BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021N10

Length=349
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588928.1|  PREDICTED: homeobox-leucine zipper protein A...  61.2    1e-08   Nicotiana tomentosiformis
ref|XP_009598097.1|  PREDICTED: homeobox-leucine zipper protein A...  61.2    1e-08   Nicotiana tomentosiformis
gb|AAM48290.1|  homeodomain protein Hfi22                             60.5    2e-08   Nicotiana tabacum [American tobacco]
ref|XP_009777009.1|  PREDICTED: homeobox-leucine zipper protein A...  60.5    2e-08   Nicotiana sylvestris
ref|XP_011097532.1|  PREDICTED: homeobox-leucine zipper protein A...  58.9    7e-08   Sesamum indicum [beniseed]
ref|XP_006366219.1|  PREDICTED: homeobox-leucine zipper protein A...  57.4    2e-07   Solanum tuberosum [potatoes]
ref|XP_004240025.1|  PREDICTED: homeobox-leucine zipper protein A...  57.0    3e-07   Solanum lycopersicum
ref|XP_006353200.1|  PREDICTED: homeobox-leucine zipper protein A...  56.6    6e-07   Solanum tuberosum [potatoes]
ref|XP_004250119.1|  PREDICTED: homeobox-leucine zipper protein A...  56.2    6e-07   Solanum lycopersicum
ref|XP_008235150.1|  PREDICTED: homeobox-leucine zipper protein A...  55.8    9e-07   Prunus mume [ume]
ref|XP_009768030.1|  PREDICTED: homeobox-leucine zipper protein A...  55.8    9e-07   Nicotiana sylvestris
ref|XP_007205506.1|  hypothetical protein PRUPE_ppa008318mg           55.8    1e-06   Prunus persica
ref|XP_007205507.1|  hypothetical protein PRUPE_ppa008318mg           55.8    1e-06   Prunus persica
ref|XP_004143453.1|  PREDICTED: homeobox-leucine zipper protein A...  52.8    1e-05   Cucumis sativus [cucumbers]
ref|XP_008440572.1|  PREDICTED: homeobox-leucine zipper protein A...  52.4    1e-05   Cucumis melo [Oriental melon]
ref|XP_002535237.1|  transcription factor, putative                   51.6    1e-05   
gb|EYU34578.1|  hypothetical protein MIMGU_mgv1a011234mg              51.2    2e-05   Erythranthe guttata [common monkey flower]
ref|XP_010681015.1|  PREDICTED: homeobox-leucine zipper protein A...  50.4    7e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010106292.1|  Homeobox-leucine zipper protein ATHB-16          49.7    1e-04   Morus notabilis
gb|AAL57494.1|AF443620_1  homeodomain leucine zipper protein CPHB-4   49.3    1e-04   Craterostigma plantagineum
ref|XP_011465283.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    2e-04   Fragaria vesca subsp. vesca
emb|CDP01514.1|  unnamed protein product                              49.3    2e-04   Coffea canephora [robusta coffee]
ref|XP_004288161.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    2e-04   Fragaria vesca subsp. vesca
gb|KDP29729.1|  hypothetical protein JCGZ_18664                       48.9    2e-04   Jatropha curcas
dbj|BAB18164.1|  homeobox-leucine zipper protein                      47.0    3e-04   Zinnia elegans [garden zinnia]
ref|XP_006380403.1|  hypothetical protein POPTR_0007s05010g           48.1    3e-04   Populus trichocarpa [western balsam poplar]
dbj|BAB18171.1|  homeobox-leucine zipper protein                      47.8    3e-04   Zinnia elegans [garden zinnia]
ref|XP_010272979.1|  PREDICTED: homeobox-leucine zipper protein A...  48.5    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_011022832.1|  PREDICTED: homeobox-leucine zipper protein A...  48.1    3e-04   Populus euphratica
gb|EYU30971.1|  hypothetical protein MIMGU_mgv1a011136mg              47.8    4e-04   Erythranthe guttata [common monkey flower]
ref|XP_010266919.1|  PREDICTED: homeobox-leucine zipper protein A...  47.8    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_007047858.1|  Alanine--glyoxylate aminotransferase 2 isofo...  47.0    8e-04   
ref|XP_003632476.1|  PREDICTED: homeobox-leucine zipper protein A...  47.0    8e-04   Vitis vinifera
ref|XP_007047860.1|  Alanine--glyoxylate aminotransferase 2 isofo...  47.0    0.001   



