA
Sbjct  395  STEET------------------QAASAYPRPSAS-LYA  414



>ref|XP_002322956.2| hypothetical protein POPTR_0016s11410g [Populus trichocarpa]
 gb|EEF04717.2| hypothetical protein POPTR_0016s11410g [Populus trichocarpa]
Length=428

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 99/160 (62%), Gaps = 34/160 (21%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP G+HNLVEWAKPYL NKR+VFRVLD+RLEGQY    +QK++
Sbjct  302  GVVLLEMLSGRRAIDKNRPSGQHNLVEWAKPYLTNKRRVFRVLDTRLEGQYVPSRAQKLS  361

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKES-KDMTTLSNKHDGSRHHRRSDGAVEELAQL  403
            NLAL CL+ +P+FRP MD+VV  LEQL+E  KD+  +S+K     H+ +  G        
Sbjct  362  NLALQCLAVEPKFRPNMDEVVMVLEQLQEQVKDIPKISHK----EHNLKVRGG-------  410

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                                  +     AYPRPS SPLYA
Sbjct  411  ----------------------ANGGQIAYPRPSASPLYA  428



>gb|KJB55871.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
 gb|KJB55873.1| hypothetical protein B456_009G099000 [Gossypium raimondii]
Length=475

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 102/160 (64%), Gaps = 28/160 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANK K+FRVLD+RLEGQY++E + K A
Sbjct  343  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLANKCKIFRVLDNRLEGQYSMEAAFKAA  402

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM-TTLSNKHDGSRHHRRSDGAVEELAQL  403
             LAL CLS + +FRP M +VV  LEQL++S +  +  +N     R  RRS G        
Sbjct  403  TLALRCLSAEAKFRPRMKEVVTALEQLQDSGECGSNPNNISSKPRIRRRSTG--------  454

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                DT+               +  +TAAYPRPS SPLYA
Sbjct  455  ----DTS---------------NGRSTAAYPRPSASPLYA  475



>gb|KDO72843.1| hypothetical protein CISIN_1g046897mg [Citrus sinensis]
Length=404

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 103/160 (64%), Gaps = 29/160 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLA+KRK+FR++D+RLEGQYTLE + K A
Sbjct  273  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLASKRKIFRIIDNRLEGQYTLEGAYKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTL-SNKHDGSRHHRRSDGAVEELAQL  403
             LAL CLS + +FRP M +VV  LEQL++S +   +  N H+  +  R S          
Sbjct  333  TLALRCLSTEGKFRPMMAEVVTVLEQLQDSSETGNIRCNTHNRPKIRRHS----------  382

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
              ++D               A SR+ T AYPRPS SPLYA
Sbjct  383  --ADD---------------ARSRSVT-AYPRPSASPLYA  404



>ref|XP_010047712.1| PREDICTED: protein kinase APK1B, chloroplastic isoform X2 [Eucalyptus 
grandis]
Length=398

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 98/159 (62%), Gaps = 22/159 (14%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R ID NRP G HNLVEWAKPYL NKR++FRV+DSRLEGQY+++ +QK A
Sbjct  261  GVVLLELLSGQRAIDKNRPAGHHNLVEWAKPYLTNKRRIFRVIDSRLEGQYSMDQAQKAA  320

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL C+S + R RPTMD++V  LEQL+E K   T S   D     RRS  A     +  
Sbjct  321  FLALQCISTEARARPTMDEIVTSLEQLQELKG--TRSTHKDRRSVGRRSSNAAPRACRSS  378

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
              E +                     AAYPRPS SPLYA
Sbjct  379  AEEVS--------------------AAAYPRPSASPLYA  397



>ref|XP_006424836.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 ref|XP_006424837.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 ref|XP_006488335.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Citrus sinensis]
 gb|ESR38076.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
 gb|ESR38077.1| hypothetical protein CICLE_v10028570mg [Citrus clementina]
Length=404

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 103/160 (64%), Gaps = 29/160 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLA+KRK+FR++D+RLEGQYTLE + K A
Sbjct  273  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLASKRKIFRIIDNRLEGQYTLEGAYKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTL-SNKHDGSRHHRRSDGAVEELAQL  403
             LAL CLS + +FRP M +VV  LEQL++S +   +  N H+  +  R S          
Sbjct  333  TLALRCLSTEGKFRPMMAEVVTVLEQLQDSSETGNIRCNTHNRPKIRRHS----------  382

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
              ++D               A SR+ T AYPRPS SPLYA
Sbjct  383  --ADD---------------ARSRSVT-AYPRPSASPLYA  404



>gb|KCW88940.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=408

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 98/159 (62%), Gaps = 22/159 (14%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R ID NRP G HNLVEWAKPYL NKR++FRV+DSRLEGQY+++ +QK A
Sbjct  271  GVVLLELLSGQRAIDKNRPAGHHNLVEWAKPYLTNKRRIFRVIDSRLEGQYSMDQAQKAA  330

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL C+S + R RPTMD++V  LEQL+E K   T S   D     RRS  A     +  
Sbjct  331  FLALQCISTEARARPTMDEIVTSLEQLQELKG--TRSTHKDRRSVGRRSSNAAPRACRSS  388

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
              E +                     AAYPRPS SPLYA
Sbjct  389  AEEVS--------------------AAAYPRPSASPLYA  407



>ref|XP_010047703.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Eucalyptus grandis]
 gb|KCW88941.1| hypothetical protein EUGRSUZ_A01268 [Eucalyptus grandis]
Length=407

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 98/159 (62%), Gaps = 22/159 (14%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R ID NRP G HNLVEWAKPYL NKR++FRV+DSRLEGQY+++ +QK A
Sbjct  270  GVVLLELLSGQRAIDKNRPAGHHNLVEWAKPYLTNKRRIFRVIDSRLEGQYSMDQAQKAA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL C+S + R RPTMD++V  LEQL+E K   T S   D     RRS  A     +  
Sbjct  330  FLALQCISTEARARPTMDEIVTSLEQLQELKG--TRSTHKDRRSVGRRSSNAAPRACRSS  387

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
              E +                     AAYPRPS SPLYA
Sbjct  388  AEEVS--------------------AAAYPRPSASPLYA  406



>ref|XP_007205264.1| hypothetical protein PRUPE_ppa006390mg [Prunus persica]
 gb|EMJ06463.1| hypothetical protein PRUPE_ppa006390mg [Prunus persica]
Length=414

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 101/159 (64%), Gaps = 15/159 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKP+LANKRK+FR++D+RLEGQY+++ + K A
Sbjct  271  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPFLANKRKIFRIIDNRLEGQYSMDGAYKAA  330

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            +LA  CLS + + RP MD+VV  LEQL++  + +   N  +G R  RRS           
Sbjct  331  SLASRCLSTESKLRPNMDEVVTALEQLQD--NGSGQGNASNGQRMRRRS-----------  377

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
             ++D           +     S N   AYPRPS SPLYA
Sbjct  378  -ADDVIKAKRAAADANKAANKSSN-IVAYPRPSASPLYA  414



>gb|KJB20072.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
Length=400

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 98/159 (62%), Gaps = 26/159 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP GEH LVEWAKPYLANKRK+F VLD+RLEGQYT+E + K A
Sbjct  268  GVVLLEILSGRRVVDKNRPSGEHKLVEWAKPYLANKRKIFHVLDNRLEGQYTIEGAFKAA  327

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS   +FRP+M++VV  LEQL++S D     N  +     RR            
Sbjct  328  TLALRCLSIAAKFRPSMNEVVTALEQLQDSNDSRINHNNTNSVPRRRR------------  375

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            +S D  T                 +T AYP+PS SPLYA
Sbjct  376  QSADDAT--------------GGRSTTAYPQPSASPLYA  400



>gb|ABD95976.1| serine/threonine kinase [Nicotiana tabacum]
Length=172

 Score =   145 bits (365),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 104/155 (67%), Gaps = 16/155 (10%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEH+LV W++PYL +KR+VFRVLDSRLEGQY+L  + KVA
Sbjct  30   GVVLLEILSGKKAIDKNRPTGEHSLVGWSRPYLTSKRRVFRVLDSRLEGQYSLTRALKVA  89

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLAL CL+ DP+ RPTMD+VV  LEQL+ESKD      K+D ++         ++L +L 
Sbjct  90   NLALQCLAMDPKSRPTMDEVVTALEQLQESKDTA----KNDTNKD--------QQLNRLI  137

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTS  295
             S+ ++      R  S+    + N    YPRPS S
Sbjct  138  SSQSSSEFNRSCRSSSEETPRAAN----YPRPSAS  168



>gb|KJB83756.1| hypothetical protein B456_013G263600 [Gossypium raimondii]
 gb|KJB83757.1| hypothetical protein B456_013G263600 [Gossypium raimondii]
Length=402

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 100/159 (63%), Gaps = 25/159 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG R +D NRP GEH+LV+WAKPYLANKRK+FRVLDSRLEGQY++E + KVA
Sbjct  267  GVVLLEMLSGHRAVDKNRPSGEHSLVDWAKPYLANKRKMFRVLDSRLEGQYSMEGAFKVA  326

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM-TTLSNKHDGSRHHRRSDGAVEELAQL  403
             LAL C+S +P+FRP M++VV  LEQL+ S +  + LSN    +   RR        A  
Sbjct  327  TLALRCISTEPKFRPRMNEVVIVLEQLQNSNESGSNLSNNTSSTPRIRRRS------ADN  380

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
                 +TT                  T AYPRPS SPLY
Sbjct  381  PSGGRSTT------------------TTAYPRPSASPLY  401



>gb|KJB20070.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
 gb|KJB20071.1| hypothetical protein B456_003G131600 [Gossypium raimondii]
Length=418

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 98/159 (62%), Gaps = 26/159 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP GEH LVEWAKPYLANKRK+F VLD+RLEGQYT+E + K A
Sbjct  286  GVVLLEILSGRRVVDKNRPSGEHKLVEWAKPYLANKRKIFHVLDNRLEGQYTIEGAFKAA  345

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS   +FRP+M++VV  LEQL++S D     N  +     RR            
Sbjct  346  TLALRCLSIAAKFRPSMNEVVTALEQLQDSNDSRINHNNTNSVPRRRR------------  393

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            +S D  T                 +T AYP+PS SPLYA
Sbjct  394  QSADDAT--------------GGRSTTAYPQPSASPLYA  418



>ref|XP_009610451.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana tomentosiformis]
Length=428

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEHNLVEWAKPYL NKR+VFRVLDSRLEGQY L  + KVA
Sbjct  290  GVVLLEILSGKKAIDKNRPTGEHNLVEWAKPYLTNKRRVFRVLDSRLEGQYLLNRAIKVA  349

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM  481
            NLA+ CLS DP+ RPTMD+VV  LEQL+ESKD+
Sbjct  350  NLAVQCLSMDPKSRPTMDEVVTALEQLQESKDL  382



>ref|XP_009610452.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana tomentosiformis]
Length=414

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEHNLVEWAKPYL NKR+VFRVLDSRLEGQY L  + KVA
Sbjct  276  GVVLLEILSGKKAIDKNRPTGEHNLVEWAKPYLTNKRRVFRVLDSRLEGQYLLNRAIKVA  335

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM  481
            NLA+ CLS DP+ RPTMD+VV  LEQL+ESKD+
Sbjct  336  NLAVQCLSMDPKSRPTMDEVVTALEQLQESKDL  368



>ref|XP_011011763.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Populus euphratica]
Length=399

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 95/160 (59%), Gaps = 34/160 (21%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP G+HNLVEWAKPYL NKR+VF VLD+RLEGQY    +QK+A
Sbjct  273  GVVLLEMLSGRRAIDKNRPSGQHNLVEWAKPYLTNKRRVFHVLDTRLEGQYVPNRAQKLA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKES-KDMTTLSNKHDGSRHHRRSDGAVEELAQL  403
            NLAL CL+ +P+FRP MD VV  LEQL+E  KD+   S K     H+ +  G        
Sbjct  333  NLALQCLAVEPKFRPNMDKVVMVLEQLQEQVKDIPKFSRK----EHNLKVRGG-------  381

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                                  +     AYPRPS SPLYA
Sbjct  382  ----------------------ANGGQIAYPRPSASPLYA  399



>ref|XP_009772470.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
 ref|XP_009772475.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
 ref|XP_009772479.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
Length=415

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEHNLVEWAKPYL NKR+VFRVLDSRLEGQY L  + KVA
Sbjct  276  GVVLLEILSGKKAIDKNRPTGEHNLVEWAKPYLTNKRRVFRVLDSRLEGQYLLNRAIKVA  335

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM  481
            NLA+ CLS DP+ RPTMD+VV  LEQL+ESKD+
Sbjct  336  NLAVQCLSMDPKSRPTMDEVVTALEQLQESKDV  368



>gb|KHN33381.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=422

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 107/160 (67%), Gaps = 13/160 (8%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG+R +D NRP G+HNLVEWAKPYLANKRK+FRVLD+RLEGQY+ + + K+A
Sbjct  273  GVVLLEMLSGKRAVDKNRPSGQHNLVEWAKPYLANKRKIFRVLDTRLEGQYSTDDACKLA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKH-DGSRHHRRSDGAVEELAQL  403
             LAL CLS + +FRP MD+VV  LEQL+    +  ++  H +GSR  RRS       A +
Sbjct  333  TLALRCLSIESKFRPNMDEVVTTLEQLQ----VPNVNGGHQNGSRVRRRS-------ADV  381

Query  402  KESEDTTTLgsrrrrrsdgDAISRNAT-AAYPRPSTSPLY  286
                   ++   R RR   D IS   T  AYPRPS SPLY
Sbjct  382  NRGYQNPSVNGSRVRRRSADDISPMETPTAYPRPSASPLY  421



>ref|NP_001242670.1| uncharacterized protein LOC100798404 [Glycine max]
 gb|ACU24124.1| unknown [Glycine max]
Length=422

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 107/160 (67%), Gaps = 13/160 (8%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG+R +D NRP G+HNLVEWAKPYLANKRK+FRVLD+RLEGQY+ + + K+A
Sbjct  273  GVVLLEMLSGKRAVDKNRPSGQHNLVEWAKPYLANKRKIFRVLDTRLEGQYSTDDACKLA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKH-DGSRHHRRSDGAVEELAQL  403
             LAL CLS + +FRP MD+VV  LEQL+    +  ++  H +GSR  RRS       A +
Sbjct  333  TLALRCLSIESKFRPNMDEVVTTLEQLQ----VPNVNGGHQNGSRVRRRS-------ADV  381

Query  402  KESEDTTTLgsrrrrrsdgDAISRNAT-AAYPRPSTSPLY  286
                   ++   R RR   D IS   T  AYPRPS SPLY
Sbjct  382  NRGYQNPSVNGSRVRRRSADDISPMETPTAYPRPSASPLY  421



>ref|NP_001240863.1| protein kinase APK1A, chloroplastic-like [Glycine max]
 ref|XP_006593429.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Glycine max]
 gb|ACM89549.1| putative protein kinase [Glycine max]
 gb|KHN30169.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=419

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 107/159 (67%), Gaps = 14/159 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG+R +D NRP G+HNLVEWAKP++ANKRK+FRVLD+RL+GQY+ + + K+A
Sbjct  273  GVVLLEMLSGKRAVDKNRPSGQHNLVEWAKPFMANKRKIFRVLDTRLQGQYSTDDAYKLA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS + +FRP MD VV  LEQL+       LSN + G R  RRS          +
Sbjct  333  TLALRCLSIESKFRPNMDQVVTTLEQLQ-------LSNVNGGPRVRRRSADVN------R  379

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATA-AYPRPSTSPLY  286
              ++ +++   R RR   D ISR  T  AYPRPS SPLY
Sbjct  380  GHQNPSSVNGSRVRRRSADDISRLETPNAYPRPSASPLY  418



>gb|KJB36715.1| hypothetical protein B456_006G172600 [Gossypium raimondii]
Length=397

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 98/158 (62%), Gaps = 33/158 (21%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLV+WAKPYL NKR++FRVLD+RL+GQY+L  +Q+ A
Sbjct  272  GVVLLEMLSGRRAIDNNRPSGEHNLVDWAKPYLTNKRRIFRVLDTRLQGQYSLTRAQEAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLA  CL+ +P+ RP+MD+VV  LE+L+E+ DM   + K      H RS+G         
Sbjct  332  NLAHQCLAVEPKLRPSMDEVVTALEKLQETGDMPKRNQKERRGNAHNRSNG---------  382

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
              + TT                      YP+PS SPL+
Sbjct  383  --KPTT----------------------YPKPSASPLH  396



>ref|XP_008387769.1| PREDICTED: probable serine/threonine-protein kinase NAK [Malus 
domestica]
Length=393

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 98/159 (62%), Gaps = 31/159 (19%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYL NKR+VFRV+D RLEGQY++  SQK A
Sbjct  266  GVVLLEMLSGRRAIDKNRPTGEHNLVEWAKPYLRNKRRVFRVIDPRLEGQYSVSRSQKAA  325

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CL+ DP++RP M++VV  LE+L+++KD+   + K     H+  S G   +     
Sbjct  326  VLALQCLAVDPKYRPDMNEVVTILEELQDTKDIPKSTQK----EHNATSQGLPNDAP---  378

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                                    +  AYPRPS +PL+A
Sbjct  379  ------------------------SVTAYPRPSRNPLFA  393



>ref|XP_010685751.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=395

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL NKRK+FR+LD+RLEGQY+L+ + KVA
Sbjct  271  GVVLLEMLSGRRAMDKNRPSGEHNLVEWARPYLTNKRKIFRILDNRLEGQYSLDAAFKVA  330

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRS  433
            +LA  CLS +P+FRP M++VVKELEQL++S      S+   G R  RRS
Sbjct  331  SLAFRCLSSEPKFRPLMNEVVKELEQLQDSSKEAR-SSSSTGGRTRRRS  378



>ref|XP_009414410.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 100/158 (63%), Gaps = 18/158 (11%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL +KRK+FR++D+RLEGQY+L+ +QKVA
Sbjct  276  GVVLLEMLSGRRAVDKNRPHGEHNLVEWARPYLTHKRKIFRIIDNRLEGQYSLDGAQKVA  335

