BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021M03

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008467047.1|  PREDICTED: glutamate--glyoxylate aminotransf...    266   2e-86   Cucumis melo [Oriental melon]
ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    271   3e-85   Nicotiana tomentosiformis
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    270   4e-85   Solanum lycopersicum
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    270   9e-85   Nicotiana sylvestris
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    268   2e-84   Malus domestica [apple tree]
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    268   2e-84   Solanum tuberosum [potatoes]
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    268   3e-84   Prunus mume [ume]
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    268   5e-84   
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    267   8e-84   Pyrus x bretschneideri [bai li]
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    266   9e-84   
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   266   1e-83   Citrus sinensis [apfelsine]
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             267   1e-83   Citrus clementina [clementine]
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           266   1e-83   Morus notabilis
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         266   1e-83   Jatropha curcas
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             266   1e-83   Prunus persica
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       266   2e-83   
ref|XP_003613139.1|  Alanine aminotransferase                           264   1e-82   Medicago truncatula
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                263   2e-82   Erythranthe guttata [common monkey flower]
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    263   2e-82   Eucalyptus grandis [rose gum]
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    263   3e-82   Glycine max [soybeans]
emb|CBI23368.3|  unnamed protein product                                263   4e-82   Vitis vinifera
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    262   5e-82   
ref|NP_001268094.1|  uncharacterized protein LOC100261274               262   6e-82   Vitis vinifera
emb|CDP13207.1|  unnamed protein product                                262   6e-82   Coffea canephora [robusta coffee]
ref|NP_001237567.1|  alanine aminotransferase 2                         262   7e-82   
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    261   2e-81   Fragaria vesca subsp. vesca
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    261   2e-81   Nelumbo nucifera [Indian lotus]
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    261   2e-81   Cicer arietinum [garbanzo]
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                260   4e-81   Glycine soja [wild soybean]
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             260   4e-81   Phaseolus vulgaris [French bean]
emb|CAN62302.1|  hypothetical protein VITISV_023686                     260   4e-81   Vitis vinifera
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    259   6e-81   
ref|NP_001237581.1|  alanine aminotransferase 3                         258   2e-80   Glycine max [soybeans]
gb|AET06145.1|  PLP-dependent aminotransferase                          258   3e-80   Papaver somniferum
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    258   3e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    257   6e-80   Populus trichocarpa [western balsam poplar]
emb|CDY61225.1|  BnaC06g43710D                                          257   7e-80   Brassica napus [oilseed rape]
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    257   7e-80   Brassica rapa
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    257   1e-79   Brassica rapa
gb|AAZ43368.1|  AlaT1                                                   255   2e-79   Vitis labrusca [Concord grape]
gb|KJB31170.1|  hypothetical protein B456_005G179600                    255   4e-79   Gossypium raimondii
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    254   5e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    254   5e-79   Tarenaya hassleriana [spider flower]
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    254   8e-79   Gossypium arboreum [tree cotton]
gb|KJB31175.1|  hypothetical protein B456_005G179600                    254   8e-79   Gossypium raimondii
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          253   2e-78   
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             253   2e-78   
emb|CDY66294.1|  BnaAnng22050D                                          253   3e-78   Brassica napus [oilseed rape]