>ref|XP_009588928.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Nicotiana 
tomentosiformis]
Length=340

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 8/65 (12%)
 Frame = -3

Query  251  FSEIPKNILGDSYDDS------QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDW  90
            F   PK ILGD+ D        QFVK+EEHNFF++ EE C+   ++EQAPT  W  P+DW
Sbjct  276  FDSNPKAILGDAKDKVFCNNQPQFVKMEEHNFFSS-EESCSTLFADEQAPTLHWYCPEDW  334

Query  89   -NWED  78
             NW+D
Sbjct  335  NNWKD  339



>ref|XP_009598097.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Nicotiana 
tomentosiformis]
Length=342

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 8/66 (12%)
 Frame = -3

Query  254  QFSEIP-KNILGDS------YDDSQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPD  96
            QF+E   K+ LGD       Y   Q+VK+EEHNFF  GEE C+   ++EQAPT  W  P+
Sbjct  277  QFTESSSKSNLGDGQKGNNYYQPQQYVKMEEHNFFN-GEESCSTLFTDEQAPTLQWYCPE  335

Query  95   DWNWED  78
            DWNW++
Sbjct  336  DWNWKE  341



>gb|AAM48290.1| homeodomain protein Hfi22 [Nicotiana tabacum]
Length=308

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 9/67 (13%)
 Frame = -3

Query  254  QFSEIP-KNILGDS-------YDDSQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSP  99
            QF+E   K+ LGD        Y   Q+VK+EEHNFF  GEE C+   ++EQAPT  W  P
Sbjct  243  QFTESSSKSNLGDGQKGNNNYYQPQQYVKMEEHNFFN-GEESCSTLFTDEQAPTLQWYCP  301

Query  98   DDWNWED  78
            +DWNW++
Sbjct  302  EDWNWKE  308



>ref|XP_009777009.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Nicotiana 
sylvestris]
Length=342

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 9/67 (13%)
 Frame = -3

Query  254  QFSEIP-KNILGDS-------YDDSQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSP  99
            QF+E   K+ LGD        Y   Q+VK+EEHNFF  GEE C+   ++EQAPT  W  P
Sbjct  277  QFTESSSKSNLGDGQKGNNNYYQPQQYVKMEEHNFFN-GEESCSTLFTDEQAPTLQWYCP  335

Query  98   DDWNWED  78
            +DWNW++
Sbjct  336  EDWNWKE  342



>ref|XP_011097532.1| PREDICTED: homeobox-leucine zipper protein ATHB-6 [Sesamum indicum]
Length=305

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 4/49 (8%)
 Frame = -3

Query  227  LGDSYDD--SQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            LG+++ +  +QFVKIEEHNFF  GEE CT   +++QAPT PW   DDWN
Sbjct  259  LGEAHKNYHTQFVKIEEHNFF--GEESCTSFFTDDQAPTLPWYCSDDWN  305



>ref|XP_006366219.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Solanum 
tuberosum]
Length=325

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 4/54 (7%)
 Frame = -3

Query  239  PKNILGDSYD--DSQFVKIEEHNFFAAGEEPC-TIXLSEEQAPTFPWCSPDDWN  87
            PK+IL +  D   SQFVK+EEHNFF +GEE C T+  ++EQAPT  W   +DWN
Sbjct  273  PKSILTNEVDFSSSQFVKLEEHNFF-SGEESCSTLLFTDEQAPTLHWYCSEDWN  325



>ref|XP_004240025.1| PREDICTED: homeobox-leucine zipper protein ATHB-6 [Solanum lycopersicum]
Length=313