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            +LA +CLS D +FRP+MD +V  L+QL+++K   T  +  +  R      G  +    LK
Sbjct  336  SLAQNCLSMDAKFRPSMDQMVSTLQQLQDTKQTGTPPSAEEKVRARSVGSGG-DTRVSLK  394

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
            +     +L                    YPRPS SPLY
Sbjct  395  DFRGDGSLK-----------------VTYPRPSASPLY  415



>ref|XP_010685750.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=404

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL NKRK+FR+LD+RLEGQY+L+ + KVA
Sbjct  280  GVVLLEMLSGRRAMDKNRPSGEHNLVEWARPYLTNKRKIFRILDNRLEGQYSLDAAFKVA  339

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRS  433
            +LA  CLS +P+FRP M++VVKELEQL++S      S+   G R  RRS
Sbjct  340  SLAFRCLSSEPKFRPLMNEVVKELEQLQDSSKEAR-SSSSTGGRTRRRS  387



>ref|XP_008357182.1| PREDICTED: protein kinase APK1A, chloroplastic [Malus domestica]
Length=418

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 99/160 (62%), Gaps = 11/160 (7%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKP+L NKRKVFR++D+RLEGQY+++ + K A
Sbjct  269  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPFLINKRKVFRIIDNRLEGQYSMDGAHKAA  328

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKE-SKDMTTLSNKHDGSRHHRRSDGAVEELAQL  403
             LA  CLS + + RP MD+VVK LEQL + + +  T SN   G R  RRS       A  
Sbjct  329  TLAARCLSTESKLRPNMDEVVKTLEQLPDYNPNGGTQSN---GQRMRRRS-------ADD  378

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                      +     +   A     T AYPRPS SPLYA
Sbjct  379  ASKAKRAAAAAAAAADAIKAANKARNTVAYPRPSASPLYA  418



>dbj|BAE71262.1| putative protein kinase APK1A [Trifolium pratense]
Length=409

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 103/160 (64%), Gaps = 24/160 (15%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG+R +D NRP G+H+LVEWAKPYLANKRKVF VLDSRLEGQY+ + S +VA
Sbjct  273  GVVLLEMLSGKRAVDKNRPSGQHSLVEWAKPYLANKRKVFSVLDSRLEGQYSSDESYRVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGS-RHHRRSDGAVEELAQL  403
             LAL CLS + ++RP MD+VV+ LEQLK       + N + G+ R +RR           
Sbjct  333  TLALRCLSTESKYRPNMDEVVRILEQLK-------VPNVNVGNQRRYRR-----------  374

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            K ++D T       R       S  A  +YPRPS SPLYA
Sbjct  375  KSADDVT-----HARTHKKSCASARAHTSYPRPSASPLYA  409



>gb|KHF99777.1| Protein kinase APK1B, chloroplastic -like protein [Gossypium 
arboreum]
Length=402

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 102/160 (64%), Gaps = 27/160 (17%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEH+LV+WAKPYLANKRK+FRVLDSRLEGQY++E + KVA
Sbjct  267  GVVLLEMLSGRRAVDKNRPSGEHSLVDWAKPYLANKRKMFRVLDSRLEGQYSMEGAFKVA  326

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGS--RHHRRSDGAVEELAQ  406
             LAL C+S +P+FRP M++VV  LEQL+ S +  +  + +  S  R  RRS       + 
Sbjct  327  TLALRCISIEPKFRPRMNEVVIVLEQLQNSNESGSSLSNNTSSTPRIRRRS-------SD  379

Query  405  LKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
                  +TT                  T AYPRPS SPLY
Sbjct  380  YPSGGRSTT------------------TTAYPRPSASPLY  401



>ref|XP_007133997.1| hypothetical protein PHAVU_010G010300g [Phaseolus vulgaris]
 gb|ESW05991.1| hypothetical protein PHAVU_010G010300g [Phaseolus vulgaris]
Length=413

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 99/158 (63%), Gaps = 17/158 (11%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GE  LVEWAKPYLANKR+VFRV+DSRLEGQY+L  +Q+ A
Sbjct  272  GVVLLEMLSGRRAIDKNRPSGEQCLVEWAKPYLANKRRVFRVMDSRLEGQYSLNRAQRAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA  CLS +P++RP MD+VV+ LEQ++ES D      K+   +  R S   +     L 
Sbjct  332  TLAFQCLSVEPKYRPNMDEVVRVLEQVRESND----EGKNGNCKKRRVSGSGLGHPNGLP  387

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             S  T +  + ++              AYPRPS S LY
Sbjct  388  ASASTGSSDAPKKL-------------AYPRPSASLLY  412



>ref|XP_007150326.1| hypothetical protein PHAVU_005G144200g [Phaseolus vulgaris]
 gb|ESW22320.1| hypothetical protein PHAVU_005G144200g [Phaseolus vulgaris]
Length=422

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 106/163 (65%), Gaps = 19/163 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG+R +D NRP G+H+LVEW KP+LANKRK+FRVLD+RLEGQY+ + + KVA
Sbjct  273  GVVLLEMLSGKRAVDKNRPSGQHSLVEWGKPFLANKRKIFRVLDTRLEGQYSTDDAYKVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGS----RHHRRSDGAVEEL  412
            NLAL CLS D +FRP MD+VV  LEQL+       + N ++G+    R  RRS       
Sbjct  333  NLALRCLSIDSKFRPNMDEVVTTLEQLQ-------VPNANEGNQNLCRVRRRS-------  378

Query  411  AQLKESEDTTTLgsrrrrrsdgDAISRNAT-AAYPRPSTSPLY  286
            A +       ++   R RR   D  SR  T + YPRPS SPLY
Sbjct  379  ADVSRGYQNPSVNGSRARRRSADDFSRMETPSTYPRPSASPLY  421



>ref|XP_008464125.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Cucumis melo]
Length=362

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 101/158 (64%), Gaps = 27/158 (17%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+L GRR ID NRP  EHNLVEWAKPYLANKRK+FR++DSRLEGQY+L+ + K +
Sbjct  231  GVVLLEILCGRRAIDKNRPAREHNLVEWAKPYLANKRKIFRIIDSRLEGQYSLDGAYKAS  290

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS +P+ RP M+DVVKELEQL++S    TL   +  S ++RR        A+  
Sbjct  291  MLALRCLSINPKLRPNMNDVVKELEQLQDS----TLPTSNRNSTNNRR--------ARRH  338

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             ++D               A + N   AYPRP  S LY
Sbjct  339  SADD---------------ARNPNNAQAYPRPPVSALY  361



>ref|XP_006429091.1| hypothetical protein CICLE_v10011895mg [Citrus clementina]
 ref|XP_006480830.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Citrus sinensis]
 gb|ESR42331.1| hypothetical protein CICLE_v10011895mg [Citrus clementina]
Length=398

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 93/157 (59%), Gaps = 33/157 (21%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID NRP GEHNLVEWAKPYL +KR++FRVLD RLEGQ++L  +QK A
Sbjct  273  GVVLLEILSGRRAIDKNRPTGEHNLVEWAKPYLTSKRRIFRVLDPRLEGQFSLPQAQKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            +LAL CLS +P+ RP MD+VVKELEQL+E ++M     K   ++ H    G         
Sbjct  333  SLALQCLSVEPKLRPDMDEVVKELEQLQELRNMHKRPQKEHQAKGHVHFKGRA-------  385

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
                                        YPRPS SPL
Sbjct  386  --------------------------TTYPRPSASPL  396



>gb|KDO51148.1| hypothetical protein CISIN_1g015909mg [Citrus sinensis]
Length=398

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 93/157 (59%), Gaps = 33/157 (21%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID NRP GEHNLVEWAKPYL +KR++FRVLD RLEGQ++L  +QK A
Sbjct  273  GVVLLEILSGRRAIDKNRPTGEHNLVEWAKPYLTSKRRIFRVLDPRLEGQFSLPQAQKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            +LAL CLS +P+ RP MD+VVKELEQL+E ++M     K   ++ H    G         
Sbjct  333  SLALQCLSVEPKLRPDMDEVVKELEQLQELRNMHKRPQKEHQAKGHVHFKGRA-------  385

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
                                        YPRPS SPL
Sbjct  386  --------------------------TTYPRPSASPL  396



>ref|XP_004487006.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X5 
[Cicer arietinum]
Length=411

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 100/160 (63%), Gaps = 23/160 (14%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG+R +D NRP G+HNLVEWAKPYLANKRK+F VLDSRLEGQY+ + + K+A
Sbjct  274  GVVLLEMLSGKRSVDKNRPSGQHNLVEWAKPYLANKRKIFSVLDSRLEGQYSTDEAYKIA  333

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS + +FRP MD+VV  LEQLK       + N + GS+   R   A +     +
Sbjct  334  TLALRCLSTESKFRPNMDEVVITLEQLK-------VPNLNAGSQKRARRKSADDVSHARR  386

Query  399  ESEDTTTLgsrrrrrsdgDAISR-NATAAYPRPSTSPLYA  283
            +S D                ++R      YPRPS SPLYA
Sbjct  387  KSVD---------------GVNRPKIPTTYPRPSASPLYA  411



>ref|XP_006573305.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Glycine 
max]
 gb|KHN19150.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=413

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 99/159 (62%), Gaps = 17/159 (11%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GE  LVEWAKPYL+NKR+VFRV+DSRLEGQY+L  +Q+ A
Sbjct  272  GVVLLEMLSGRRAIDKNRPSGEQCLVEWAKPYLSNKRRVFRVMDSRLEGQYSLTQAQRAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA  CLS +P++RP MD+VVK LEQL+ES D      K+   +  R S   +     L 
Sbjct  332  TLAFQCLSVEPKYRPNMDEVVKALEQLRESNDKV----KNGDHKKCRVSGSGLGHPNGLP  387

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
             S    ++ + ++               YPRPS S LY+
Sbjct  388  ASTSKGSIDAAKKFN-------------YPRPSASLLYS  413



>ref|XP_004143118.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 gb|KGN47146.1| hypothetical protein Csa_6G190370 [Cucumis sativus]
Length=404

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 102/158 (65%), Gaps = 27/158 (17%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+L GRR ID NRP  EHNLVEWAKPYLANKRK+FR++DSRLEGQY+L+ + K +
Sbjct  273  GVVLLEILCGRRAIDKNRPAREHNLVEWAKPYLANKRKIFRIIDSRLEGQYSLDGAYKAS  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL C+S +P+ RP M+DVVKELEQL++S    TL   +  S ++RR        A+  
Sbjct  333  MLALRCISINPKLRPIMNDVVKELEQLQDS----TLPTSNRNSTNNRR--------ARRH  380

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             ++D               A + N+  AYPRP  S LY
Sbjct  381  SADD---------------ARNPNSAQAYPRPPVSALY  403



>ref|XP_002533148.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF29229.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=410

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 102/157 (65%), Gaps = 16/157 (10%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM+SGRR ID NRP  E NLVEWA+PYL NKRK+F+V+D+R+EGQY+L+ + KVA
Sbjct  268  GVVLLEMISGRRAIDKNRPSREQNLVEWARPYLGNKRKIFQVMDARVEGQYSLKDALKVA  327

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLA+ C+S +PRFRP M++VVK LEQL ES D       ++GSR  R      E L ++ 
Sbjct  328  NLAVQCISPEPRFRPKMEEVVKALEQLLESND-------NEGSRGSRH-----ESLRKVN  375

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
             + +       R  R           A+YPRPS SPL
Sbjct  376  RNSNNGP----RYHRKSTAETCDGKAASYPRPSASPL  408



>ref|XP_004487004.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Cicer arietinum]
 ref|XP_004487005.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X4 
[Cicer arietinum]
Length=428

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 100/160 (63%), Gaps = 23/160 (14%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG+R +D NRP G+HNLVEWAKPYLANKRK+F VLDSRLEGQY+ + + K+A
Sbjct  291  GVVLLEMLSGKRSVDKNRPSGQHNLVEWAKPYLANKRKIFSVLDSRLEGQYSTDEAYKIA  350

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS + +FRP MD+VV  LEQLK       + N + GS+   R   A +     +
Sbjct  351  TLALRCLSTESKFRPNMDEVVITLEQLK-------VPNLNAGSQKRARRKSADDVSHARR  403

Query  399  ESEDTTTLgsrrrrrsdgDAISR-NATAAYPRPSTSPLYA  283
            +S D                ++R      YPRPS SPLYA
Sbjct  404  KSVD---------------GVNRPKIPTTYPRPSASPLYA  428



>ref|XP_008464124.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Cucumis melo]
Length=404

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 101/158 (64%), Gaps = 27/158 (17%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+L GRR ID NRP  EHNLVEWAKPYLANKRK+FR++DSRLEGQY+L+ + K +
Sbjct  273  GVVLLEILCGRRAIDKNRPAREHNLVEWAKPYLANKRKIFRIIDSRLEGQYSLDGAYKAS  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS +P+ RP M+DVVKELEQL++S    TL   +  S ++RR        A+  
Sbjct  333  MLALRCLSINPKLRPNMNDVVKELEQLQDS----TLPTSNRNSTNNRR--------ARRH  380

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             ++D               A + N   AYPRP  S LY
Sbjct  381  SADD---------------ARNPNNAQAYPRPPVSALY  403



>ref|XP_006339025.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Solanum 
tuberosum]
Length=413

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 101/157 (64%), Gaps = 19/157 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEH+LV+WAKPYL NKR+VFRVLD+RLEGQY+L  + KVA
Sbjct  275  GVVLLEILSGKKAIDKNRPMGEHSLVDWAKPYLTNKRRVFRVLDARLEGQYSLSHALKVA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L C+S DP+ RPTMD+VV  LEQL++SKD+     K      H RS  A+++    K
Sbjct  335  ILSLQCISMDPKSRPTMDEVVTALEQLQQSKDVAKNDKKVRQVNQHSRSSFALKK--SCK  392

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
             S + T                  A + YPRPS S L
Sbjct  393  SSTEETP-----------------AKSKYPRPSLSLL  412



>ref|XP_004487002.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004487003.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=441

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 100/160 (63%), Gaps = 23/160 (14%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG+R +D NRP G+HNLVEWAKPYLANKRK+F VLDSRLEGQY+ + + K+A
Sbjct  304  GVVLLEMLSGKRSVDKNRPSGQHNLVEWAKPYLANKRKIFSVLDSRLEGQYSTDEAYKIA  363

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS + +FRP MD+VV  LEQLK       + N + GS+   R   A +     +
Sbjct  364  TLALRCLSTESKFRPNMDEVVITLEQLK-------VPNLNAGSQKRARRKSADDVSHARR  416

Query  399  ESEDTTTLgsrrrrrsdgDAISR-NATAAYPRPSTSPLYA  283
            +S D                ++R      YPRPS SPLYA
Sbjct  417  KSVD---------------GVNRPKIPTTYPRPSASPLYA  441



>ref|XP_003544233.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Glycine 
max]
 gb|KHN20929.1| Protein kinase APK1A-like protein, chloroplastic [Glycine soja]
Length=399

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++SG+R +D NRP GEHNL+EWAKPYL+NKR++F+V+D+R+EGQYTL  S KVA
Sbjct  270  GVVLLEIMSGKRALDSNRPSGEHNLIEWAKPYLSNKRRIFQVMDARIEGQYTLRESMKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
            NLA+ CLS +PRFRP MD+VV+ LE+L++S+D
Sbjct  330  NLAIQCLSVEPRFRPKMDEVVRALEELQDSED  361



>ref|XP_002266032.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010654281.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 ref|XP_010654282.1| PREDICTED: probable serine/threonine-protein kinase NAK [Vitis 
vinifera]
 emb|CBI30550.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 88/122 (72%), Gaps = 10/122 (8%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYL +KRK+FRV+D+RLEGQY+L+ +QK A
Sbjct  273  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLTSKRKIFRVIDTRLEGQYSLDRAQKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM--TTLSNKH--------DGSRHHRRSD  430
             LAL CL  +PR RP MD+VV  LEQ+ E KD   +T   +H        D  R+HRRS 
Sbjct  333  MLALQCLLTEPRARPNMDEVVTALEQICEPKDKLRSTTKEQHSNHQSRPNDRPRYHRRSA  392

Query  429  GA  424
             A
Sbjct  393  DA  394



>gb|KDP35639.1| hypothetical protein JCGZ_09077 [Jatropha curcas]
Length=392

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 91/117 (78%), Gaps = 4/117 (3%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP G+HNLVEWAKPYL NK++VFR+LD+RL+GQY+L  +QKVA
Sbjct  273  GVVLLEILSGRRAVDKNRPSGQHNLVEWAKPYLTNKKRVFRILDTRLDGQYSLTRAQKVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKES----KDMTTLSNKHDGSRHHRRSDGAV  421
            NLAL+CL  +P+FRP M++VVK LE+++ES    +++TT  N   G   + R   ++
Sbjct  333  NLALNCLDVEPKFRPNMEEVVKALEEVQESNKKEENLTTHGNTKTGKIAYPRPSASL  389



>gb|AFK44181.1| unknown [Lotus japonicus]
Length=401

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 11/124 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++SG+R +D NRP GEHNL+EWAKPYL+NKR++F+V+D+R+EGQYTL  + KVA
Sbjct  275  GVVLLEIMSGKRALDQNRPSGEHNLIEWAKPYLSNKRRIFQVMDARIEGQYTLREAMKVA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS-----------NKHDGSRHHRRS  433
            NLA+ CLS +PRFRP MD+VV  LE+L+ S D T              N H G + HR  
Sbjct  335  NLAIQCLSVEPRFRPKMDEVVSVLEELQGSHDDTAGGVGTSRDQRARRNVHSGPKQHRSK  394

Query  432  DGAV  421
               +
Sbjct  395  QSGI  398



>ref|XP_009364395.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Pyrus x 
bretschneideri]
Length=418

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 96/159 (60%), Gaps = 9/159 (6%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKP+L NKRK+FR++D+RLEGQY+++ + K  
Sbjct  269  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPFLVNKRKIFRIIDNRLEGQYSMDGAHKAG  328

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA  CLS + + RP MD+VVK LEQL +     T   + +G R  RRS       A   
Sbjct  329  ILAARCLSTESKLRPNMDEVVKTLEQLPDYN--PTGGTQSNGQRMRRRS-------ADDA  379