emb|CDX91708.1|  BnaC08g06270D                                          250   3e-78   
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    252   5e-78   Brassica rapa
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          252   5e-78   Amborella trichopoda
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    252   5e-78   
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    252   6e-78   
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    252   7e-78   Populus euphratica
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              251   8e-78   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20108.1|  AT1G70580                                              251   8e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61453.1|  putative alanine aminotransferase                       251   9e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    251   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    251   2e-77   Elaeis guineensis
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             251   2e-77   Capsella rubella
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             251   2e-77   
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             250   2e-77   Populus trichocarpa [western balsam poplar]
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    250   2e-77   Elaeis guineensis
emb|CDY25780.1|  BnaA07g10020D                                          248   3e-77   Brassica napus [oilseed rape]
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    250   3e-77   Brassica rapa
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             249   4e-77   
emb|CDY41452.1|  BnaA08g20540D                                          249   6e-77   Brassica napus [oilseed rape]
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    249   7e-77   
gb|EPS68501.1|  hypothetical protein M569_06265                         249   8e-77   Genlisea aurea
gb|AAM22749.1|  alanine aminotransferase                                237   3e-76   Deschampsia antarctica
gb|AAK68842.1|  alanine aminotransferase-like protein                   244   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    247   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    247   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    247   6e-76   Camelina sativa [gold-of-pleasure]
emb|CDY12474.1|  BnaC07g13140D                                          248   6e-76   Brassica napus [oilseed rape]
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    246   9e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    246   1e-75   Camelina sativa [gold-of-pleasure]
dbj|BAJ90574.1|  predicted protein                                      240   2e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    241   2e-75   
gb|AAL24255.1|  At1g23310/F26F24_4                                      245   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 245   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151206.1|  PREDICTED: glutamate--glyoxylate aminotransf...    233   7e-75   
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    244   8e-75   Brassica rapa
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    243   2e-74   Camelina sativa [gold-of-pleasure]
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       241   1e-73   
gb|EMS58349.1|  Alanine aminotransferase 2                              241   1e-73   Triticum urartu
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          240   2e-73   Arabidopsis lyrata subsp. lyrata
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             240   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    239   3e-73   Setaria italica
gb|AAO84040.1|  alanine aminotransferase                                239   3e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    239   3e-73   Solanum lycopersicum
ref|NP_001058716.1|  Os07g0108300                                       239   3e-73   
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    239   5e-73   Nicotiana sylvestris
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    238   1e-72   Nicotiana tomentosiformis
tpg|DAA59363.1|  TPA: putative MATE efflux family protein isoform 1     235   2e-72   
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    236   4e-72   Brachypodium distachyon [annual false brome]
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    236   5e-72   
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    236   1e-71   
ref|NP_001151209.1|  alanine aminotransferase 2                         235   1e-71   
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    235   2e-71   Cucumis sativus [cucumbers]
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    235   2e-71   