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = -3

Query  218  SYDDSQFVKIEEHNFFAAGEEPC-TIXLSEEQAPTFPWCSPDDWN  87
            ++  SQFVK+EEHNFF  GEE C T+  ++EQAPT  W  PDDWN
Sbjct  270  NFSSSQFVKLEEHNFF-NGEESCSTLLFTDEQAPTLHWYCPDDWN  313



>ref|XP_006353200.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Solanum 
tuberosum]
Length=348

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 14/67 (21%)
 Frame = -3

Query  239  PKNILGDSYDDSQF-------------VKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSP  99
            PK+ILGDS   + F             VK+EEHNFF  GEE C+   S+EQAPT  W   
Sbjct  277  PKSILGDSQKANCFTYQPSSTTTTTQYVKMEEHNFFN-GEESCSTLFSDEQAPTLQWYCS  335

Query  98   DDWNWED  78
            +DWN++D
Sbjct  336  EDWNFKD  342



>ref|XP_004250119.1| PREDICTED: homeobox-leucine zipper protein ATHB-6 [Solanum lycopersicum]
Length=350

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 14/67 (21%)
 Frame = -3

Query  239  PKNILGDSYDDSQF-------------VKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSP  99
            PK+ILGDS   + F             VK+EEHNFF  GEE C+   S+EQAPT  W   
Sbjct  276  PKSILGDSQKANCFTYQPPSTTTTTQYVKMEEHNFFN-GEESCSTLFSDEQAPTLQWYCS  334

Query  98   DDWNWED  78
            +DWN++D
Sbjct  335  EDWNFKD  341



>ref|XP_008235150.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Prunus 
mume]
Length=337

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            QFVKIEEHNFF++ EE C+   S+EQAPT  WC PD WN
Sbjct  301  QFVKIEEHNFFSS-EEACSF-FSDEQAPTLQWCCPDQWN  337



>ref|XP_009768030.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Nicotiana 
sylvestris]
Length=341

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 39/65 (60%), Gaps = 8/65 (12%)
 Frame = -3

Query  251  FSEIPKNILGDSYDDS------QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDW  90
            F   PK ILGD  D        QFVK+EEHNFF++ EE C+   ++EQ PT  W   +DW
Sbjct  277  FDSNPKAILGDGQDKVVYNNQPQFVKMEEHNFFSS-EESCSTLFADEQPPTLQWYCSEDW  335

Query  89   -NWED  78
             NW+D
Sbjct  336  NNWKD  340



>ref|XP_007205506.1| hypothetical protein PRUPE_ppa008318mg [Prunus persica]
 gb|EMJ06705.1| hypothetical protein PRUPE_ppa008318mg [Prunus persica]
Length=336

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            QFVKIEEHNFF++ EE C+   S+EQAPT  WC PD WN
Sbjct  300  QFVKIEEHNFFSS-EEACSF-FSDEQAPTLQWCCPDQWN  336



>ref|XP_007205507.1| hypothetical protein PRUPE_ppa008318mg [Prunus persica]
 gb|EMJ06706.1| hypothetical protein PRUPE_ppa008318mg [Prunus persica]
Length=337

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            QFVKIEEHNFF++ EE C+   S+EQAPT  WC PD WN
Sbjct  301  QFVKIEEHNFFSS-EEACSF-FSDEQAPTLQWCCPDQWN  337



>ref|XP_004143453.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Cucumis 
sativus]
 ref|XP_004173863.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Cucumis 
sativus]
 gb|KGN48728.1| hypothetical protein Csa_6G499720 [Cucumis sativus]
Length=324

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            QFVKIEEHNFF +GEE C +  S+EQAP+  W  PD WN
Sbjct  288  QFVKIEEHNFF-SGEETCNL-FSDEQAPSMHWYCPDQWN  324



>ref|XP_008440572.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Cucumis 
melo]
Length=324

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            QFVKIEEHNFF +GEE C +  S+EQAP+  W  PD WN
Sbjct  288  QFVKIEEHNFF-SGEETCNL-FSDEQAPSMHWYCPDQWN  324



>ref|XP_002535237.1| transcription factor, putative [Ricinus communis]
 gb|EEF27146.1| transcription factor, putative, partial [Ricinus communis]
Length=249