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
                     +     +   A     T AYPRPS SPLYA
Sbjct  380  SKAKRAAAAAAAAADAIKAANEARKTVAYPRPSASPLYA  418



>ref|XP_004165801.1| PREDICTED: LOW QUALITY PROTEIN: protein kinase APK1A, chloroplastic-like 
[Cucumis sativus]
Length=404

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 101/158 (64%), Gaps = 27/158 (17%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+L GRR ID NRP  EHNLVEWAKPYLANKRK FR++DSRLEGQY+L+ + K +
Sbjct  273  GVVLLEILCGRRAIDKNRPAREHNLVEWAKPYLANKRKXFRIIDSRLEGQYSLDGAYKAS  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL C+S +P+ RP M+DVVKELEQL++S    TL   +  S ++RR        A+  
Sbjct  333  MLALRCISINPKLRPIMNDVVKELEQLQDS----TLPTSNRNSTNNRR--------ARRH  380

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             ++D               A + N+  AYPRP  S LY
Sbjct  381  SADD---------------ARNPNSAQAYPRPPVSALY  403



>ref|XP_006576543.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Glycine max]
Length=371

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 98/158 (62%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GE  LVEWAKPYL+NKR+VFRV+DSRLEGQY+L  +Q+ A
Sbjct  229  GVVLLEMLSGRRAIDKNRPSGEQCLVEWAKPYLSNKRRVFRVMDSRLEGQYSLTQAQRAA  288

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA  CL+ +P++RP MD+VV+ LEQL+ES +     ++     H +RS  +   L    
Sbjct  289  TLAFQCLAVEPKYRPNMDEVVRALEQLRESNN-----DQVKNGDHKKRSRVSGSGLGHHN  343

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
                +T+            +I       YPRPS S LY
Sbjct  344  GLPASTS----------KGSIDAAKKFNYPRPSASLLY  371



>gb|KHN47889.1| Protein kinase APK1B, chloroplastic [Glycine soja]
Length=413

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 97/158 (61%), Gaps = 16/158 (10%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GE  LVEWAKPYL+NKR+VFRV+DSRLEGQY+L  +Q+ A
Sbjct  272  GVVLLEMLSGRRAIDKNRPSGEQCLVEWAKPYLSNKRRVFRVMDSRLEGQYSLTQAQRAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA  CL+ +P++RP MD+VV+ LEQL+ES +    +  H   +  R S   +     L 
Sbjct  332  TLAFQCLAVEPKYRPNMDEVVRALEQLRESNNDQVKNGDHK--KRSRVSGSGLGHHNGLP  389

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             S    ++ +              A   YPRPS S LY
Sbjct  390  ASTSKGSIDA--------------AKFNYPRPSASLLY  413



>ref|XP_008784589.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=415

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 98/159 (62%), Gaps = 19/159 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL+NKRK+FR+LD+RL GQY L  +QK A
Sbjct  276  GVVLLEMLSGRRAVDKNRPPGEHNLVEWARPYLSNKRKIFRILDTRLGGQYPLGGAQKAA  335

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             +A+ CLS + ++RP MD+VV  LE L+++KD        +     + S   V    Q +
Sbjct  336  AIAVRCLSAEAKYRPNMDEVVSALELLQDAKD-----TGRNAQTERKASSQIVGSNVQRR  390

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            +   +              A SR    AYPRPS SPLYA
Sbjct  391  DRRGSEA------------AGSRK--GAYPRPSASPLYA  415



>gb|EYU41728.1| hypothetical protein MIMGU_mgv1a007413mg [Erythranthe guttata]
Length=408

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 101/159 (64%), Gaps = 26/159 (16%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+L+G++ ID NRP GEHNLVEWAKPYL NKR++FRV+D+R+EGQY  + + K A
Sbjct  276  GVVLLEILTGKKAIDKNRPTGEHNLVEWAKPYLTNKRRIFRVIDARIEGQYLADRAVKAA  335

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLAL C+S DPR RP MD+VV  LE L++SK+    S+K+    ++ +S G  +      
Sbjct  336  NLALQCISMDPRSRPNMDEVVSALENLQDSKE----SSKNGHRNNNSQSRGGPKSC----  387

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            +SE+T                    T AYPRP  S LYA
Sbjct  388  KSEET------------------RKTTAYPRPKASALYA  408



>ref|XP_010557255.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X3 
[Tarenaya hassleriana]
Length=412

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 101/158 (64%), Gaps = 19/158 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKR+VFRV+D+RL+ QY++E + KVA
Sbjct  273  GVVLLEMLSGRRAVDKNRPTGEHNLVEWAKPYLANKRRVFRVIDNRLQDQYSMEEAHKVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ CLS + + RP M +VV  LEQ++      +L+      R  R SD  + + A++ 
Sbjct  333  TLAMRCLSTEIKLRPNMKEVVSHLEQIQ------SLNAARRERRTRRSSDSVIAKKAKVG  386

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
              + +                + N TAAYPRPS SPL+
Sbjct  387  YGQPSPM-------------AAANGTAAYPRPSGSPLH  411



>ref|XP_008784588.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=422

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 98/159 (62%), Gaps = 19/159 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL+NKRK+FR+LD+RL GQY L  +QK A
Sbjct  283  GVVLLEMLSGRRAVDKNRPPGEHNLVEWARPYLSNKRKIFRILDTRLGGQYPLGGAQKAA  342

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             +A+ CLS + ++RP MD+VV  LE L+++KD        +     + S   V    Q +
Sbjct  343  AIAVRCLSAEAKYRPNMDEVVSALELLQDAKD-----TGRNAQTERKASSQIVGSNVQRR  397

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            +   +              A SR    AYPRPS SPLYA
Sbjct  398  DRRGSEA------------AGSRK--GAYPRPSASPLYA  422



>gb|KJB16969.1| hypothetical protein B456_002G257500 [Gossypium raimondii]
Length=371

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++ GRR ID N+P GEHNLVEWAKPYL NKR+VFRVLD+RL+GQY+L   QK A
Sbjct  274  GVVLLEIICGRRAIDKNKPSGEHNLVEWAKPYLTNKRRVFRVLDTRLQGQYSLNRVQKAA  333

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKE  493
            +LALHCL+K+P+ RP+MD+VVK LEQL+E
Sbjct  334  HLALHCLAKEPKSRPSMDEVVKRLEQLQE  362



>ref|XP_003522100.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Glycine max]
Length=414

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 98/158 (62%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GE  LVEWAKPYL+NKR+VFRV+DSRLEGQY+L  +Q+ A
Sbjct  272  GVVLLEMLSGRRAIDKNRPSGEQCLVEWAKPYLSNKRRVFRVMDSRLEGQYSLTQAQRAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA  CL+ +P++RP MD+VV+ LEQL+ES +     ++     H +RS  +   L    
Sbjct  332  TLAFQCLAVEPKYRPNMDEVVRALEQLRESNN-----DQVKNGDHKKRSRVSGSGLGHHN  386

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
                +T+            +I       YPRPS S LY
Sbjct  387  GLPASTS----------KGSIDAAKKFNYPRPSASLLY  414



>ref|XP_010557252.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=435

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 101/158 (64%), Gaps = 19/158 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKR+VFRV+D+RL+ QY++E + KVA
Sbjct  296  GVVLLEMLSGRRAVDKNRPTGEHNLVEWAKPYLANKRRVFRVIDNRLQDQYSMEEAHKVA  355

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ CLS + + RP M +VV  LEQ++      +L+      R  R SD  + + A++ 
Sbjct  356  TLAMRCLSTEIKLRPNMKEVVSHLEQIQ------SLNAARRERRTRRSSDSVIAKKAKVG  409

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
              + +                + N TAAYPRPS SPL+
Sbjct  410  YGQPSPM-------------AAANGTAAYPRPSGSPLH  434



>ref|XP_010111458.1| putative serine/threonine-protein kinase NAK [Morus notabilis]
 gb|EXC30981.1| putative serine/threonine-protein kinase NAK [Morus notabilis]
Length=394

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP G+HNLVEWAKPYL NKR++  V+D+RLEGQY+L ++QK A
Sbjct  265  GVVLLEMLSGRRAIDKNRPTGQHNLVEWAKPYLTNKRRLLHVMDARLEGQYSLSLAQKAA  324

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMT  478
            NLAL CL+ D ++RP +D+VV  LEQL++SKD++
Sbjct  325  NLALQCLAIDSKYRPNIDEVVTTLEQLQDSKDIS  358



>ref|XP_004249535.1| PREDICTED: probable serine/threonine-protein kinase NAK [Solanum 
lycopersicum]
Length=413

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 100/157 (64%), Gaps = 19/157 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEH+LV+WAKPYL +KR+VFRVLD+RLEGQY+L  + KVA
Sbjct  275  GVVLLEILSGKKAIDKNRPMGEHSLVDWAKPYLTSKRRVFRVLDARLEGQYSLSHALKVA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L C+S DP+ RPTMD+VV  LEQL++SKD+     K      H RS  A ++    K
Sbjct  335  ILSLQCISMDPKSRPTMDEVVTALEQLQQSKDVAKNDKKVRQVNQHSRSSFAFKK--SCK  392

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
             S + T                  A + YPRPS S L
Sbjct  393  SSTEETP-----------------AKSKYPRPSLSLL  412



>ref|XP_010557253.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=432

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 101/158 (64%), Gaps = 19/158 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKR+VFRV+D+RL+ QY++E + KVA
Sbjct  293  GVVLLEMLSGRRAVDKNRPTGEHNLVEWAKPYLANKRRVFRVIDNRLQDQYSMEEAHKVA  352

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ CLS + + RP M +VV  LEQ++      +L+      R  R SD  + + A++ 
Sbjct  353  TLAMRCLSTEIKLRPNMKEVVSHLEQIQ------SLNAARRERRTRRSSDSVIAKKAKVG  406

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
              + +                + N TAAYPRPS SPL+
Sbjct  407  YGQPSPM-------------AAANGTAAYPRPSGSPLH  431



>ref|XP_002534306.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF28074.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=389

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 97/159 (61%), Gaps = 39/159 (25%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP G+HNLVEWAKPYL NKR+V  VLD+R+EGQY+L  +QKVA
Sbjct  270  GVVLLEMLSGRRAIDKNRPTGQHNLVEWAKPYLTNKRRVLHVLDTRIEGQYSLSRAQKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            +L + CL  +P+FRP+MD+VV+ LEQL+ES      + K   +R H              
Sbjct  330  SLTVQCLDVEPKFRPSMDEVVQALEQLQES------NKKESNTRAH-------------G  370

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            ++ D  T                    +YPRPS SPL+A
Sbjct  371  DTNDGRT--------------------SYPRPSRSPLFA  389



>ref|XP_009588344.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
tomentosiformis]
Length=417

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 104/155 (67%), Gaps = 16/155 (10%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEH+LV W++PYL +KR+VFRVLDSRLEGQY+L  + KVA
Sbjct  275  GVVLLEILSGKKAIDKNRPTGEHSLVGWSRPYLTSKRRVFRVLDSRLEGQYSLTRALKVA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLAL CL+ DP+ RPTMD+VV  LEQL+ESKD      K+D ++         ++L +L 
Sbjct  335  NLALQCLAMDPKSRPTMDEVVTALEQLQESKDTA----KNDTNKD--------QQLNRLI  382

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTS  295
             S+ ++      R  S+    + N    YPRPS S
Sbjct  383  SSQSSSEFNRSCRSSSEETPRAAN----YPRPSAS  413



>emb|CDP00097.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 88/109 (81%), Gaps = 3/109 (3%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRRVID NRP GEHNL+EWAKPYLA+KR++F+V+D+R+EGQY+L  + K A
Sbjct  270  GVVLLEMLTGRRVIDKNRPPGEHNLIEWAKPYLASKRRIFQVIDARIEGQYSLGGAIKAA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRS  433
            NLA+ CL+ +P++RP MD+VVK LEQL++S   +    KH+  R H ++
Sbjct  330  NLAVKCLATEPKYRPNMDEVVKALEQLQDSDSGSV---KHEVVRKHHKT  375



>ref|XP_009353659.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009353660.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=391

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKP+LANKRK+FRV+D+RLEGQY+++ + K A
Sbjct  270  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPFLANKRKIFRVIDNRLEGQYSMDGAHKAA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRS  433
             LA  C+S + + RP MD+VV  LEQL++S    T   + +G R  RRS
Sbjct  330  TLAARCISTESKLRPNMDEVVTALEQLQDSN--ATGGTQSNGQRMRRRS  376



>ref|XP_009766459.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nicotiana 
sylvestris]
Length=416

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 95/155 (61%), Gaps = 17/155 (11%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GE +LV W++PYL +KR+VFRVLDSRLEGQY+L  + KVA
Sbjct  275  GVVLLEILSGKKAIDKNRPTGEQSLVGWSRPYLTSKRRVFRVLDSRLEGQYSLTRALKVA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLAL CL+ DP+ RPTMD+VV  LEQL+ESKD        D   +   S  + E     +
Sbjct  335  NLALQCLAMDPKSRPTMDEVVTALEQLQESKDTAKTDTNKDQQLNRLSSQSSSELNRSCR  394

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTS  295
             S + T                    A+YPRPS S
Sbjct  395  SSSEETP-----------------RAASYPRPSAS  412



>ref|XP_007141880.1| hypothetical protein PHAVU_008G233400g [Phaseolus vulgaris]
 gb|ESW13874.1| hypothetical protein PHAVU_008G233400g [Phaseolus vulgaris]
Length=400

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++SG+R +D NRP GEHNL+EWAKPYL+NKR++F+V+D+R+EGQY++  + KV+
Sbjct  270  GVVLLEIMSGKRALDSNRPGGEHNLIEWAKPYLSNKRRIFQVMDARIEGQYSMRTAMKVS  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
            NLA+ CLS +PRFRP MD+VV+ LE+L++S D
Sbjct  330  NLAIQCLSVEPRFRPKMDEVVRTLEELQDSGD  361



>ref|XP_008802716.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Phoenix 
dactylifera]
Length=382

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 101/164 (62%), Gaps = 33/164 (20%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L  +QK A
Sbjct  243  GVVLLEMLSGRRAIDKNRPPGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSLAAAQKAA  302

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMT-------TLSNKHDGSRHHRRSDGAV  421
             LALHCLS + +FRPTMD+VV  LEQL+++KD           S++  GS  H+    ++
Sbjct  303  ALALHCLSTEAKFRPTMDEVVSTLEQLQDNKDAAKHSQSEPKASSRSLGSSGHKLGHRSL  362

Query  420  EELAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
            EE    K                           AYPRPS SPL
Sbjct  363  EEAGTRK--------------------------VAYPRPSASPL  380



>ref|XP_006846202.1| hypothetical protein AMTR_s00012p00221000 [Amborella trichopoda]
 gb|ERN07877.1| hypothetical protein AMTR_s00012p00221000 [Amborella trichopoda]
Length=405

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 101/160 (63%), Gaps = 32/160 (20%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYL+NKRK+FRV+DSR+EGQY+L+++QK A
Sbjct  277  GVVLLEMLSGRRALDKNRPTGEHNLVEWAKPYLSNKRKLFRVMDSRIEGQYSLKIAQKAA  336

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS +P++RP+M +VV+ LEQL+ESKD                            
Sbjct  337  ALALQCLSSEPKYRPSMKEVVEVLEQLQESKDA---------------------------  369

Query  399  ESEDTTTLgsrrrrrsdgDAISR-NATAAYPRPSTSPLYA  283
                  T     +     +  SR N T +YPRPS SPLY+
Sbjct  370  ----PRTFQPEPQSMPTRNGSSRPNGTVSYPRPSASPLYS  405



>ref|NP_001274846.1| protein kinase APK1B, chloroplastic-like [Solanum tuberosum]
 gb|ABN69037.1| protein kinase [Solanum tuberosum]
Length=416

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 100/155 (65%), Gaps = 17/155 (11%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEHNLVE ++PYL +KR+VFRVLDSRLEGQY+L  + KVA
Sbjct  275  GVVLLEILSGKKAIDKNRPTGEHNLVECSRPYLTSKRRVFRVLDSRLEGQYSLTRALKVA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            N+AL CL+ DP+ RPTMD+VV  LEQL+ESKD    ++K+   + +R S  +  EL +  
Sbjct  335  NVALQCLAMDPKSRPTMDEVVTALEQLQESKDRVK-NDKNKDQQLNRLSSQSSGELNKSF  393

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTS  295
             S    T                   A YPRPS S
Sbjct  394  RSNSEETPR----------------VANYPRPSAS  412



>ref|XP_004307510.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVV+LEMLSGRR +D NRP GEH+LVEWAKPYLA+KR+V +V D+R++GQY++  + K  
Sbjct  259  GVVMLEMLSGRRAVDKNRPTGEHSLVEWAKPYLASKRRVLQVFDARIDGQYSVAAALKAV  318

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM  481
            NLA+ CLS +P+FRP M DVVK LEQL+E++DM
Sbjct  319  NLAIRCLSTEPKFRPIMSDVVKSLEQLQETEDM  351



>ref|XP_009414323.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GEHNLVEWA+PYL +KRK+FRVLD RL GQY+L  +QK A
Sbjct  277  GVVLLELLSGRRAVDKNRPTGEHNLVEWARPYLTSKRKIFRVLDPRLGGQYSLVGAQKAA  336

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL CLS + R+RPTMD VV  LEQL+++KD
Sbjct  337  VLALQCLSSEARYRPTMDQVVAALEQLQDAKD  368



>ref|XP_009414322.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=424

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GEHNLVEWA+PYL +KRK+FRVLD RL GQY+L  +QK A
Sbjct  284  GVVLLELLSGRRAVDKNRPTGEHNLVEWARPYLTSKRKIFRVLDPRLGGQYSLVGAQKAA  343

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL CLS + R+RPTMD VV  LEQL+++KD
Sbjct  344  VLALQCLSSEARYRPTMDQVVAALEQLQDAKD  375



>ref|XP_006435539.1| hypothetical protein CICLE_v10031723mg [Citrus clementina]
 ref|XP_006486484.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Citrus sinensis]
 gb|ESR48779.1| hypothetical protein CICLE_v10031723mg [Citrus clementina]
 gb|KDO69305.1| hypothetical protein CISIN_1g015731mg [Citrus sinensis]
Length=400