ref|NP_001183048.1|  uncharacterized protein LOC100501386               234   2e-71   Zea mays [maize]
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    233   7e-71   Cucumis melo [Oriental melon]
ref|XP_010248614.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    228   1e-70   
gb|AFK42206.1|  unknown                                                 219   4e-67   Lotus japonicus
gb|ABK25444.1|  unknown                                                 223   1e-66   Picea sitchensis
ref|XP_011034252.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    219   1e-66   Populus euphratica
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              220   1e-65   
ref|XP_010230121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    208   9e-65   
ref|XP_001763950.1|  predicted protein                                  205   6e-60   
ref|XP_001782822.1|  predicted protein                                  201   2e-58   
ref|XP_001777071.1|  predicted protein                                  194   1e-55   
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             186   7e-53   Selaginella moellendorffii
ref|XP_003613140.1|  Alanine aminotransferase                           186   9e-53   
ref|XP_005651940.1|  alanine aminotransferase                           183   3e-51   Coccomyxa subellipsoidea C-169
emb|CDX91589.1|  BnaC02g15710D                                          172   5e-51   
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    178   9e-50   
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              175   9e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002947519.1|  alanine aminotransferase                           174   7e-48   Volvox carteri f. nagariensis
gb|EMT29455.1|  Alanine aminotransferase 2                              169   3e-46   
ref|XP_001698518.1|  alanine aminotransferase                           166   3e-45   Chlamydomonas reinhardtii
gb|AFK38994.1|  unknown                                                 156   5e-45   Lotus japonicus
gb|AFK36743.1|  unknown                                                 157   8e-45   Lotus japonicus
gb|AAB01685.1|  alanine aminotransferase                                164   2e-44   Chlamydomonas reinhardtii
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               165   3e-44   Nannochloropsis gaditana
gb|KIZ07569.1|  alanine transaminase                                    165   3e-44   Monoraphidium neglectum
ref|XP_003291733.1|  alanine transaminase                               162   1e-43   Dictyostelium purpureum
gb|EEE58449.1|  hypothetical protein OsJ_09677                          155   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060284.1|  Os07g0617800                                       154   5e-42   
ref|XP_006649511.1|  PREDICTED: alanine aminotransferase 2-like         156   1e-41   
ref|XP_006657961.1|  PREDICTED: alanine aminotransferase 2-like i...    155   2e-41   Oryza brachyantha
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...    155   3e-41   Oryza brachyantha
gb|ETK83815.1|  hypothetical protein L915_11053                         149   3e-41   Phytophthora parasitica
ref|XP_006661735.1|  PREDICTED: alanine aminotransferase 2-like         155   5e-41   Oryza brachyantha
ref|NP_001064504.1|  Os10g0390500                                       155   5e-41   
gb|EEC74641.1|  hypothetical protein OsI_10280                          155   5e-41   Oryza sativa Indica Group [Indian rice]
gb|AAK52114.1|AC079936_10  Putative alanine aminotransferase            154   5e-41   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC79866.1|  putative alanine aminotransferase                      154   7e-41   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA63613.1|  TPA: hypothetical protein ZEAMMB73_743428              151   7e-41   
gb|ETL90369.1|  hypothetical protein L917_10859                         147   7e-41   Phytophthora parasitica
gb|EEE67593.1|  hypothetical protein OsJ_25140                          154   1e-40   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                          154   1e-40   Oryza sativa Indica Group [Indian rice]
tpg|DAA41461.1|  TPA: hypothetical protein ZEAMMB73_764403              150   1e-40   
gb|ETL37230.1|  hypothetical protein L916_10951                         147   2e-40   Phytophthora parasitica
gb|AAV64199.1|  putative alanine aminotransferase                       152   6e-40   Zea mays [maize]
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340          152   6e-40   Sorghum bicolor [broomcorn]
emb|CDJ93113.1|  Aminotransferase domain containing protein             152   7e-40   Haemonchus contortus [red stomach worm]