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = -3

Query  218  SYDDSQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            +Y+ +QFVK+EEHNFF++ EE C    S++QAPT  W  PD WN
Sbjct  208  AYNQTQFVKMEEHNFFSS-EEACNF-FSDDQAPTLQWYCPDQWN  249



>gb|EYU34578.1| hypothetical protein MIMGU_mgv1a011234mg [Erythranthe guttata]
Length=288

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            QFVKIEEHNFF  GEE C+   S++QAPT  W   D WN
Sbjct  252  QFVKIEEHNFF--GEESCSTFFSDDQAPTLHWYCSDQWN  288



>ref|XP_010681015.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Beta 
vulgaris subsp. vulgaris]
Length=332

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 2/38 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDW  90
            QFVKIEEHNFF +GEE C    SEEQAP+  W  PD W
Sbjct  296  QFVKIEEHNFF-SGEEACNF-FSEEQAPSLHWYCPDQW  331



>ref|XP_010106292.1| Homeobox-leucine zipper protein ATHB-16 [Morus notabilis]
 gb|EXC09709.1| Homeobox-leucine zipper protein ATHB-16 [Morus notabilis]
Length=342

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 36/56 (64%), Gaps = 9/56 (16%)
 Frame = -3

Query  233  NILGDSYDDS-----QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPW-CSPDD-WN  87
            N LG S+  +     QFVKIEEHNFF +GEE C    S+EQAPT  W CS +D WN
Sbjct  289  NCLGSSFQKTTTYQPQFVKIEEHNFF-SGEEACNF-FSDEQAPTLHWYCSGEDQWN  342



>gb|AAL57494.1|AF443620_1 homeodomain leucine zipper protein CPHB-4 [Craterostigma plantagineum]
Length=282

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -3

Query  203  QFVKIEE-HNFFAAGEEPCTIXL-SEEQAPTFPWCSPDDWN  87
            QFVKIEE HN F   +E CT    S+EQAPT  W +PD+WN
Sbjct  242  QFVKIEEQHNLFREEDESCTTTFFSDEQAPTLNWYTPDEWN  282



>ref|XP_011465283.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=329

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            QFVKIEEHNFF++ EE C    S+EQAP+  W  PD WN
Sbjct  293  QFVKIEEHNFFSS-EEACNF-FSDEQAPSLQWYCPDQWN  329



>emb|CDP01514.1| unnamed protein product [Coffea canephora]
Length=360

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            QFVKIEEHNFF+ G++ C+   S++Q PT  W  P++WN
Sbjct  323  QFVKIEEHNFFS-GDDSCSTFFSDDQPPTLHWYCPEEWN  360



>ref|XP_004288161.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=328

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            QFVKIEEHNFF++ EE C    S+EQAP+  W  PD WN
Sbjct  292  QFVKIEEHNFFSS-EEACNF-FSDEQAPSLQWYCPDQWN  328



>gb|KDP29729.1| hypothetical protein JCGZ_18664 [Jatropha curcas]
Length=322

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = -3

Query  206  SQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            +QFVK+EEHNFF++ EE C    S+EQAP+  W  PD WN
Sbjct  285  TQFVKMEEHNFFSS-EEACNF-FSDEQAPSLQWYCPDQWN  322



>dbj|BAB18164.1| homeobox-leucine zipper protein [Zinnia elegans]
Length=151

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 4/55 (7%)
 Frame = -3

Query  230  ILGDSYD--DSQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWNWEDES  72
            I+GD+      QFVK+EEHNFF  G+E C    S++QAPT  W   D WN  +E+
Sbjct  99   IMGDAQKAYQPQFVKLEEHNFFG-GDESCNF-FSDDQAPTLQWYCQDQWNLSEEN  151



>ref|XP_006380403.1| hypothetical protein POPTR_0007s05010g [Populus trichocarpa]
 gb|ABK95942.1| unknown [Populus trichocarpa]
 gb|ERP58200.1| hypothetical protein POPTR_0007s05010g [Populus trichocarpa]
Length=328