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRRVID NRP  EHNL+EWAKPYL +KR++F+V+D+R+EGQY+L  + K A
Sbjct  269  GVVLLEMLSGRRVIDKNRPSREHNLIEWAKPYLQSKRRIFQVMDARIEGQYSLGAALKTA  328

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LA+ CLS +P+FRPTMD+VVK LEQ++++ D
Sbjct  329  VLAIKCLSNEPKFRPTMDEVVKALEQIQDTND  360



>ref|XP_006486482.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006486483.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Citrus sinensis]
 gb|KDO69306.1| hypothetical protein CISIN_1g015731mg [Citrus sinensis]
Length=401

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRRVID NRP  EHNL+EWAKPYL +KR++F+V+D+R+EGQY+L  + K A
Sbjct  270  GVVLLEMLSGRRVIDKNRPSREHNLIEWAKPYLQSKRRIFQVMDARIEGQYSLGAALKTA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LA+ CLS +P+FRPTMD+VVK LEQ++++ D
Sbjct  330  VLAIKCLSNEPKFRPTMDEVVKALEQIQDTND  361



>ref|XP_010521843.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010521844.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Tarenaya 
hassleriana]
Length=414

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 98/158 (62%), Gaps = 14/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLANKRK+FRV+DSRL+ QY++E   K A
Sbjct  270  GVVLLEMLSGRRAVDKNRPAGEHNLVEWAKPYLANKRKMFRVIDSRLQDQYSMEEVYKAA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CLS + + RP M DVV +LEQ++     +    + +     R +D  + + A++ 
Sbjct  330  TLALRCLSTEVKLRPNMKDVVSQLEQIRALNASSGNPERRERRARRRSTDSVITKKAKVG  389

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
                 + + +              + AAYPRPS SPL+
Sbjct  390  YFAQPSPMAA--------------SVAAYPRPSASPLH  413



>ref|XP_008343582.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Malus domestica]
Length=395

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVV+LE+LSGRRV+D NRP GEHNLVEWAKPYLA+KRKV ++ D R+EGQY+L+ + +  
Sbjct  253  GVVMLELLSGRRVVDKNRPSGEHNLVEWAKPYLASKRKVIQIFDGRIEGQYSLDEALRAV  312

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
            NLA+ CL+ +P+ RPTMDDVVK LEQL+E  D
Sbjct  313  NLAIQCLAVEPKSRPTMDDVVKALEQLQEPSD  344



>ref|XP_002466186.1| hypothetical protein SORBIDRAFT_01g003130 [Sorghum bicolor]
 gb|EER93184.1| hypothetical protein SORBIDRAFT_01g003130 [Sorghum bicolor]
Length=418

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWA+PYLA+KRK+FR+LD+RLEGQY L  +Q +A
Sbjct  277  GVVLLEMLSGRRAIDKNRPQGEHNLVEWARPYLAHKRKIFRILDTRLEGQYNLNSAQSIA  336

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRH  445
             LAL CLS + + RPTMDDVV  L+++++S +   L     G++ 
Sbjct  337  ALALECLSYEAKMRPTMDDVVTILQEVQDSSEAEKLQEPKAGTKQ  381



>ref|XP_008354131.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Malus domestica]
Length=427

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVV+LE+LSGRRV+D NRP GEHNLVEWAKPYLA+KRKV ++ D R+EGQY+L+ + +  
Sbjct  285  GVVMLELLSGRRVVDKNRPSGEHNLVEWAKPYLASKRKVIQIFDGRIEGQYSLDEALRAV  344

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
            NLA+ CL+ +P+ RPTMDDVVK LEQL+E  D
Sbjct  345  NLAIQCLAVEPKSRPTMDDVVKALEQLQEPSD  376



>ref|XP_003616404.1| Serine/threonine protein kinase [Medicago truncatula]
Length=233

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++SG+R +D NRP GEHNL+EWAKPYL +KR+VF+V+D+R+EGQYT+  + KVA
Sbjct  89   GVVLLEIMSGKRALDNNRPSGEHNLIEWAKPYLNSKRRVFQVMDARIEGQYTVRQAMKVA  148

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKES  490
            +LA+ CLS +PRFRP MD++V+ LE+L+ S
Sbjct  149  DLAVRCLSVEPRFRPKMDEIVRVLEELQSS  178



>ref|XP_004490898.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cicer arietinum]
Length=397

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 88/121 (73%), Gaps = 14/121 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++SG+R +D NRP GEHNL+EWAKPYL +KR++F+V+D+R+EGQYTL  + KVA
Sbjct  269  GVVLLEIMSGKRTLDNNRPSGEHNLIEWAKPYLNSKRRIFQVMDARIEGQYTLRQAMKVA  328

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM--------------TTLSNKHDGSRHH  442
            +LA+ CLS +PRFRP MD+VV+ LE+L+ S D               +  S++ +G R H
Sbjct  329  DLAVQCLSVEPRFRPKMDEVVRALEELQGSDDTIEGAGSSRDRNIRRSVHSSRSNGPRQH  388

Query  441  R  439
            R
Sbjct  389  R  389



>ref|XP_003519344.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform 1 
[Glycine max]
 gb|KHN41092.1| Protein kinase APK1A-like protein, chloroplastic [Glycine soja]
Length=392

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 85/114 (75%), Gaps = 7/114 (6%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++SG+R +D NRP GEHNL+EWAKPYL++KR++F+V+D+R+EGQY L  + KVA
Sbjct  270  GVVLLEIMSGKRALDSNRPSGEHNLIEWAKPYLSSKRRIFQVMDARIEGQYMLREAMKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTT-------LSNKHDGSRHHR  439
             LA+ CLS +PRFRP MD+VV+ LE+L++S D           + +  G R HR
Sbjct  330  TLAIQCLSVEPRFRPKMDEVVRALEELQDSDDRVGGVGSSRDQTTRRSGPRQHR  383



>ref|XP_009343547.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Pyrus x 
bretschneideri]
Length=402

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVV+LE+LSGRR +D NRP GEHNLVEWAKPYLA+KRKV ++ D R+EGQY+L+ + +  
Sbjct  260  GVVMLELLSGRRAVDKNRPSGEHNLVEWAKPYLASKRKVTQIFDGRIEGQYSLDEALRAV  319

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
            NLA+ CL+ +PR RPTMDDVVK LEQL+E  D
Sbjct  320  NLAIRCLAVEPRVRPTMDDVVKALEQLQEPSD  351



>gb|KEH39440.1| kinase 1B [Medicago truncatula]
Length=407

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG+R +D NRP G+H+LVEWAKPYLANKRKVF VLDSRLEGQY+ + S +VA
Sbjct  273  GVVLLEMLSGKRAVDKNRPSGQHSLVEWAKPYLANKRKVFSVLDSRLEGQYSSDESYRVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             LAL CLS + R+RP MD+VV+ LEQLK
Sbjct  333  TLALRCLSTESRYRPNMDEVVRILEQLK  360



>ref|XP_011091519.1| PREDICTED: probable serine/threonine-protein kinase NAK [Sesamum 
indicum]
Length=397

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 98/159 (62%), Gaps = 32/159 (20%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRRV+D NRP GE NL+EWA+PYLA+KR+V RV+D+RLEGQY+   + + A
Sbjct  271  GVVLLEMLTGRRVLDKNRPHGEQNLIEWARPYLASKRRVLRVMDARLEGQYSPSGALRAA  330

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ CL+ +P+ RPTMDDVVK LEQL+E   + T     +  +H R  D          
Sbjct  331  TLAIKCLALEPKHRPTMDDVVKALEQLQEMGSVKT----EEAQKHRRARD----------  376

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
              ED+++                   A+YPRPS SP+ A
Sbjct  377  --EDSSS----------------RKMASYPRPSVSPILA  397



>dbj|BAJ98795.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=271

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D N+P GEHNLVEWA+PYL +KR++FRVLD RL GQY+L  +QK A
Sbjct  140  GVVLLEMLSGRRAVDKNQPTGEHNLVEWARPYLTSKRRIFRVLDPRLGGQYSLAKAQKTA  199

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
            +LAL CLS D R RP+M+ VV  LEQL ++K+
Sbjct  200  SLALQCLSADSRHRPSMEQVVVALEQLHDAKE  231



>ref|XP_010558327.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010558328.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Tarenaya hassleriana]
Length=392

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID N+P GEHNLVEWAKPYL N+R+V RV+D RL+GQY+L  + KVA
Sbjct  267  GVVLLEMLSGRRAIDKNQPVGEHNLVEWAKPYLTNRRRVLRVMDPRLQGQYSLTRAHKVA  326

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMT  478
             LAL CLS D + RP+M+DVVK LE+L+  KD T
Sbjct  327  ILALDCLSVDAKLRPSMNDVVKTLEELQSHKDST  360



>ref|XP_009626085.1| PREDICTED: protein kinase APK1A, chloroplastic [Nicotiana tomentosiformis]
Length=395

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 95/156 (61%), Gaps = 28/156 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM++GRRV+D NRP GE NL+EWAKP+L++KRKV R++D R+EGQY+LE + K A
Sbjct  264  GVVLLEMMTGRRVVDKNRPHGEQNLIEWAKPFLSSKRKVLRIMDPRIEGQYSLEGALKAA  323

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ CL+ +P+FRP M +VVK LEQL+ S +  +L       RH             L+
Sbjct  324  LLAVKCLALEPKFRPKMHEVVKALEQLQNSNESGSLKRDQTQRRH-------------LR  370

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSP  292
               D                 SR  T++YPRP+ SP
Sbjct  371  TCTDEA---------------SRRKTSSYPRPAASP  391



>ref|XP_007208720.1| hypothetical protein PRUPE_ppa015273mg, partial [Prunus persica]
 gb|EMJ09919.1| hypothetical protein PRUPE_ppa015273mg, partial [Prunus persica]
Length=310

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWAKPYL NKR+VFRV+DSRLEGQY+L  +QK A
Sbjct  231  GVVLLEMLSGRRAIDKNRPTGEHNLVEWAKPYLRNKRRVFRVIDSRLEGQYSLNRAQKAA  290

Query  579  NLALHCLSKDPRFRPTMDDV  520
            NLAL CLS DP++RP +++V
Sbjct  291  NLALQCLSIDPKYRPDVNEV  310



>ref|XP_006365700.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Solanum 
tuberosum]
Length=394

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 94/157 (60%), Gaps = 28/157 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRRV+D NRP GEHNL+EWAKP+L +KRKV R++D R+EGQY++E + + A
Sbjct  264  GVVLLEMLTGRRVMDKNRPHGEHNLIEWAKPFLTSKRKVLRIMDHRIEGQYSVEGALRAA  323

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ CL+ +P+FRP M +VVK LEQL+   +  +L  +    +HHR S           
Sbjct  324  LLAVKCLALEPKFRPKMPEVVKALEQLQNLNESGSLKRETTQRKHHRTSTDEA-------  376

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
                                 S   T +YPRP+ SPL
Sbjct  377  ---------------------SGRKTTSYPRPAASPL  392



>ref|XP_009759469.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Nicotiana 
sylvestris]
Length=395

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 98/156 (63%), Gaps = 28/156 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRRV+D NRP GE NL+EWAKP+L++KRKV R++D R+EGQY++E + K A
Sbjct  264  GVVLLEMLTGRRVVDKNRPHGEQNLIEWAKPFLSSKRKVLRIMDPRIEGQYSVEGALKAA  323

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ CL+ +P+FRP M +VVK LEQL+ S +  +L  +    R HRR+    +E     
Sbjct  324  LLAVKCLALEPKFRPKMHEVVKALEQLQNSNESGSL-KRDQTQRKHRRT--CTDE-----  375

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSP  292
                                 SR  T++YPRP+ SP
Sbjct  376  --------------------ASRRKTSSYPRPAASP  391



>ref|XP_010558326.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Tarenaya hassleriana]
Length=406

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID N+P GEHNLVEWAKPYL N+R+V RV+D RL+GQY+L  + KVA
Sbjct  281  GVVLLEMLSGRRAIDKNQPVGEHNLVEWAKPYLTNRRRVLRVMDPRLQGQYSLTRAHKVA  340

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMT  478
             LAL CLS D + RP+M+DVVK LE+L+  KD T
Sbjct  341  ILALDCLSVDAKLRPSMNDVVKTLEELQSHKDST  374



>ref|XP_010658583.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X2 [Vitis 
vinifera]
Length=372

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYLA+KRK+F VLDSR++GQ++L  +   A
Sbjct  242  GVVLLEMLSGRRAVDKNRPSGEHNLVEWARPYLASKRKIFHVLDSRIQGQFSLNGAHGAA  301

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS-NKHDGSRHHRRSDG  427
             +A+ CLS +P+ RP MD VV  LEQL+   + TT S N+   + H+  S+G
Sbjct  302  RVAIQCLSTEPKHRPNMDQVVTALEQLQADSNNTTASQNRPRPNFHNSSSNG  353



>ref|XP_002283701.1| PREDICTED: protein kinase APK1A, chloroplastic isoform X1 [Vitis 
vinifera]
 emb|CBI31685.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYLA+KRK+F VLDSR++GQ++L  +   A
Sbjct  274  GVVLLEMLSGRRAVDKNRPSGEHNLVEWARPYLASKRKIFHVLDSRIQGQFSLNGAHGAA  333

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS-NKHDGSRHHRRSDG  427
             +A+ CLS +P+ RP MD VV  LEQL+   + TT S N+   + H+  S+G
Sbjct  334  RVAIQCLSTEPKHRPNMDQVVTALEQLQADSNNTTASQNRPRPNFHNSSSNG  385



>ref|NP_001169424.1| uncharacterized protein LOC100383293 [Zea mays]
 gb|ACN33713.1| unknown [Zea mays]
Length=163

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID NRP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L+ +Q +A
Sbjct  18   GVVLLEVLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLDGAQAIA  77

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRH  445
             L+L C S + + RPTMD VV  LE+L++S +         G++ 
Sbjct  78   ALSLECPSYEAKMRPTMDAVVTILEELQDSGEAEKRQGPKAGTKQ  122



>ref|XP_008810614.1| PREDICTED: protein kinase APK1A, chloroplastic [Phoenix dactylifera]
Length=415

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 103/166 (62%), Gaps = 33/166 (20%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+P+LANK+++FR+LD+RL GQY+L  +QK A
Sbjct  276  GVVLLEMLSGRRAVDKNRPAGEHNLVEWARPHLANKKRIFRILDARLGGQYSLGGAQKAA  335

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMT-------TLSNKHDGSRHHRRSDGAV  421
             LAL CLS + ++RP MD+VV ELEQL+++KD          +S+++ GS   R    +V
Sbjct  336  ALALQCLSIEAKYRPNMDEVVPELEQLQDTKDTGRNPQTERKVSSQYVGSNLQRYRRRSV  395

Query  420  EELAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            EE  + K                           AY RPS SPLYA
Sbjct  396  EEPGRGK--------------------------GAYARPSASPLYA  415



>ref|XP_004246420.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Solanum lycopersicum]
Length=416

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 100/155 (65%), Gaps = 17/155 (11%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEHNLVE ++ YL +KR+VFRVLDSRLEGQY+L  + KVA
Sbjct  275  GVVLLEILSGKKAIDKNRPTGEHNLVECSRAYLTSKRRVFRVLDSRLEGQYSLTRALKVA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            ++AL CL+ DP+ RPTMD+VV  LEQL+ESKD    ++K+   + +R S  +  EL +  
Sbjct  335  SVALQCLAMDPKSRPTMDEVVTALEQLQESKDRVK-NDKNKDQQLNRLSSQSSGELNKSF  393

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTS  295
             S    T                   A+YPRPS S
Sbjct  394  RSNSEETPR----------------VASYPRPSAS  412



>gb|ACU19261.1| unknown [Glycine max]
Length=392

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 84/114 (74%), Gaps = 7/114 (6%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++ G+R +D NRP GEHNL+EWAKPYL++KR++F+V+D+R+EGQY L  + KVA
Sbjct  270  GVVLLEIMFGKRALDSNRPSGEHNLIEWAKPYLSSKRRIFQVMDARIEGQYMLREAMKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTT-------LSNKHDGSRHHR  439
             LA+ CLS +PRFRP MD+VV+ LE+L++S D           + +  G R HR
Sbjct  330  TLAIQCLSVEPRFRPKMDEVVRALEELQDSDDRVGGVGSSRDQTTRRSGPRQHR  383



>gb|ACL52762.1| unknown [Zea mays]
Length=259

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID NRP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L+ +Q +A
Sbjct  114  GVVLLEVLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLDGAQAIA  173

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             L+L CLS + + RPTMD VV  LE+L++S +
Sbjct  174  ALSLECLSYEAKMRPTMDAVVTILEELQDSGE  205



>gb|ACF85751.1| unknown [Zea mays]
 gb|AFW67137.1| putative protein kinase superfamily protein isoform 1 [Zea mays]
 gb|AFW67138.1| putative protein kinase superfamily protein isoform 2 [Zea mays]
Length=259

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID NRP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L+ +Q +A
Sbjct  114  GVVLLEVLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLDGAQAIA  173

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             L+L CLS + + RPTMD VV  LE+L++S +
Sbjct  174  ALSLECLSYEAKMRPTMDAVVTILEELQDSGE  205



>ref|XP_010325852.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Solanum lycopersicum]
Length=422

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 100/155 (65%), Gaps = 17/155 (11%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEHNLVE ++ YL +KR+VFRVLDSRLEGQY+L  + KVA
Sbjct  281  GVVLLEILSGKKAIDKNRPTGEHNLVECSRAYLTSKRRVFRVLDSRLEGQYSLTRALKVA  340

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            ++AL CL+ DP+ RPTMD+VV  LEQL+ESKD    ++K+   + +R S  +  EL +  
Sbjct  341  SVALQCLAMDPKSRPTMDEVVTALEQLQESKDRVK-NDKNKDQQLNRLSSQSSGELNKSF  399

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTS  295
             S    T                   A+YPRPS S
Sbjct  400  RSNSEET----------------PRVASYPRPSAS  418



>ref|XP_004490921.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cicer arietinum]
Length=178

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++SG+R +D NRP GEHNL+EWAKPYL +KR++F+V+D+R+EGQYTL  + KVA
Sbjct  95   GVVLLEIMSGKRTLDNNRPSGEHNLIEWAKPYLNSKRRIFQVMDARIEGQYTLRQAMKVA  154