gb|EFA80185.1|  alanine transaminase                                    152   7e-40   Heterostelium album PN500
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2              152   8e-40   Zea mays [maize]
gb|AAV64237.1|  putative alanine aminotransferase                       152   8e-40   Zea mays [maize]
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...    150   2e-39   Auxenochlorella protothecoides
ref|XP_002887430.1|  ALAAT2                                             150   2e-39   
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2              150   2e-39   Phoenix dactylifera
gb|KIY92376.1|  hypothetical protein MNEG_15586                         142   4e-39   Monoraphidium neglectum
gb|ETP13560.1|  hypothetical protein F441_11279                         149   4e-39   Phytophthora parasitica CJ01A1
gb|ETP41623.1|  hypothetical protein F442_11247                         149   4e-39   Phytophthora parasitica P10297
ref|XP_008907369.1|  hypothetical protein PPTG_13440                    149   4e-39   Phytophthora parasitica INRA-310
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2              149   5e-39   Elaeis guineensis
ref|XP_010939850.1|  PREDICTED: alanine aminotransferase 2 isofor...    146   8e-39   
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like         148   2e-38   Phoenix dactylifera
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like         147   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDJ93112.1|  Aminotransferase domain containing protein             147   2e-38   Haemonchus contortus [red stomach worm]
gb|ETI43749.1|  hypothetical protein F443_11362                         147   3e-38   Phytophthora parasitica P1569
ref|XP_002906656.1|  alanine aminotransferase 2                         147   3e-38   Phytophthora infestans T30-4
dbj|GAM23260.1|  hypothetical protein SAMD00019534_064350               147   3e-38   Acytostelium subglobosum LB1
ref|XP_004992298.1|  alanine aminotransferase                           147   4e-38   Salpingoeca rosetta
gb|KJB68683.1|  hypothetical protein B456_011G0552001                   144   4e-38   Gossypium raimondii
ref|XP_008560719.1|  PREDICTED: alanine aminotransferase 1              147   4e-38   Microplitis demolitor
gb|KJB68682.1|  hypothetical protein B456_011G0552001                   144   4e-38   Gossypium raimondii
gb|ADB91976.1|  alanine aminotransferase                                147   4e-38   Branchiostoma belcheri
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2              147   5e-38   Fragaria vesca subsp. vesca
emb|CEF68484.1|  Alanine aminotransferase 1                             146   5e-38   Strongyloides ratti
ref|XP_004342401.1|  alanine aminotransferase, mitochondrial, put...    146   6e-38   Acanthamoeba castellanii str. Neff
dbj|BAN21041.1|  alanine aminotransferase                               146   7e-38   Riptortus pedestris
ref|NP_001185380.1|  alanine aminotransferase 2                         146   7e-38   Arabidopsis thaliana [mouse-ear cress]
gb|ENN78579.1|  hypothetical protein YQE_04947                          146   7e-38   Dendroctonus ponderosae
ref|NP_565040.2|  alanine aminotransferase 2                            146   7e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59591.2|  putative alanine aminotransferase                       146   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939849.1|  PREDICTED: alanine aminotransferase 2 isofor...    146   8e-38   Elaeis guineensis
ref|XP_010428116.1|  PREDICTED: alanine aminotransferase 2, mitoc...    146   9e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...    145   1e-37   Elaeis guineensis
gb|ETN63742.1|  alanine aminotransferase                                145   1e-37   Anopheles darlingi [American malaria mosquito]
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like         145   1e-37   
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial               145   1e-37   Glycine soja [wild soybean]
ref|XP_005775483.1|  alanine aminotransferase                           145   2e-37   Emiliania huxleyi CCMP1516
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like         145   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN77825.1|  Alanine aminotransferase 1                              145   2e-37   Toxocara canis
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...    145   2e-37   Cicer arietinum [garbanzo]
ref|XP_007441690.1|  PREDICTED: alanine aminotransferase 2-like i...    145   2e-37   
ref|XP_005443445.1|  PREDICTED: alanine aminotransferase 2-like         144   2e-37   Falco cherrug
ref|XP_007024768.1|  Alanine aminotransferase 2                         145   2e-37   
ref|XP_007441689.1|  PREDICTED: alanine aminotransferase 2-like i...    145   2e-37   