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = -3

Query  206  SQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            +QFVK+EEHNFF++ EE C    S+EQ P+ PW S D WN
Sbjct  291  TQFVKLEEHNFFSS-EEACNF-FSDEQPPSLPWYSSDQWN  328



>dbj|BAB18171.1| homeobox-leucine zipper protein [Zinnia elegans]
Length=247

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 4/55 (7%)
 Frame = -3

Query  230  ILGDSYD--DSQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWNWEDES  72
            I+GD+      QFVK+EEHNFF  G+E C    S++QAPT  W   D WN  +E+
Sbjct  195  IMGDAQKAYQPQFVKLEEHNFFG-GDESCNF-FSDDQAPTLQWYCQDQWNLSEEN  247



>ref|XP_010272979.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Nelumbo 
nucifera]
Length=337

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 2/38 (5%)
 Frame = -3

Query  200  FVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
             +K+EEHNFF A EEPC    SE+QAPT  W  PD WN
Sbjct  302  LMKMEEHNFFGA-EEPCNF-FSEDQAPTLQWYCPDQWN  337



>ref|XP_011022832.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Populus 
euphratica]
Length=328

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = -3

Query  206  SQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            +QFVK+EEHNFF++ EE C    S+EQ P+ PW S D WN
Sbjct  291  TQFVKLEEHNFFSS-EEACNF-FSDEQPPSLPWYSSDQWN  328



>gb|EYU30971.1| hypothetical protein MIMGU_mgv1a011136mg [Erythranthe guttata]
Length=291

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 6/60 (10%)
 Frame = -3

Query  248  SEIPKNILGDSYD-----DSQFVKIEEHNFFAAGE-EPCTIXLSEEQAPTFPWCSPDDWN  87
             EI  +ILGD          QFVKIEEH+FF   E + C+    ++QAPT  W S  DWN
Sbjct  232  KEISASILGDGQKMCQLAQMQFVKIEEHDFFGDEESDNCSNLFCDDQAPTLHWYSSHDWN  291



>ref|XP_010266919.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Nelumbo 
nucifera]
Length=334

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            Q +++EEHNFF A EEPC    SE+QAP+  W  PD WN
Sbjct  298  QLMRMEEHNFFNA-EEPCNF-FSEDQAPSLQWYYPDQWN  334



>ref|XP_007047858.1| Alanine--glyoxylate aminotransferase 2 isoform 1 [Theobroma cacao]
 ref|XP_007047859.1| Pyrimidine 4 isoform 1 [Theobroma cacao]
 gb|EOX92015.1| Alanine--glyoxylate aminotransferase 2 isoform 1 [Theobroma cacao]
 gb|EOX92016.1| Pyrimidine 4 isoform 1 [Theobroma cacao]
Length=330

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            Q+VK+EEHNFF+A +E C    S+EQAP+  W SP+ WN
Sbjct  294  QYVKMEEHNFFSA-DEACNF-FSDEQAPSLHWYSPEQWN  330



>ref|XP_003632476.1| PREDICTED: homeobox-leucine zipper protein ATHB-6 [Vitis vinifera]
Length=335

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 4/57 (7%)
 Frame = -3

Query  254  QFSEIPKNILGDSYD--DSQFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDW  90
             FS+  +  LG++      QFVK+EEHNFF A +E C    S++Q PT PW  PD W
Sbjct  280  HFSDSSRPTLGNTQKAYQPQFVKMEEHNFFGA-DESCNF-FSDDQPPTLPWYCPDQW  334



>ref|XP_007047860.1| Alanine--glyoxylate aminotransferase 2 isoform 3 [Theobroma cacao]
 gb|EOX92017.1| Alanine--glyoxylate aminotransferase 2 isoform 3 [Theobroma cacao]
Length=317

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = -3

Query  203  QFVKIEEHNFFAAGEEPCTIXLSEEQAPTFPWCSPDDWN  87
            Q+VK+EEHNFF+A +E C    S+EQAP+  W SP+ WN
Sbjct  281  QYVKMEEHNFFSA-DEACNF-FSDEQAPSLHWYSPEQWN  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552569507840