Query  579  NLALHCLSKDPRFRPTMDDVVKEL  508
            +LA+ CLS +PRFRP MD+VV+ L
Sbjct  155  DLAVQCLSVEPRFRPKMDEVVRAL  178



>ref|NP_001241128.1| probable serine/threonine-protein kinase NAK-like [Glycine max]
 ref|XP_006601852.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X1 [Glycine max]
 ref|XP_006601853.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X2 [Glycine max]
 gb|ACM89535.1| protein kinase [Glycine max]
 gb|KHN13986.1| Putative serine/threonine-protein kinase NAK [Glycine soja]
Length=410

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 96/157 (61%), Gaps = 20/157 (13%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM+SGRR ID N+P GEHNLVEWAKPYL+NKR+VFRV+D RLEGQY+   +Q  A
Sbjct  272  GVVLLEMISGRRAIDKNQPTGEHNLVEWAKPYLSNKRRVFRVMDPRLEGQYSQNRAQAAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ C S +P+ RP MD+VVK LE+L+ESK+M      H   +HH R+ G         
Sbjct  332  ALAMQCFSVEPKCRPNMDEVVKALEELQESKNMQRKGADHK--QHHVRNSGPGRTNGGDG  389

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
             S+                  +    +AYPRPS S L
Sbjct  390  GSD------------------APRKASAYPRPSASLL  408



>ref|XP_008233629.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Prunus mume]
Length=401

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLA+KRKV  + D+R+EGQY+L  + +  
Sbjct  260  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLASKRKVLHIFDARIEGQYSLGGALRAV  319

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
            NLA+ CL+ + +FRP M+DV+K LEQL+E  D
Sbjct  320  NLAIRCLAVEAKFRPNMNDVIKALEQLQEPSD  351



>ref|XP_004981243.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Setaria 
italica]
Length=416

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L  +Q +A
Sbjct  275  GVVLLEMLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSLSGAQTIA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKES  490
             LAL CLS + + RP+MD VV  LE+L++S
Sbjct  335  TLALECLSYEAKMRPSMDAVVTILEELQDS  364



>dbj|BAJ95924.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97649.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL +KR+VFR+LD+RL GQY+L  +QK A
Sbjct  285  GVVLLEMLSGRRALDKNRPAGEHNLVEWARPYLTSKRRVFRILDARLGGQYSLPGAQKTA  344

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LA+ CLS D R RP M  VV  LEQL+++K+
Sbjct  345  ALAMQCLSGDARARPGMAQVVTALEQLQDAKE  376



>ref|XP_009404596.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=414

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 91/171 (53%), Gaps = 45/171 (26%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GEHNLVEWA+P+LA+KRK+FRVLD+RL  QY L  +QK +
Sbjct  274  GVVLLELLSGRRALDRNRPIGEHNLVEWARPFLASKRKIFRVLDTRLGAQYPLATAQKAS  333

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQL-------------KESKDMTTLSNKHDGSRHHR  439
             +AL CLS + R RP M  VV  LE+L             + S   +  SN H   R  R
Sbjct  334  FIALQCLSTEARHRPAMAQVVSALEELQNAEVTDQSLRTGQNSSSQSGYSNPH---RSRR  390

Query  438  RSDGAVEELAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
            RS G +                              N   AYPRPS SPLY
Sbjct  391  RSAGEIG-----------------------------NRKVAYPRPSASPLY  412



>ref|XP_010487686.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=170

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA
Sbjct  27   GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVA  86

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L CL+ + + RP M +VV  LE ++        +      R  RRSD    + A   
Sbjct  87   TLSLRCLTTEVKLRPNMSEVVSHLEHIQTLNAAIGGNMDRTERRMRRRSDSVASKKANAG  146

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             +  T                  +   AYPRPS SPLY
Sbjct  147  FARQTAV---------------GSTVVAYPRPSASPLY  169



>ref|XP_004236745.1| PREDICTED: protein kinase APK1A, chloroplastic [Solanum lycopersicum]
Length=394

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 93/157 (59%), Gaps = 28/157 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRRV+D NRP GEHNL+EWAKP+L +KRKV  ++D R+EGQY++E + + A
Sbjct  264  GVVLLEMLTGRRVMDKNRPHGEHNLIEWAKPFLTSKRKVLHIMDHRIEGQYSVEGALRAA  323

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ CL+ +P+FRP M +VVK LEQL+   +  +L  +    +HHR S           
Sbjct  324  LLAVKCLALEPKFRPKMPEVVKALEQLQNLNESGSLKRETTQRKHHRTSTDEA-------  376

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
                                 S   T +YPRP+ SPL
Sbjct  377  ---------------------SGRKTTSYPRPAASPL  392



>gb|EYU33216.1| hypothetical protein MIMGU_mgv1a011111mg [Erythranthe guttata]
Length=292

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 97/161 (60%), Gaps = 37/161 (23%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+L+G+RV+D NRP GE NL+EWAKPYLA+KR+V R++D+R+EGQYT   + K A
Sbjct  167  GVVLLEILTGKRVLDKNRPHGEQNLIEWAKPYLASKRRVLRIMDARIEGQYTPSGALKAA  226

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSN-KHDGSRHHRRSDGAVEELAQL  403
             LA+ C++ +P++RPTM++VVK LEQL+ES         + D  + HR            
Sbjct  227  TLAIKCIATEPKYRPTMNEVVKGLEQLQESGTAVKPEQVEADQQKLHR------------  274

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPST-SPLYA  283
                                   R ATA+YPRPS+ SP+ A
Sbjct  275  -----------------------RKATASYPRPSSASPVVA  292



>ref|XP_003616403.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES99361.1| kinase 1B [Medicago truncatula]
Length=418

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++SG+R +D NRP GEHNL+EWAKPYL +KR+VF+V+D+R+EGQYT+  + KVA
Sbjct  274  GVVLLEIMSGKRALDNNRPSGEHNLIEWAKPYLNSKRRVFQVMDARIEGQYTVRQAMKVA  333

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKES  490
            +LA+ CLS +PRFRP MD++V+ LE+L+ S
Sbjct  334  DLAVRCLSVEPRFRPKMDEIVRVLEELQSS  363



>ref|XP_004239839.1| PREDICTED: probable serine/threonine-protein kinase NAK [Solanum 
lycopersicum]
Length=409

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 97/157 (62%), Gaps = 19/157 (12%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG++ ID NRP GEHNLV+WAKPYL +K +V RVLD+RLEGQY+L  + KVA
Sbjct  271  GVVLLEILSGKKAIDKNRPMGEHNLVDWAKPYLTSKLRVSRVLDARLEGQYSLSHALKVA  330

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+  C+S +P+ RPTMD+VV  LEQL++SKD+     K      H +S  A ++    K
Sbjct  331  ILSFQCISTEPKSRPTMDEVVTALEQLQQSKDVAKNDKKVRQVNQHSQSSFAFKK--SCK  388

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
             S + T                  A + YPRPS S L
Sbjct  389  SSTEETP-----------------AESNYPRPSLSFL  408



>ref|XP_002316286.1| hypothetical protein POPTR_0010s21090g [Populus trichocarpa]
 gb|EEF02457.1| hypothetical protein POPTR_0010s21090g [Populus trichocarpa]
Length=415

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 81/107 (76%), Gaps = 7/107 (7%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP  EHNLVEWA+PYL++KR++F+V+D+R++GQY+   + K A
Sbjct  273  GVVLLEMLSGRRAIDKNRPSKEHNLVEWARPYLSSKRRIFQVMDARIQGQYSSSDALKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHR  439
            NLA+ CLS +P++RP M+ VVK LEQL  S D       +DGS+  R
Sbjct  333  NLAIQCLSTEPKYRPNMEAVVKALEQLHNSND-------NDGSKGSR  372



>gb|AET14353.1| protein kinase 1b [Glycine max]
Length=412

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP G+HNLVEWAKPYLANK K+ RVLD+RLEGQY L+ + KVA
Sbjct  280  GVVLLEMLSGRRAVDKNRPSGQHNLVEWAKPYLANKHKLLRVLDNRLEGQYALDEACKVA  339

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CL+ + + RPTMD+VV +LEQL+
Sbjct  340  TLSLRCLATESKLRPTMDEVVTDLEQLQ  367



>ref|XP_006590337.1| PREDICTED: uncharacterized protein LOC100809679 isoform X1 [Glycine 
max]
Length=412

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP G+HNLVEWAKPYLANK K+ RVLD+RLEGQY L+ + KVA
Sbjct  280  GVVLLEMLSGRRAVDKNRPSGQHNLVEWAKPYLANKHKLLRVLDNRLEGQYALDEACKVA  339

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CL+ + + RPTMD+VV +LEQL+
Sbjct  340  TLSLRCLATESKLRPTMDEVVTDLEQLQ  367



>gb|EMS53821.1| putative serine/threonine-protein kinase NAK [Triticum urartu]
Length=493

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL +KR++FRVLD RL GQY+L  +QK A
Sbjct  272  GVVLLEMLSGRRAVDKNRPTGEHNLVEWARPYLTSKRRIFRVLDPRLGGQYSLAKAQKAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTT  475
            +LAL CLS D R RP+M+ VV  LEQL ++K+  T
Sbjct  332  SLALQCLSVDSRNRPSMEQVVVALEQLHDAKEGGT  366



>ref|NP_001242718.1| protein kinase APK1A, chloroplastic-like [Glycine max]
 gb|ACU20684.1| unknown [Glycine max]
Length=412

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP G+HNLVEWAKPYLANK K+ RVLD+RLEGQY L+ + KVA
Sbjct  280  GVVLLEMLSGRRAVDKNRPSGQHNLVEWAKPYLANKHKLLRVLDNRLEGQYALDEACKVA  339

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CL+ + + RPTMD+VV +LEQL+
Sbjct  340  TLSLRCLATESKLRPTMDEVVTDLEQLQ  367



>ref|XP_010231839.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Brachypodium 
distachyon]
Length=393

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL +KR++FRVLD+RL GQY+L  +QK A
Sbjct  272  GVVLLEMLSGRRAVDKNRPNGEHNLVEWARPYLTSKRRIFRVLDARLGGQYSLTSAQKAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
            +LAL CLS + R RP+M+ VV  LEQL+E  +
Sbjct  332  SLALQCLSVESRHRPSMEQVVTVLEQLQEPNE  363



>gb|ACG32116.1| protein kinase APK1B [Zea mays]
Length=419

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L  +Q +A
Sbjct  275  GVVLLEMLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLNGAQTIA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL CLS + + RPTMD VV  LE+L+ S +
Sbjct  335  ALALECLSYEAKMRPTMDAVVAILEELQGSGE  366



>gb|KDP44953.1| hypothetical protein JCGZ_01453 [Jatropha curcas]
Length=415

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID N+P  E NLVEWA+PYL +KRK+F+V+D+R+EGQY+L+ + K A
Sbjct  273  GVVLLEMLSGRRAIDKNKPSREQNLVEWARPYLGSKRKIFQVMDARIEGQYSLKDALKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LA+ CLS +PR+RP M++VVK LEQL ES D
Sbjct  333  TLAVQCLSTEPRYRPNMEEVVKALEQLLESND  364



>gb|ACF87678.1| unknown [Zea mays]
 tpg|DAA52220.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=419

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L  +Q +A
Sbjct  275  GVVLLEMLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLNGAQTIA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL CLS + + RPTMD VV  LE+L+ S +
Sbjct  335  ALALECLSYEAKMRPTMDAVVAILEELQGSGE  366



>gb|EYU26593.1| hypothetical protein MIMGU_mgv1a007265mg [Erythranthe guttata]
Length=413

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 83/115 (72%), Gaps = 2/115 (2%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVL+E+L G++ ID NRP GEHNLVEWAKPYL NKR++ RVLD+RLEGQY+L  + K A
Sbjct  278  GVVLVEILCGKKAIDKNRPPGEHNLVEWAKPYLTNKRRILRVLDNRLEGQYSLAHAVKAA  337

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEE  415
             LAL CLS + R RP+MD+VV  LEQL++S   T +   H  +RH + + G   E
Sbjct  338  QLALQCLSTEARSRPSMDEVVTALEQLQDSN--TNIQKNHRLNRHGKTNSGPNSE  390



>gb|KHN21952.1| Protein kinase APK1A, chloroplastic [Glycine soja]
Length=472

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP G+HNLVEWAKPYLANK K+ RVLD+RLEGQY L+ + KVA
Sbjct  340  GVVLLEMLSGRRAVDKNRPSGQHNLVEWAKPYLANKHKLLRVLDNRLEGQYALDEACKVA  399

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CL+ + + RPTMD+VV +LEQL+
Sbjct  400  TLSLRCLATESKLRPTMDEVVTDLEQLQ  427



>gb|KEH30160.1| kinase 1B [Medicago truncatula]
Length=498

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 82/113 (73%), Gaps = 5/113 (4%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRRV+D NRP  +HNLVEWAKPYL+NKRK+ RVLDSRLEGQY LE   KVA
Sbjct  371  GVVLLEMLSGRRVVDKNRPQRQHNLVEWAKPYLSNKRKILRVLDSRLEGQYELEDIYKVA  430

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAV  421
             L+L CLS + + RP MD+VV  LEQL+         N+ + +R  RRS G V
Sbjct  431  TLSLRCLSVEAKLRPNMDEVVTNLEQLQVPH-----VNESNKNRLRRRSAGDV  478



>ref|XP_002311169.2| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
 gb|EEE88536.2| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
Length=413

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 94/157 (60%), Gaps = 18/157 (11%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP  E  LVEWA+PYL++KRK+F+V+D+R++GQY+   + K A
Sbjct  273  GVVLLEMLSGRRAIDKNRPSKEQYLVEWARPYLSSKRKIFQVMDARIQGQYSSSDALKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLA+ CLS +PR+RP M++VVK LEQL         SN +DGSR  R   G +       
Sbjct  333  NLAIQCLSAEPRYRPNMEEVVKALEQLHN-------SNNNDGSRGSR---GEIPRRVHRS  382

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
             S   T            + +S    A+Y  P  SPL
Sbjct  383  SSNGPT--------YHRKNEVSNGKPASYAGPCVSPL  411



>ref|XP_006379595.1| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
 gb|ERP57392.1| hypothetical protein POPTR_0008s05650g [Populus trichocarpa]
Length=413

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 94/157 (60%), Gaps = 18/157 (11%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP  E  LVEWA+PYL++KRK+F+V+D+R++GQY+   + K A
Sbjct  273  GVVLLEMLSGRRAIDKNRPSKEQYLVEWARPYLSSKRKIFQVMDARIQGQYSSSDALKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
            NLA+ CLS +PR+RP M++VVK LEQL         SN +DGSR  R   G +       
Sbjct  333  NLAIQCLSAEPRYRPNMEEVVKALEQLHN-------SNNNDGSRGSR---GEIPRRVHRS  382

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
             S   T            + +S    A+Y  P  SPL
Sbjct  383  SSNGPT--------YHRKNEVSNGKPASYAGPCVSPL  411



>gb|AGU99598.1| protein kinase [Triticum aestivum]
Length=472

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L  +Q +A
Sbjct  315  GVVLLEMLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSLNGAQTIA  374

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LA+ CLS + + RP+MD VV  LE +++S D
Sbjct  375  ALAVECLSFEAKMRPSMDAVVSILEGIQDSSD  406



>ref|XP_004171473.1| PREDICTED: probable serine/threonine-protein kinase NAK-like, 
partial [Cucumis sativus]
Length=397

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GEHNLV+WAKPYL NK K+ RV+D+RLEG Y L  +Q+ A
Sbjct  286  GVVLLELLSGRRALDKNRPTGEHNLVDWAKPYLVNKHKIRRVMDNRLEGHYALGQAQRAA  345

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQL-KESKDMTTLSNKHDGSRHHR  439
            NLA  CL+ DP++RPTM++VV  LEQL K S+ + +    H+G  + R
Sbjct  346  NLAFLCLAIDPKYRPTMNEVVTSLEQLQKPSEVLRSGRESHNGQSNGR  393



>ref|XP_004142067.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
[Cucumis sativus]
 gb|KGN54255.1| hypothetical protein Csa_4G296090 [Cucumis sativus]
Length=384

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GEHNLV+WAKPYL NK K+ RV+D+RLEG Y L  +Q+ A
Sbjct  273  GVVLLELLSGRRALDKNRPTGEHNLVDWAKPYLVNKHKIRRVMDNRLEGHYALGQAQRAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQL-KESKDMTTLSNKHDGSRHHR  439
            NLA  CL+ DP++RPTM++VV  LEQL K S+ + +    H+G  + R
Sbjct  333  NLAFLCLAIDPKYRPTMNEVVTSLEQLQKPSEVLRSGRESHNGQSNGR  380



>gb|EMT32058.1| Protein kinase APK1A, chloroplastic [Aegilops tauschii]
Length=423

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L  +Q +A
Sbjct  273  GVVLLEMLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSLNGAQTIA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LA+ CLS + + RP+MD VV  LE +++S D
Sbjct  333  ALAVECLSFEAKMRPSMDAVVSILEGIQDSSD  364



>gb|KHN32126.1| Protein kinase APK1B, chloroplastic, partial [Glycine soja]
Length=365

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP G+HNLVEWAKPYL+NKRK+ RVLD+RLEGQY L+ + KVA
Sbjct  241  GVVLLEMLSGRRAVDKNRPSGQHNLVEWAKPYLSNKRKLLRVLDNRLEGQYELDEACKVA  300

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CL+ + + RPTMD+V  +LEQL+
Sbjct  301  TLSLRCLAIESKLRPTMDEVATDLEQLQ  328



>ref|XP_010678047.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+RVID NRP GE  LVEWAKPYL NKRK+FRVLD R+EGQY+L+ + KVA
Sbjct  272  GVVLLEILSGKRVIDKNRPNGEQKLVEWAKPYLTNKRKIFRVLDPRIEGQYSLDHAVKVA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             LAL CLS DP+ RP M+ V KELE+L+
Sbjct  332  TLALKCLSIDPKLRPNMNMVSKELEKLQ  359



>ref|XP_006650809.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Oryza brachyantha]
Length=423