ref|XP_007441688.1|  PREDICTED: alanine aminotransferase 2-like i...    145   2e-37   
ref|XP_005230442.1|  PREDICTED: alanine aminotransferase 2-like         144   3e-37   
ref|XP_005833147.1|  hypothetical protein GUITHDRAFT_157749             144   3e-37   Guillardia theta CCMP2712
ref|XP_637993.1|  alanine transaminase                                  145   3e-37   Dictyostelium discoideum AX4
ref|XP_008120969.1|  PREDICTED: alanine aminotransferase 1-like         144   3e-37   Anolis carolinensis [Carolina anole]
gb|KHG30536.1|  Alanine aminotransferase 2, mitochondrial -like p...    144   3e-37   Gossypium arboreum [tree cotton]
ref|XP_003573850.1|  PREDICTED: alanine aminotransferase 2              144   3e-37   Brachypodium distachyon [annual false brome]
ref|XP_010235387.1|  PREDICTED: alanine aminotransferase 2-like i...    144   4e-37   Brachypodium distachyon [annual false brome]
ref|XP_009059448.1|  hypothetical protein LOTGIDRAFT_192553             144   4e-37   Lottia gigantea
ref|XP_010415979.1|  PREDICTED: alanine aminotransferase 2, mitoc...    144   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002166762.2|  PREDICTED: alanine aminotransferase 2-like         143   4e-37   
ref|XP_003055208.1|  predicted protein                                  144   4e-37   Micromonas pusilla CCMP1545
ref|XP_002499950.1|  alanine aminotransferase                           143   5e-37   Micromonas commoda
ref|XP_010096539.1|  Alanine aminotransferase 2                         144   6e-37   Morus notabilis
ref|XP_005880402.1|  PREDICTED: alanine aminotransferase 2              144   6e-37   
ref|XP_001660470.1|  AAEL009872-PA                                      144   6e-37   
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...    143   7e-37   Hordeum vulgare [barley]
ref|XP_010235383.1|  PREDICTED: alanine aminotransferase 2-like i...    144   7e-37   Brachypodium distachyon [annual false brome]
ref|XP_002826439.1|  PREDICTED: alanine aminotransferase 2              137   8e-37   
ref|XP_002681562.1|  alanine aminotransferase                           143   8e-37   Naegleria gruberi strain NEG-M
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like         143   8e-37   
gb|KDR12685.1|  Alanine aminotransferase 2                              143   9e-37   Zootermopsis nevadensis
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...    143   9e-37   Hordeum vulgare [barley]
ref|XP_002969652.1|  hypothetical protein SELMODRAFT_91640              143   1e-36   
ref|XP_002970914.1|  hypothetical protein SELMODRAFT_94316              143   1e-36   
ref|XP_007135364.1|  hypothetical protein PHAVU_010G123200g             143   1e-36   Phaseolus vulgaris [French bean]
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...    142   1e-36   Cucumis melo [Oriental melon]
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...    142   1e-36   
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...    142   1e-36   Solanum lycopersicum
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...    143   1e-36   Prunus mume [ume]
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg             143   1e-36   Prunus persica
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...    143   1e-36   Solanum tuberosum [potatoes]
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...    142   1e-36   Solanum tuberosum [potatoes]
ref|XP_010471259.1|  PREDICTED: alanine aminotransferase 2, mitoc...    142   1e-36   Camelina sativa [gold-of-pleasure]
gb|ADE77246.1|  unknown                                                 140   2e-36   Picea sitchensis
gb|KGB32667.1|  Alanine aminotransferase 2                              142   2e-36   Schistosoma haematobium
ref|XP_008150574.1|  PREDICTED: alanine aminotransferase 2 isofor...    142   2e-36   
ref|XP_002430266.1|  Alanine aminotransferase, putative                 142   2e-36   Pediculus humanus corporis [human body lice]
gb|ETL95505.1|  hypothetical protein L917_06707                         135   2e-36   Phytophthora parasitica
gb|ELK29365.1|  Alanine aminotransferase 2                              141   2e-36   Myotis davidii
ref|XP_011036545.1|  PREDICTED: alanine aminotransferase 2-like         142   2e-36   Populus euphratica
gb|EYC32542.1|  hypothetical protein Y032_0003g1641                     142   3e-36   Ancylostoma ceylanicum
ref|XP_008150573.1|  PREDICTED: alanine aminotransferase 2 isofor...    142   3e-36   Eptesicus fuscus
ref|NP_001086104.1|  alanine aminotransferase 2                         142   3e-36   Xenopus laevis [clawed frog]
gb|KDD76740.1|  aminotransferase                                        141   3e-36   Helicosporidium sp. ATCC 50920