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM+SGRR ID NRP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+   +Q VA
Sbjct  277  GVVLLEMMSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSHVGAQTVA  336

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL CLS + + RP+MD VV  LE+L+ES +
Sbjct  337  TLALECLSYETKMRPSMDAVVTILEELQESSN  368



>ref|XP_006591904.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Glycine max]
Length=451

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP G+HNLVEWAKPYL+NKRK+ RVLD+RLEGQY L+ + KVA
Sbjct  327  GVVLLEMLSGRRAVDKNRPSGQHNLVEWAKPYLSNKRKLLRVLDNRLEGQYELDEACKVA  386

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CL+ + + RPTMD+V  +LEQL+
Sbjct  387  TLSLRCLAIESKLRPTMDEVATDLEQLQ  414



>gb|AFK41166.1| unknown [Medicago truncatula]
 gb|KEH22883.1| kinase 1B [Medicago truncatula]
Length=407

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 98/158 (62%), Gaps = 23/158 (15%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE++SGRR ID N P GEHNLVEWAKPYL+NKR+VFRV+D RLEGQY+   +   A
Sbjct  272  GVVLLEIISGRRAIDKNLPSGEHNLVEWAKPYLSNKRRVFRVMDPRLEGQYSHSRAHAAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA  CLS +PR RP MD+VVK LEQL+E KD     ++  GS H  R+   +   A  K
Sbjct  332  ALASQCLSVEPRIRPNMDEVVKTLEQLQEPKD-----SQKKGSDHRARNSN-LGLNASGK  385

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             + D T                R A+ AYPRPS S L+
Sbjct  386  GNADAT----------------RKAS-AYPRPSASLLH  406



>ref|XP_010678048.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+RVID NRP GE  LVEWAKPYL NKRK+FRVLD R+EGQY+L+ + KVA
Sbjct  271  GVVLLEILSGKRVIDKNRPNGEQKLVEWAKPYLTNKRKIFRVLDPRIEGQYSLDHAVKVA  330

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             LAL CLS DP+ RP M+ V KELE+L+
Sbjct  331  TLALKCLSIDPKLRPNMNMVSKELEKLQ  358



>ref|NP_001145874.1| uncharacterized protein LOC100279389 [Zea mays]
 gb|ACL52773.1| unknown [Zea mays]
Length=419

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWA+PYL +KRK FR+LD+RLEGQY L  +Q +A
Sbjct  275  GVVLLEMLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKTFRILDTRLEGQYNLNGAQTIA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL CLS + + RPTMD VV  LE+L+ S +
Sbjct  335  ALALECLSYEAKMRPTMDAVVAILEELQGSGE  366



>ref|XP_008675653.1| PREDICTED: probable serine/threonine-protein kinase NAK [Zea 
mays]
Length=117

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R +D NRP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QKVA
Sbjct  25   GVVLLELLSGQRALDKNRPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKVA  84

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESK  487
             LAL CLS D R RP +D VV  LEQL+  +
Sbjct  85   TLALQCLSMDARCRPGVDQVVTALEQLQRPR  115



>ref|NP_001240055.1| protein kinase APK1A, chloroplastic-like [Glycine max]
 ref|XP_006591903.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Glycine max]
 gb|ACM89543.1| rust resistance protein [Glycine max]
Length=463

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP G+HNLVEWAKPYL+NKRK+ RVLD+RLEGQY L+ + KVA
Sbjct  339  GVVLLEMLSGRRAVDKNRPSGQHNLVEWAKPYLSNKRKLLRVLDNRLEGQYELDEACKVA  398

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CL+ + + RPTMD+V  +LEQL+
Sbjct  399  TLSLRCLAIESKLRPTMDEVATDLEQLQ  426



>gb|ABC74580.1| rust resistance gene ABC1041 [Hordeum vulgare subsp. vulgare]
 gb|ABF18544.1| serine/threonine kinase-like protein ABC1041 [Hordeum vulgare 
subsp. vulgare]
Length=425

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+L  +Q +A
Sbjct  275  GVVLLEMLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSLNGAQTIA  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMT  478
             LA+ CLS + + RP+M+ VV  LE +++S D T
Sbjct  335  ALAVECLSFEAKMRPSMEAVVSILEGIQDSSDPT  368



>ref|NP_001241432.1| probable serine/threonine-protein kinase NAK-like [Glycine max]
 ref|XP_006582915.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X1 [Glycine max]
 gb|ACM89505.1| protein kinase [Glycine max]
 gb|KHN40300.1| Putative serine/threonine-protein kinase NAK [Glycine soja]
Length=410

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 97/157 (62%), Gaps = 20/157 (13%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM+SGRR ID N+P GEHNLV+WAKPYL+NKR+VFRV+D RLEGQY    +Q  A
Sbjct  272  GVVLLEMISGRRAIDKNQPTGEHNLVDWAKPYLSNKRRVFRVIDPRLEGQYLQSRAQAAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ CLS + R RP MD+VVK LEQL+ESK+M      H   +HH R+ G         
Sbjct  332  ALAIQCLSIEARCRPNMDEVVKALEQLQESKNMQRKGADH--KQHHVRNSGPGRSNGGNG  389

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
             S+                 + R A+ AYPRPS S L
Sbjct  390  GSD-----------------VPRKAS-AYPRPSASLL  408



>ref|XP_006654906.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Oryza brachyantha]
Length=419

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL +KR++FR+LD+RL GQY+L  +QK A
Sbjct  293  GVVLLEMLSGRRALDKNRPTGEHNLVEWARPYLTSKRRIFRILDARLGGQYSLAKAQKAA  352

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTT  475
             LAL C+S + + RP M+ VV  LEQL+++K+  T
Sbjct  353  TLALQCISVEAKNRPNMEQVVAVLEQLQDAKETGT  387



>ref|NP_001141912.1| uncharacterized LOC100274061 [Zea mays]
 gb|ACF87298.1| unknown [Zea mays]
 gb|AFW67139.1| putative protein kinase superfamily protein [Zea mays]
Length=418

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID NRP GEHNLVEWA+PYL +KRK+FR+LD+RLEGQY L+ +Q +A
Sbjct  273  GVVLLEVLSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRILDTRLEGQYNLDGAQAIA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             L+L CLS + + RPTMD VV  LE+L++S +
Sbjct  333  ALSLECLSYEAKMRPTMDAVVTILEELQDSGE  364



>ref|NP_001054444.1| Os05g0110900 [Oryza sativa Japonica Group]
 gb|AAK73157.1|AC079022_30 putative protein kinase [Oryza sativa]
 gb|AAU44204.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16358.1| Os05g0110900 [Oryza sativa Japonica Group]
 dbj|BAG93323.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62074.1| hypothetical protein OsJ_16858 [Oryza sativa Japonica Group]
Length=395

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL +KR++FR+LD+RL GQY+L  +QK A
Sbjct  269  GVVLLEMLSGRRALDKNRPTGEHNLVEWARPYLMSKRRIFRILDARLGGQYSLAKAQKAA  328

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL C+S + + RP M+ VV  LEQL++SK+
Sbjct  329  TLALQCISVEAKNRPNMEQVVAVLEQLQDSKE  360



>gb|EEC78387.1| hypothetical protein OsI_18165 [Oryza sativa Indica Group]
Length=395

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL +KR++FR+LD+RL GQY+L  +QK A
Sbjct  269  GVVLLEMLSGRRALDKNRPTGEHNLVEWARPYLMSKRRIFRILDARLGGQYSLAKAQKAA  328

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL C+S + + RP M+ VV  LEQL++SK+
Sbjct  329  TLALQCISVEAKNRPNMEQVVAVLEQLQDSKE  360



>ref|XP_008447952.1| PREDICTED: probable serine/threonine-protein kinase NAK [Cucumis 
melo]
Length=384

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GEHNLV+WAKPYL NK K+ R++D+RLEG Y L  +Q+ A
Sbjct  273  GVVLLELLSGRRALDKNRPTGEHNLVDWAKPYLINKHKIRRIMDNRLEGHYGLGQAQRAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQL-KESKDMTTLSNKHDGSRHHR  439
            NLA  CL+ DP++RPTM++VV  LEQL K S+ + +    H+G  + R
Sbjct  333  NLAFLCLATDPKYRPTMNEVVTSLEQLQKPSEVLRSEREGHNGQSNGR  380



>ref|XP_007218037.1| hypothetical protein PRUPE_ppa006035mg [Prunus persica]
 gb|EMJ19236.1| hypothetical protein PRUPE_ppa006035mg [Prunus persica]
Length=366

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLA+KRKV ++ D+R+EGQY++  + +  
Sbjct  195  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLASKRKVLQIFDARIEGQYSVGGALRAV  254

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKE  493
            NLA+ CL+ +P+FR  M+DVVK LEQL+E
Sbjct  255  NLAIRCLAVEPKFRLNMNDVVKALEQLQE  283



>ref|XP_004142761.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004170949.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 gb|KGN51318.1| hypothetical protein Csa_5G517160 [Cucumis sativus]
Length=401

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 95/157 (61%), Gaps = 28/157 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID NRP GEHNLVEWAKPYL +KR+V ++LD+R+EGQY+   + K A
Sbjct  271  GVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIEGQYSTGGALKAA  330

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ C+S +P+ RP M+ VVK LEQL++S + +       GSR              L 
Sbjct  331  KLAIQCISTEPKLRPNMNAVVKALEQLQDSSETS-------GSR------------GTLS  371

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
            E  +T++          G   + N   +YPRPS S L
Sbjct  372  EPLNTSS---------QGSGSTNNKPVSYPRPSASVL  399



>ref|XP_007218038.1| hypothetical protein PRUPE_ppa006035mg [Prunus persica]
 gb|EMJ19237.1| hypothetical protein PRUPE_ppa006035mg [Prunus persica]
Length=431

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWAKPYLA+KRKV ++ D+R+EGQY++  + +  
Sbjct  260  GVVLLEMLSGRRAVDKNRPSGEHNLVEWAKPYLASKRKVLQIFDARIEGQYSVGGALRAV  319

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKE  493
            NLA+ CL+ +P+FR  M+DVVK LEQL+E
Sbjct  320  NLAIRCLAVEPKFRLNMNDVVKALEQLQE  348



>ref|XP_002892407.1| hypothetical protein ARALYDRAFT_470784 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68666.1| hypothetical protein ARALYDRAFT_470784 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 92/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA
Sbjct  267  GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVA  326

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L CL+ + + RP M +VV  LE ++        +      R  RRSD  V + A   
Sbjct  327  TLSLRCLTTEIKLRPNMSEVVSHLEHIQSLNAAIGGNMDRTERRMRRRSDSVVSKKANAG  386

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             +  T                  +   AYPRPS SPLY
Sbjct  387  FARQTAV---------------GSTVVAYPRPSASPLY  409



>ref|XP_009412594.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=417

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVL+E+L+G+R ID NRP  EHNLVEWAKPYLA+KR+V R++DSRL+GQY++  +Q+ A
Sbjct  277  GVVLVELLTGQRAIDKNRPSEEHNLVEWAKPYLASKRRVIRIMDSRLQGQYSVAGAQRTA  336

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGA  424
             LAL CLS   + RP+MD VV  LEQL+++ DM         S  HR SD A
Sbjct  337  GLALQCLSMQAKRRPSMDQVVIALEQLQDATDMERTPKTELKSSGHRGSDRA  388



>ref|XP_004492356.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X1 [Cicer arietinum]
 ref|XP_004492357.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
isoform X2 [Cicer arietinum]
Length=407

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 97/158 (61%), Gaps = 23/158 (15%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM+SGRR ID N P GEHNLVEWAKPYL+NKR+VFRV+D RLEGQY+   +   A
Sbjct  272  GVVLLEMISGRRAIDKNLPSGEHNLVEWAKPYLSNKRRVFRVMDPRLEGQYSHTRAHAAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA  CLS +PR RP MD+VVK LEQL+E K+      +  G+ H  R  G +   +  K
Sbjct  332  ALASQCLSVEPRIRPNMDEVVKTLEQLQEPKE-----TQKKGADHRVRYPG-LGNNSSGK  385

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             + D                 SR A+ AYPRPS S L+
Sbjct  386  GNADA----------------SRKAS-AYPRPSASLLH  406



>ref|XP_009380641.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
 ref|XP_009380642.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=417

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYLA+KRK+FRVLD+RLE QY+   +QK A
Sbjct  284  GVVLLEMLSGRRALDKNRPTGEHNLVEWARPYLASKRKIFRVLDARLERQYSPVGAQKAA  343

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM  481
             L+  CLS +  +RPTMD VV  LE+L+ + D+
Sbjct  344  VLSFQCLSLEASYRPTMDQVVAALEELQNATDI  376



>ref|XP_007140532.1| hypothetical protein PHAVU_008G120600g [Phaseolus vulgaris]
 gb|ESW12526.1| hypothetical protein PHAVU_008G120600g [Phaseolus vulgaris]
Length=410

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM+SGRR ID N+P GEHNLV+WAKPYL+NKR+VFRV+D RLEGQY+   +Q  A
Sbjct  272  GVVLLEMISGRRAIDKNQPSGEHNLVDWAKPYLSNKRRVFRVMDPRLEGQYSHSRAQAAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG  427
             LA+ CLS + + RP M++VVK LEQ++ESKDM      H    HH R+ G
Sbjct  332  ALAMQCLSVESKCRPNMEEVVKALEQVQESKDMQRKGADHK--HHHLRNSG  380



>ref|XP_011030315.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Populus 
euphratica]
Length=415

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 81/107 (76%), Gaps = 7/107 (7%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID N+P  E +LVEWA+PYL++KRK+F+V+D+R++GQY+   + +VA
Sbjct  273  GVVLLEMLSGRRAIDKNKPSKEQHLVEWARPYLSSKRKIFQVMDARIQGQYSSSDALEVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHR  439
            NLA+ CLS +PR+RP M +VVK LEQL         SN +DGSR  R
Sbjct  333  NLAIQCLSAEPRYRPNMKEVVKALEQLHN-------SNNNDGSRGSR  372



>gb|KEH30163.1| kinase 1B [Medicago truncatula]
Length=418

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP  +HNLVEWAKPYL NKRK+ RVLDSRLEGQY LE + KVA
Sbjct  292  GVVLLEILSGRRVVDKNRPPSQHNLVEWAKPYLTNKRKILRVLDSRLEGQYELEDAYKVA  351

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CLS + + RP MD+VV +LE+L+
Sbjct  352  TLSLRCLSIEAKLRPNMDEVVTDLEKLQ  379



>ref|XP_011027201.1| PREDICTED: protein kinase APK1A, chloroplastic [Populus euphratica]
Length=415

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 83/121 (69%), Gaps = 12/121 (10%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR ID NRP  E NLVEWA+PYL++KR++F+V+D+R++GQY+   + K A
Sbjct  273  GVVLLEMLSGRRAIDKNRPSKEQNLVEWARPYLSSKRRIFQVMDARIQGQYSSSDALKAA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKH------------DGSRHHRR  436
            NLA+ CLS +P++RP M+ VVK LEQL  S D       H            +G ++HR+
Sbjct  333  NLAIQCLSAEPKYRPHMEAVVKALEQLNNSNDNDGSKGSHGENPLRVNRSSSNGPKYHRK  392

Query  435  S  433
            +
Sbjct  393  N  393



>gb|AAO18450.1| putative protein kinase [Oryza sativa Japonica Group]
Length=416

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM+SGRR ID NRP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+   +Q VA
Sbjct  277  GVVLLEMMSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSHVGAQTVA  336

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKES  490
             LAL CLS + + RP+M+ VV  LE+L+ES
Sbjct  337  TLALECLSYEAKMRPSMEAVVTILEELQES  366



>ref|XP_006417790.1| hypothetical protein EUTSA_v10007756mg [Eutrema salsugineum]
 gb|ESQ36143.1| hypothetical protein EUTSA_v10007756mg [Eutrema salsugineum]
Length=413

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 94/158 (59%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYLANKRK+FRV+D+RL+ QY++E + KVA
Sbjct  270  GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLANKRKIFRVIDNRLQDQYSMEEACKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L CL+ + + RP M +VV  LE ++              S +  R         +++
Sbjct  330  TLSLRCLTTEIKLRPNMREVVSHLEHIQ--------------SLNATRGGNMDRTERRVR  375

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
               D+ T        +   A+  +   AYPRPS SPLY
Sbjct  376  RRSDSITTKKPNAGFARQTAVG-STVVAYPRPSASPLY  412



>ref|NP_001051730.1| Os03g0821900 [Oryza sativa Japonica Group]
 gb|ABF99600.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13644.1| Os03g0821900 [Oryza sativa Japonica Group]
 dbj|BAG92171.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76429.1| hypothetical protein OsI_14109 [Oryza sativa Indica Group]
 gb|EEE60197.1| hypothetical protein OsJ_13155 [Oryza sativa Japonica Group]
Length=424

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM+SGRR ID NRP GEHNLVEWA+PYL +KRK+FRVLD+RLEGQY+   +Q VA
Sbjct  277  GVVLLEMMSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRVLDTRLEGQYSHVGAQTVA  336

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKES  490
             LAL CLS + + RP+M+ VV  LE+L+ES
Sbjct  337  TLALECLSYEAKMRPSMEAVVTILEELQES  366



>ref|XP_010501359.1| PREDICTED: protein kinase APK1A, chloroplastic-like, partial 
[Camelina sativa]
Length=305

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA
Sbjct  162  GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVA  221

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L CL+ + + RP M +VV  LE ++        +      R  RRSD    + A   
Sbjct  222  TLSLRCLTTEVKLRPNMSEVVSHLEHIQTLNAAIGGNMDRTERRMRRRSDSVASKKANAG  281

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             +  T                  +   AYPRPS SPLY
Sbjct  282  FARQTAV---------------GSTVVAYPRPSASPLY  304



>ref|XP_007009313.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY18123.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=347

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 96/162 (59%), Gaps = 29/162 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+G+R +D NRP  E NLV+WAKPYL +KRK+ +V+D+R+EGQYTL+V+ K A
Sbjct  208  GVVLLEMLTGKRAVDKNRPSREQNLVDWAKPYLTSKRKILQVMDARIEGQYTLDVALKAA  267

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM-----TTLSNKHDGSRHHRRSDGAVEE  415
             +AL CLS +P+ RP M+ VVK LEQL+++ D       ++ N H  SR+  +       
Sbjct  268  YVALQCLSIEPKLRPNMNAVVKVLEQLQDTGDKGGPRNASVQNSHQNSRNAAK-------  320

Query  414  LAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
              Q K + D                +      + P+PS SPL
Sbjct  321  -FQRKNAND----------------VCNGIDGSCPQPSASPL  345



>ref|XP_010111129.1| Protein kinase APK1A [Morus notabilis]
 gb|EXC30494.1| Protein kinase APK1A [Morus notabilis]
Length=527

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 87/125 (70%), Gaps = 11/125 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVV+LEMLSG+R +D NRP GEHNLVEWAKPYLA+KR+V ++ DSR+EGQY++  + +  
Sbjct  385  GVVMLEMLSGKRAVDKNRPSGEHNLVEWAKPYLASKRRVLQIFDSRIEGQYSVGGAIRAV  444

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM-TTLSNKH----------DGSRHHRRS  433
            N+A+ CL+ +P++RP+M +VVK LEQL+E   +    SN+H          +G +H R S
Sbjct  445  NIAIQCLATEPKYRPSMKEVVKALEQLQELDCVGAPASNQHHLQSLNGKSSNGHKHLRAS  504

Query  432  DGAVE  418
               V 
Sbjct  505  TNGVS  509



>ref|XP_008464126.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
melo]
 ref|XP_008464127.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
melo]
Length=402

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GV+LLEMLSGRR +D NRP  EHNL+EWA+P LANKRK  R++D+RLEGQY+L+ + K++
Sbjct  276  GVILLEMLSGRRAVDKNRPFREHNLIEWARPQLANKRKTARIIDNRLEGQYSLDAAYKLS  335

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRS  433
            +L L CLS +P+ RP+M++VV ELEQL++   +    N        RRS
Sbjct  336  SLTLQCLSIEPKSRPSMNEVVTELEQLQDPTSININRNSKQNRMARRRS  384



>ref|XP_009118427.1| PREDICTED: protein kinase APK1A, chloroplastic [Brassica rapa]
 emb|CDY06271.1| BnaA09g49320D [Brassica napus]
Length=406

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 92/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYLANKRK+FRV+D+RL+ QY++E + KVA
Sbjct  263  GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLANKRKIFRVIDTRLQDQYSMEEACKVA  322

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L CL+ + + RP M DVV  LE ++                  RR  G ++   +  
Sbjct  323  ILSLRCLTTETKLRPNMSDVVSHLEHIQSLNSA-------------RR--GIMDRTERRM  367

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
                 + +G +            +   AYPRPS SPLY
Sbjct  368  RRRSDSVVGKKPNAGFARQTAVGSTLVAYPRPSASPLY  405



>ref|NP_172237.1| protein kinase APK1A [Arabidopsis thaliana]
 ref|NP_973778.1| protein kinase APK1A [Arabidopsis thaliana]
 sp|Q06548.1|APK1A_ARATH RecName: Full=Protein kinase APK1A, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02092.1| tyrosine-serine-threonine kinase [Arabidopsis thaliana]
 gb|AAO42086.1| putative protein kinase APK1A [Arabidopsis thaliana]
 gb|AAO50645.1| putative protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28143.1| protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28144.1| protein kinase APK1A [Arabidopsis thaliana]
Length=410

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA
Sbjct  267  GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVA  326

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L CL+ + + RP M +VV  LE ++        +      R  RRSD  V +     
Sbjct  327  TLSLRCLTTEIKLRPNMSEVVSHLEHIQSLNAAIGGNMDKTDRRMRRRSDSVVSKKVNAG  386

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             +  T                  +   AYPRPS SPLY
Sbjct  387  FARQTAV---------------GSTVVAYPRPSASPLY  409



>ref|XP_010542646.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010542647.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=398

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP G+HNLVEWAKPY+ANKRK+FRV+D+RL+ QY++E + KVA
Sbjct  270  GVVLLEILSGRRAVDKNRPTGQHNLVEWAKPYMANKRKIFRVIDNRLQDQYSMEEAYKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             LAL CLS + + RP M +VV +LEQ++
Sbjct  330  ILALRCLSAEVKLRPNMKEVVSQLEQIQ  357



>ref|XP_010487664.1| PREDICTED: protein kinase APK1A, chloroplastic [Camelina sativa]
Length=413

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA
Sbjct  270  GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L CL+ + + RP M +VV  LE ++        +      R  RRSD    + A   
Sbjct  330  TLSLRCLTTEVKLRPNMSEVVSHLEHIQTLNAAIGGNMDRTERRMRRRSDSVASKKANAG  389

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             +  T                  +   AYPRPS SPLY
Sbjct  390  FARQTAV---------------GSTVVAYPRPSASPLY  412



>ref|XP_006307674.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 ref|XP_006307675.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 gb|EOA40572.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
 gb|EOA40573.1| hypothetical protein CARUB_v10009302mg [Capsella rubella]
Length=410

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA
Sbjct  267  GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVA  326

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L CL+ + + RP M +VV  LE ++        +      R  RRSD  V +     
Sbjct  327  TLSLRCLTTEVKLRPNMSEVVSHLEHIQSLNAAIGGNMDRTERRTRRRSDSVVSKKVNAG  386

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             +  T                  +   AYPRPS SPLY
Sbjct  387  FARQTAV---------------GSTVVAYPRPSASPLY  409



>ref|XP_007009312.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18122.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=410

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 96/162 (59%), Gaps = 29/162 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+G+R +D NRP  E NLV+WAKPYL +KRK+ +V+D+R+EGQYTL+V+ K A
Sbjct  271  GVVLLEMLTGKRAVDKNRPSREQNLVDWAKPYLTSKRKILQVMDARIEGQYTLDVALKAA  330

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM-----TTLSNKHDGSRHHRRSDGAVEE  415
             +AL CLS +P+ RP M+ VVK LEQL+++ D       ++ N H  SR+  +       
Sbjct  331  YVALQCLSIEPKLRPNMNAVVKVLEQLQDTGDKGGPRNASVQNSHQNSRNAAK-------  383

Query  414  LAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
              Q K + D                +      + P+PS SPL
Sbjct  384  -FQRKNAND----------------VCNGIDGSCPQPSASPL  408



>ref|XP_010543301.1| PREDICTED: probable serine/threonine-protein kinase NAK [Tarenaya 
hassleriana]
Length=387

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM+SGRR ID N+P G+HNLV+WAKPYL NKR+V RV+D RL+GQY+L  + KVA
Sbjct  267  GVVLLEMVSGRRAIDKNQPTGQHNLVDWAKPYLTNKRRVLRVMDPRLQGQYSLNRALKVA  326

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVE  418
             LA  CLS D + RP M+DVVK LE+L+  K         +G    R +   V+
Sbjct  327  MLAFDCLSVDAKLRPGMNDVVKALEELQSHKAAVHGEQNSNGGSDSRETSQTVD  380



>gb|ABK24429.1| unknown [Picea sitchensis]
Length=465

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 83/117 (71%), Gaps = 6/117 (5%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+L+GRR +D NRP GEHNLV WA+PYL +KRK++R++D RLE  Y+++ +Q+ A
Sbjct  317  GVVLLELLTGRRSMDKNRPSGEHNLVAWARPYLMDKRKLYRLVDPRLEFNYSVKGAQRAA  376

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDG------SRHHRRSDG  427
             +A HCLS+DP+ RP MDDVV+ L  L   KDM + S  H        SRH R ++G
Sbjct  377  QIAHHCLSRDPKARPLMDDVVEALTPLLNLKDMASSSLHHQAVQSMRLSRHQRMTNG  433



>ref|XP_008458866.1| PREDICTED: protein kinase APK1A, chloroplastic [Cucumis melo]
Length=401

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 95/157 (61%), Gaps = 28/157 (18%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID NRP GEHNLVEWAKPYL +KR+V ++LD+R+E QY+   + K A
Sbjct  271  GVVLLEILSGRRAIDKNRPSGEHNLVEWAKPYLTSKRRVLQMLDARIESQYSTGGALKAA  330

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LA+ C+S +P+ RP M+ VVK LEQL++S + +       GSR            A + 
Sbjct  331  KLAIQCISTEPKLRPNMNAVVKALEQLQDSSETS-------GSR------------ATIS  371

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPL  289
            E  +T++          G   + N   +YPRPS S L
Sbjct  372  EPLNTSS---------QGSGSTNNKPVSYPRPSASVL  399



>ref|XP_009140954.1| PREDICTED: protein kinase APK1B, chloroplastic [Brassica rapa]
Length=418

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 91/158 (58%), Gaps = 13/158 (8%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP GE  LV+WAKP LANKRK+FRV+D+RL+ QY++E + KVA
Sbjct  273  GVVLLEILSGRRVVDKNRPPGEQKLVDWAKPLLANKRKIFRVIDNRLQDQYSMEEACKVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CL+ + + RP M +VV  LE ++   +     N     R  RR            
Sbjct  333  TLALRCLTTEIKLRPNMTEVVAHLEHIQTLHETGGGRNIDKMERRTRRRS----------  382

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
               D+  +  +        +      AAYPRPS SPL+
Sbjct  383  ---DSVVVSQKPNAGFARQSAVGGIAAAYPRPSASPLF  417



>ref|NP_001184929.1| protein kinase APK1A [Arabidopsis thaliana]
 gb|AEE28145.1| protein kinase APK1A [Arabidopsis thaliana]
Length=424

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA
Sbjct  281  GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVA  340

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L CL+ + + RP M +VV  LE ++        +      R  RRSD  V +     
Sbjct  341  TLSLRCLTTEIKLRPNMSEVVSHLEHIQSLNAAIGGNMDKTDRRMRRRSDSVVSKKVNAG  400

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             +  T                  +   AYPRPS SPLY
Sbjct  401  FARQTAV---------------GSTVVAYPRPSASPLY  423



>ref|XP_004505862.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X3 
[Cicer arietinum]
 ref|XP_004505863.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X4 
[Cicer arietinum]
Length=418

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 84/122 (69%), Gaps = 5/122 (4%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRVID NRP  +HNLVEWA+PYL+NKRKV RVLD+RLEGQY L+ + KVA
Sbjct  292  GVVLLEILSGRRVIDKNRPHKQHNLVEWARPYLSNKRKVLRVLDNRLEGQYELDDAYKVA  351

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L++ C+S + + RP MD+VV  LEQL+         N  + +R  RRS G V  +    
Sbjct  352  TLSVRCISIEAKLRPNMDEVVTNLEQLQVPH-----VNGCNQNRSRRRSAGDVTSVGTAT  406

Query  399  ES  394
             S
Sbjct  407  TS  408



>ref|XP_004505860.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004505861.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=420

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 84/122 (69%), Gaps = 5/122 (4%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRVID NRP  +HNLVEWA+PYL+NKRKV RVLD+RLEGQY L+ + KVA
Sbjct  294  GVVLLEILSGRRVIDKNRPHKQHNLVEWARPYLSNKRKVLRVLDNRLEGQYELDDAYKVA  353

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L++ C+S + + RP MD+VV  LEQL+         N  + +R  RRS G V  +    
Sbjct  354  TLSVRCISIEAKLRPNMDEVVTNLEQLQVPH-----VNGCNQNRSRRRSAGDVTSVGTAT  408

Query  399  ES  394
             S
Sbjct  409  TS  410



>ref|XP_010937617.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X2 
[Elaeis guineensis]
Length=415

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 99/166 (60%), Gaps = 33/166 (20%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL+NK+K+FR+LD+RL GQY+L  +QK A
Sbjct  276  GVVLLEMLSGRRAVDKNRPAGEHNLVEWARPYLSNKKKIFRILDTRLGGQYSLGGAQKAA  335

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMT-------TLSNKHDGSRHHRRSDGAV  421
             LAL CLS D ++R  MD+VV  LEQL+++KD           S+++ GS  HR    ++
Sbjct  336  ALALQCLSIDSKYRLNMDEVVSALEQLQDAKDTGRNPHTERKGSSQNVGSNLHRYRRRSL  395

Query  420  EELAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            EE    K                           A+ R S SPLYA
Sbjct  396  EEAGSRK--------------------------GAHARSSASPLYA  415



>emb|CDX77220.1| BnaC04g40150D [Brassica napus]
Length=418

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 91/158 (58%), Gaps = 13/158 (8%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP GE  LV+WAKP LANKRK+FRV+D+RL+ QY++E + KVA
Sbjct  273  GVVLLEILSGRRVVDKNRPPGEQKLVDWAKPLLANKRKIFRVIDNRLQDQYSMEEACKVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CL+ + + RP M +VV  LE ++   +     N     R  RR            
Sbjct  333  TLALRCLTTEIKLRPNMTEVVAHLEHIQTLHETGGGRNIDKMERRTRRRS----------  382

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
               D+  +  +        +      AAYPRPS SPL+
Sbjct  383  ---DSVVVSQKPNAGFARQSAVGGIAAAYPRPSASPLF  417



>gb|EPS63220.1| protein kinase 1b, partial [Genlisea aurea]
Length=346

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSG+R +D NRP  E  LVEWAKPYL +KRKV RV+DSRLEGQYT+E   KVA
Sbjct  253  GVVLLEMLSGKRAVDKNRPAPEEKLVEWAKPYLRDKRKVVRVVDSRLEGQYTIEAVMKVA  312

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
            +++L C+S DPR RP M +VV+E+EQL+
Sbjct  313  DISLRCVSSDPRLRPRMIEVVREVEQLQ  340



>ref|XP_010475518.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
 ref|XP_010475519.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 90/158 (57%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYL NKRKVFRV+D+RL+ QY++E + KVA
Sbjct  270  GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKVFRVIDNRLQDQYSMEEACKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L L CL+ + + RP M +VV  LE ++        +      R  RRSD    + A   
Sbjct  330  TLCLRCLTTETKLRPNMTEVVSCLEHIQSVNAAIGGNMDRTERRMRRRSDSVASKKANAG  389

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             +  T                  +   AYPRPS SPLY
Sbjct  390  FARQTAV---------------GSTVVAYPRPSASPLY  412



>gb|EPS59398.1| hypothetical protein M569_15409, partial [Genlisea aurea]
Length=375

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVL+E+L+G++ ID NRP GEHNLVEWAKPYL NKR+V  V+D RLEGQY++    K  
Sbjct  274  GVVLVEILTGKKAIDKNRPPGEHNLVEWAKPYLGNKRRVLSVVDGRLEGQYSVATVAKTG  333

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKES  490
            +LAL CLS DPR RP M+++V  LEQL++S
Sbjct  334  SLALQCLSTDPRTRPNMEEIVNALEQLQDS  363



>ref|XP_001758139.1| predicted protein [Physcomitrella patens]
 gb|EDQ76961.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 83/124 (67%), Gaps = 13/124 (10%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRR +D NRP GE NLVEWA+PYL +KRK +R++D RL+GQY+++ +QK A
Sbjct  307  GVVLLEMLTGRRSVDKNRPSGEQNLVEWARPYLNDKRKFYRLIDPRLDGQYSVKGAQKAA  366

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM-------------TTLSNKHDGSRHHR  439
             L+ HCLS+DP+ RP M DVV  L+ L++ +DM             +T  N H G R + 
Sbjct  367  ILSHHCLSRDPKSRPLMGDVVDTLKPLQDMRDMFSSSSNQASTNYRSTGMNGHGGGRPYH  426

Query  438  RSDG  427
               G
Sbjct  427  NGHG  430



>ref|XP_010937616.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform X1 
[Elaeis guineensis]
Length=423

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 99/166 (60%), Gaps = 33/166 (20%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRR +D NRP GEHNLVEWA+PYL+NK+K+FR+LD+RL GQY+L  +QK A
Sbjct  284  GVVLLEMLSGRRAVDKNRPAGEHNLVEWARPYLSNKKKIFRILDTRLGGQYSLGGAQKAA  343

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMT-------TLSNKHDGSRHHRRSDGAV  421
             LAL CLS D ++R  MD+VV  LEQL+++KD           S+++ GS  HR    ++
Sbjct  344  ALALQCLSIDSKYRLNMDEVVSALEQLQDAKDTGRNPHTERKGSSQNVGSNLHRYRRRSL  403

Query  420  EELAQLKESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLYA  283
            EE    K                           A+ R S SPLYA
Sbjct  404  EEAGSRK--------------------------GAHARSSASPLYA  423



>ref|XP_010030960.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW50195.1| hypothetical protein EUGRSUZ_J00006 [Eucalyptus grandis]
Length=409

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 82/116 (71%), Gaps = 7/116 (6%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEMLSGRRV+D NRP GE NL+EWAKPYL++KRK+F V+D+R+ GQY+L  + K A
Sbjct  272  GVVLLEMLSGRRVVDKNRPSGEQNLIEWAKPYLSSKRKIFHVMDARIRGQYSLSGALKAA  331

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS-------NKHDGSRHHRRS  433
             +A+ CLS + + RP M +VV+ LEQL++S+             N H G ++ RRS
Sbjct  332  TIAVKCLSLEAKSRPNMKEVVRALEQLQDSEARAITEAQQNANRNTHAGPKYRRRS  387



>ref|XP_006649840.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Oryza brachyantha]
Length=374

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R +D NRP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QK+A
Sbjct  280  GVVLLELLSGQRALDKNRPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKIA  339

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESK  487
             LA+ CLS D R RP MD VV  LEQL+  K
Sbjct  340  GLAMQCLSMDARCRPGMDQVVTALEQLQNGK  370



>ref|XP_010457947.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Camelina 
sativa]
Length=413

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR +D NRP GE NLVEWAKPYL NKRK+FRV+D+RL+ QY++E + KVA
Sbjct  270  GVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             L+L CL+ + + RP M +VV  LE ++        +      R  RRSD    + A   
Sbjct  330  TLSLRCLTTEVKLRPNMREVVSHLEHIQTLNAAIGGNMDRTERRMRRRSDSVASKKANAG  389

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
             +  T                  +   AYPRPS SPLY
Sbjct  390  FARQTAV---------------GSTVVAYPRPSASPLY  412



>emb|CDY31741.1| BnaA04g16770D [Brassica napus]
Length=418

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 91/158 (58%), Gaps = 13/158 (8%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP GE  LV+WAKP LANKRK+FRV+D+RL+ QY++E + KVA
Sbjct  273  GVVLLEILSGRRVVDKNRPPGEQKLVDWAKPLLANKRKIFRVIDNRLQDQYSMEEACKVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CL+ + + RP M +VV  LE ++   +     N     R  RR            
Sbjct  333  TLALRCLTTEIKLRPNMTEVVAHLEHIQTLHETGGGRNIDKLERRTRRRS----------  382

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
               D+  +  +        +      AAYPRPS SPL+
Sbjct  383  ---DSVVVSQKPNAGFARQSAVGGIAAAYPRPSASPLF  417



>gb|AGP76187.1| MLPK [Brassica rapa subsp. chinensis]
Length=418

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 91/158 (58%), Gaps = 13/158 (8%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP GE  LV+WAKP LANKRK+FRV+D+RL+ QY++E + KVA
Sbjct  273  GVVLLEILSGRRVVDKNRPPGEQKLVDWAKPLLANKRKIFRVIDNRLQDQYSMEEACKVA  332

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAVEELAQLK  400
             LAL CL+ + + RP M +VV  LE ++   +     N     R  RR            
Sbjct  333  TLALRCLTTEIKLRPNMTEVVAHLEHIQTLHETGGGRNIDKLERRTRRRS----------  382

Query  399  ESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
               D+  +  +        +      AAYPRPS SPL+
Sbjct  383  ---DSVVVSQKPNAGFARQSAVGGIAAAYPRPSASPLF  417



>ref|NP_001049704.1| Os03g0274800 [Oryza sativa Japonica Group]
 gb|ABF95245.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11618.1| Os03g0274800 [Oryza sativa Japonica Group]
 gb|EAY89440.1| hypothetical protein OsI_10947 [Oryza sativa Indica Group]
 gb|EAZ26435.1| hypothetical protein OsJ_10320 [Oryza sativa Japonica Group]
 dbj|BAG95774.1| unnamed protein product [Oryza sativa Japonica Group]
Length=374

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R +D NRP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QK+A
Sbjct  280  GVVLLELLSGQRALDKNRPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKIA  339

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESK  487
             LA+ CLS D R RP MD VV  LEQL+ +K
Sbjct  340  GLAVQCLSMDARCRPGMDQVVTALEQLQGAK  370



>ref|XP_006398693.1| hypothetical protein EUTSA_v10013737mg [Eutrema salsugineum]
 gb|ESQ40146.1| hypothetical protein EUTSA_v10013737mg [Eutrema salsugineum]
Length=396

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID N+P GEHNLV+WAKPYL NKR++ RV+D RL+GQY+L  + K+A
Sbjct  267  GVVLLELLSGRRAIDKNQPVGEHNLVDWAKPYLTNKRRLLRVMDPRLQGQYSLTRALKIA  326

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL C+S D + RPTM+D+VK LEQL   K+
Sbjct  327  ILALDCISIDAKSRPTMNDIVKTLEQLHVQKE  358



>gb|ACJ85391.1| unknown [Medicago truncatula]
Length=238

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP  +HNLVEWAKPYL+NK K+ RVLDSRLEGQY LE   KVA
Sbjct  112  GVVLLEILSGRRVVDKNRPTRQHNLVEWAKPYLSNKHKILRVLDSRLEGQYELEDVFKVA  171

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CLS + + RP +D+VV  LEQL+
Sbjct  172  ILSLRCLSVEAKLRPNVDEVVTNLEQLQ  199



>ref|XP_009357737.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
Length=402

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 83/125 (66%), Gaps = 12/125 (10%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVV+LE+LSGRR +D NRP GEHNLVEWAKPYLA+KRK  ++ D R+EGQY+++ + +  
Sbjct  260  GVVMLELLSGRRAVDKNRPTGEHNLVEWAKPYLASKRKFIQIFDLRIEGQYSMDEALRAV  319

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDM------------TTLSNKHDGSRHHRR  436
            +LA+ CL+ +P+ RP M+DVVK LEQL+E  D                +N +   RH RR
Sbjct  320  SLAIRCLAFEPKSRPNMNDVVKALEQLQEPIDSEGAGISPNQHRPNPHANSNHAPRHRRR  379

Query  435  SDGAV  421
            S   V
Sbjct  380  SINGV  384



>ref|NP_001149364.1| protein kinase APK1A [Zea mays]
 gb|ACG35162.1| protein kinase APK1A [Zea mays]
Length=374

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R +D NRP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QKVA
Sbjct  282  GVVLLELLSGQRALDKNRPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKVA  341

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESK  487
             LAL CLS D R RP MD VV  LEQL+  +
Sbjct  342  TLALQCLSMDARCRPAMDQVVTALEQLQRPR  372



>ref|XP_010067409.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
 gb|KCW65537.1| hypothetical protein EUGRSUZ_G02935 [Eucalyptus grandis]
Length=392

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 87/119 (73%), Gaps = 9/119 (8%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML GRR +D NRP  EHNLVEWAKP L +KRK+ +V+D R++GQY++  + K+A
Sbjct  265  GVVLLEMLCGRRAVDKNRPAREHNLVEWAKPCLTSKRKILQVMDPRIQGQYSVGGALKLA  324

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK---ESKDMTTL------SNKHDGSRHHRRSD  430
             LA+ CLS +P++RPTM++VV+ LEQL+   E+K   TL      S+  DGS+H R ++
Sbjct  325  KLAIGCLSTEPKYRPTMNEVVRALEQLQASEEAKANETLSEGQHPSSSSDGSKHPRSTN  383



>gb|ABF95246.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=372

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R +D NRP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QK+A
Sbjct  278  GVVLLELLSGQRALDKNRPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKIA  337

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESK  487
             LA+ CLS D R RP MD VV  LEQL+ +K
Sbjct  338  GLAVQCLSMDARCRPGMDQVVTALEQLQGAK  368



>gb|ACJ84948.1| unknown [Medicago truncatula]
 gb|AFK35293.1| unknown [Medicago truncatula]
Length=415

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP  +HNLVEWAKPYL+NK K+ RVLDSRLEGQY LE   KVA
Sbjct  289  GVVLLEILSGRRVVDKNRPTRQHNLVEWAKPYLSNKHKILRVLDSRLEGQYELEDVFKVA  348

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CLS + + RP MD+VV  LEQL+
Sbjct  349  ILSLRCLSVEAKLRPNMDEVVTNLEQLQ  376



>gb|ACF79269.1| unknown [Zea mays]
 gb|ACN26123.1| unknown [Zea mays]
 gb|ACR37930.1| unknown [Zea mays]
 tpg|DAA44647.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=374

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R +D NRP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QKVA
Sbjct  282  GVVLLELLSGQRALDKNRPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKVA  341

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESK  487
             LAL CLS D R RP MD VV  LEQL+  +
Sbjct  342  TLALQCLSMDARCRPGMDQVVTALEQLQRPR  372



>gb|KEH30165.1| kinase 1B [Medicago truncatula]
Length=415

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP  +HNLVEWAKPYL+NK K+ RVLDSRLEGQY LE   KVA
Sbjct  289  GVVLLEILSGRRVVDKNRPTRQHNLVEWAKPYLSNKHKILRVLDSRLEGQYELEDVFKVA  348

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CLS + + RP MD+VV  LEQL+
Sbjct  349  ILSLRCLSVEAKLRPNMDEVVTNLEQLQ  376



>gb|KEH30164.1| kinase 1B [Medicago truncatula]
Length=413

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP  +HNLVEWAKPYL+NK K+ RVLDSRLEGQY LE   KVA
Sbjct  287  GVVLLEILSGRRVVDKNRPTRQHNLVEWAKPYLSNKHKILRVLDSRLEGQYELEDVFKVA  346

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLK  496
             L+L CLS + + RP MD+VV  LEQL+
Sbjct  347  ILSLRCLSVEAKLRPNMDEVVTNLEQLQ  374



>gb|ACF82794.1| unknown [Zea mays]
 tpg|DAA44648.1| TPA: putative protein kinase superfamily protein [Zea mays]
 tpg|DAA44649.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=325

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R +D NRP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QKVA
Sbjct  233  GVVLLELLSGQRALDKNRPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKVA  292

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESK  487
             LAL CLS D R RP MD VV  LEQL+  +
Sbjct  293  TLALQCLSMDARCRPGMDQVVTALEQLQRPR  323



>ref|XP_006400026.1| hypothetical protein EUTSA_v10013316mg [Eutrema salsugineum]
 gb|ESQ41479.1| hypothetical protein EUTSA_v10013316mg [Eutrema salsugineum]
Length=503

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRR +D NRP GEHNLVEWA+P+L +KR+ +R+LD RLEG ++++ SQKV 
Sbjct  343  GVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGSQKVT  402

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS  469
             LA  CLS+DP+ RP M DVV+ L+ L   KDM + S
Sbjct  403  QLAAQCLSRDPKIRPKMSDVVEALKPLPHLKDMASSS  439



>ref|XP_008677038.1| PREDICTED: protein kinase APK1A isoform X1 [Zea mays]
 gb|ACR33989.1| unknown [Zea mays]
 tpg|DAA44646.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=405

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSG+R +D NRP G+HNLVEWA+PY+ NKR+V  VLDSRL  QY+L  +QKVA
Sbjct  313  GVVLLELLSGQRALDKNRPPGQHNLVEWARPYITNKRRVIHVLDSRLGSQYSLPAAQKVA  372

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESK  487
             LAL CLS D R RP MD VV  LEQL+  +
Sbjct  373  TLALQCLSMDARCRPGMDQVVTALEQLQRPR  403



>ref|XP_001776496.1| predicted protein [Physcomitrella patens]
 gb|EDQ58629.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 84/124 (68%), Gaps = 13/124 (10%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRR +D NRP GE NLVEWA+PYL +KRK+++++D RLEGQ++++ +QK A
Sbjct  281  GVVLLEMLTGRRSVDKNRPSGEQNLVEWARPYLNDKRKLYKLIDPRLEGQFSVKGAQKAA  340

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS-------------NKHDGSRHHR  439
             L+ HCLS++P+ RP M DVV  L+ L++ +DM + S             N H G R + 
Sbjct  341  ILSHHCLSREPKLRPLMGDVVDTLKPLQDMRDMASSSSVQISANYRSTGMNGHGGGRPYH  400

Query  438  RSDG  427
               G
Sbjct  401  NGHG  404



>ref|XP_006294292.1| hypothetical protein CARUB_v10023308mg [Capsella rubella]
 gb|EOA27190.1| hypothetical protein CARUB_v10023308mg [Capsella rubella]
Length=414

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 96/159 (60%), Gaps = 16/159 (10%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRRV+D NRP GE  LVEWAKP LANKRK+FRV+D+RL+ QY++E + KVA
Sbjct  270  GVVLLEVLSGRRVVDKNRPPGEQKLVEWAKPLLANKRKLFRVIDNRLQDQYSMEEACKVA  329

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDG-AVEELAQL  403
             L L CL+ + + RP M++VV  LE ++   +    +      R  RRSD  A+ +    
Sbjct  330  TLVLRCLTYEIKLRPNMNEVVAHLEHIQTLNEAGGRNVDKVERRMRRRSDSVAINQKPNA  389

Query  402  KESEDTTTLgsrrrrrsdgDAISRNATAAYPRPSTSPLY  286
              +  T              A+   AT AYPRPS SPL+
Sbjct  390  GFARQT--------------AVGVIAT-AYPRPSNSPLF  413



>ref|XP_008372383.1| PREDICTED: serine/threonine-protein kinase BIK1-like [Malus domestica]
Length=167

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 73/108 (68%), Gaps = 11/108 (10%)
 Frame = -1

Query  726  RVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVANLALHCLSKDP  547
            RV+D NRP GEHNLVEWAKPYLA+KRKV ++ D R+EGQY+L+ + +  NLA+ CL+ +P
Sbjct  36   RVVDKNRPSGEHNLVEWAKPYLASKRKVIQIFDGRIEGQYSLDEALRAVNLAIQCLAVEP  95

Query  546  RFRPTMDDVVKELEQLKESKDMTTLS--------NKHDGSRH---HRR  436
            + RPTMDDVVK LEQL+E  D             N H  S H   HRR
Sbjct  96   KSRPTMDDVVKALEQLQEPSDSEGSGIFQNEHRPNPHANSNHAPKHRR  143



>ref|XP_009122790.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=389

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID N+P GEHNLV+WA+PYL NKR++ RV+D RL+GQY+L  + K+A
Sbjct  268  GVVLLELLSGRRAIDKNQPVGEHNLVDWARPYLTNKRRLLRVMDPRLQGQYSLTRALKIA  327

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL C+S D + RPTM+DVVK LE+L   K+
Sbjct  328  LLALDCISLDSKVRPTMNDVVKTLEELHVQKE  359



>gb|KFK25744.1| hypothetical protein AALP_AA8G154000 [Arabis alpina]
Length=506

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRR +D NRP GEHNLVEWA+P+L +KR+ +R+LD RLEG ++++ +QKV 
Sbjct  346  GVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVT  405

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRSDGAV  421
             LA  CLS+DP+ RP M DVV+ L+ L   KDM + S      +  R  +G++
Sbjct  406  QLAAQCLSRDPKIRPKMSDVVEALKPLPHLKDMASSSYYFQTMQAERLKNGSM  458



>gb|KDO82763.1| hypothetical protein CISIN_1g010432mg [Citrus sinensis]
Length=304

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRR +D NRP GEHNLVEWA+P+L  +R+ +R++D RLEG ++++ +QK A
Sbjct  146  GVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAA  205

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS  469
             LA HCLS+DP+ RP M +VV+ L+ L   KDM + S
Sbjct  206  QLAAHCLSRDPKARPLMSEVVEALKPLPNLKDMASSS  242



>emb|CDY40347.1| BnaA10g27210D [Brassica napus]
Length=390

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLE+LSGRR ID N+P GEHNLV+WA+PYL NKR++ RV+D RL+GQY+L  + K+A
Sbjct  268  GVVLLELLSGRRAIDKNQPVGEHNLVDWARPYLTNKRRLLRVMDPRLQGQYSLTRALKIA  327

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKD  484
             LAL C+S D + RPTM+DVVK LE+L   K+
Sbjct  328  LLALDCISLDSKVRPTMNDVVKTLEELHVQKE  359



>ref|XP_004143117.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004165802.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Cucumis 
sativus]
 gb|KGN47148.1| hypothetical protein Csa_6G190390 [Cucumis sativus]
Length=401

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GV+LLE+LSGRR +D NRP  EHNL+EWA+P+LAN+RK  R++D+RLEGQY+L+ + K++
Sbjct  275  GVILLEILSGRRAVDKNRPFREHNLIEWARPHLANQRKTARIIDNRLEGQYSLDAAYKLS  334

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLSNKHDGSRHHRRS  433
            +L L CLS +P+ RP+M ++VKELEQL++   +    N        RRS
Sbjct  335  SLTLQCLSIEPKCRPSMHELVKELEQLQDPTSININRNSKQNRLARRRS  383



>gb|KDO82764.1| hypothetical protein CISIN_1g010432mg [Citrus sinensis]
Length=306

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRR +D NRP GEHNLVEWA+P+L  +R+ +R++D RLEG ++++ +QK A
Sbjct  148  GVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAA  207

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS  469
             LA HCLS+DP+ RP M +VV+ L+ L   KDM + S
Sbjct  208  QLAAHCLSRDPKARPLMSEVVEALKPLPNLKDMASSS  244



>ref|XP_010066960.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X2 [Eucalyptus grandis]
Length=512

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRR +D NRP GEHNLVEWA+P+L  +R+ +R++D RLEG ++++ +QK A
Sbjct  356  GVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAA  415

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS  469
             LA HCLS+DP+ RP M DVV+ L+ L   KDM + S
Sbjct  416  QLAAHCLSRDPKARPLMSDVVEALKPLPNLKDMASSS  452



>ref|XP_010066959.1| PREDICTED: probable receptor-like protein kinase At5g15080 isoform 
X1 [Eucalyptus grandis]
 gb|KCW65013.1| hypothetical protein EUGRSUZ_G02551 [Eucalyptus grandis]
Length=513

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRR +D NRP GEHNLVEWA+P+L  +R+ +R++D RLEG ++++ +QK A
Sbjct  357  GVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLGERRRFYRLIDPRLEGHFSIKGAQKAA  416

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS  469
             LA HCLS+DP+ RP M DVV+ L+ L   KDM + S
Sbjct  417  QLAAHCLSRDPKARPLMSDVVEALKPLPNLKDMASSS  453



>ref|XP_010420160.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
Length=511

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRR +D NRP GEHNLVEWA+P+L +KR+ +R+LD RLEG ++++ +QKV 
Sbjct  351  GVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVT  410

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS  469
             LA  CLS+DP+ RP M DVV+ L+ L   KDM + S
Sbjct  411  QLAAQCLSRDPKIRPKMSDVVEALKPLPHLKDMASAS  447



>ref|XP_010492331.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Camelina 
sativa]
Length=509

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEML+GRR +D NRP GEHNLVEWA+P+L +KR+ +R+LD RLEG ++++ +QKV 
Sbjct  349  GVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVT  408

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKESKDMTTLS  469
             LA  CLS+DP+ RP M DVV+ L+ L   KDM + S
Sbjct  409  QLAAQCLSRDPKIRPKMSDVVEALKPLPHLKDMASAS  445



>gb|KDP35640.1| hypothetical protein JCGZ_09078 [Jatropha curcas]
Length=347

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -1

Query  759  GVVLLEMLSGRRVIDYNRPCGEHNLVEWAKPYLANKRKVFRVLDSRLEGQYTLEVSQKVA  580
            GVVLLEM+SGRR +D NRP G+ NLVEWAK YL NKR+    LD RL+GQ+ L  +QK+ 
Sbjct  257  GVVLLEMVSGRRAMDNNRPPGQENLVEWAKLYLTNKRRFLSFLDPRLDGQHFLRTAQKLV  316

Query  579  NLALHCLSKDPRFRPTMDDVVKELEQLKES  490
            NLALHCL+ +P+FRP MDDVV  LE+L+ES
Sbjct  317  NLALHCLNSEPKFRPDMDDVVMILERLQES  346



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470