gb|KFB49063.1|  AGAP000901-PA-like protein                              141   4e-36   Anopheles sinensis
emb|CCD81366.1|  putative alanine aminotransferase                      141   4e-36   Schistosoma mansoni
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                   141   4e-36   Citrus sinensis [apfelsine]
gb|EYC32543.1|  hypothetical protein Y032_0003g1641                     141   4e-36   Ancylostoma ceylanicum
gb|EMT23015.1|  Alanine aminotransferase 2                              141   4e-36   
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg             141   4e-36   
ref|XP_008620886.1|  alanine transaminase                               141   4e-36   Saprolegnia diclina VS20
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...    141   4e-36   Citrus sinensis [apfelsine]
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg             141   4e-36   Citrus clementina [clementine]
gb|ACJ85860.1|  unknown                                                 141   5e-36   Medicago truncatula
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...    141   5e-36   Cucumis sativus [cucumbers]
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...    141   5e-36   
gb|EMS46317.1|  Alanine aminotransferase 2                              141   5e-36   Triticum urartu
gb|AHW58022.1|  alanine aminotransferase 1                              141   5e-36   Sogatella furcifera
gb|KGN58474.1|  hypothetical protein Csa_3G646610                       141   5e-36   Cucumis sativus [cucumbers]
gb|AIT69935.1|  alanine transaminase                                    141   5e-36   Dumontia simplex
ref|XP_003627448.1|  Alanine aminotransferase                           141   5e-36   Medicago truncatula
ref|XP_004166923.1|  PREDICTED: alanine aminotransferase 2, mitoc...    141   5e-36   
emb|CDQ55985.1|  unnamed protein product                                134   5e-36   Oncorhynchus mykiss
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...    141   5e-36   
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...    141   5e-36   Cucumis melo [Oriental melon]
ref|XP_006105500.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    141   5e-36   
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...    141   5e-36   Cucumis melo [Oriental melon]
ref|XP_003228933.1|  PREDICTED: alanine aminotransferase 1-like         141   5e-36   Anolis carolinensis [Carolina anole]
gb|KFM79416.1|  Alanine aminotransferase 2                              137   8e-36   Stegodyphus mimosarum
ref|XP_009939421.1|  PREDICTED: alanine aminotransferase 2              139   9e-36   Opisthocomus hoazin [hoatzin]
ref|XP_010015482.1|  PREDICTED: alanine aminotransferase 2              139   1e-35   Nestor notabilis
gb|EHJ76295.1|  putative alanine aminotransferase                       140   1e-35   
ref|XP_001660471.1|  AAEL009875-PA                                      139   1e-35   
gb|KFR15864.1|  Alanine aminotransferase 2                              139   1e-35   Opisthocomus hoazin [hoatzin]
ref|XP_005608301.1|  PREDICTED: alanine aminotransferase 2 isofor...    139   1e-35   Equus caballus [domestic horse]
gb|KFQ52041.1|  Alanine aminotransferase 2                              139   1e-35   Nestor notabilis
ref|XP_006300438.1|  hypothetical protein CARUB_v10020102mg             140   1e-35   Capsella rubella
gb|ESA18192.1|  hypothetical protein GLOINDRAFT_334935                  140   1e-35   
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like         140   1e-35   Sesamum indicum [beniseed]
ref|XP_005608300.1|  PREDICTED: alanine aminotransferase 2 isofor...    139   1e-35   
ref|XP_010113991.1|  PREDICTED: alanine aminotransferase 2              139   1e-35   Chlamydotis macqueenii
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2              140   1e-35   Sorex araneus [Eurasian shrew]
ref|XP_006764960.1|  PREDICTED: alanine aminotransferase 2              141   1e-35   
gb|KDO24164.1|  hypothetical protein SPRG_10592                         139   1e-35   Saprolegnia parasitica CBS 223.65
ref|XP_011372050.1|  PREDICTED: alanine aminotransferase 2              138   1e-35   
ref|XP_008507870.1|  PREDICTED: alanine aminotransferase 2 isofor...    139   1e-35   Equus przewalskii [Przewalski horse]
ref|XP_003757274.1|  PREDICTED: alanine aminotransferase 2              139   1e-35   
gb|KFP35282.1|  Alanine aminotransferase 2                              139   2e-35   
ref|XP_002158641.1|  PREDICTED: alanine aminotransferase 2-like         139   2e-35   
gb|EXX69945.1|  alanine transaminase ALT1                               140   2e-35   
ref|XP_316880.5|  AGAP000901-PA                                         140   2e-35   
ref|XP_006530622.1|  PREDICTED: alanine aminotransferase 2 isofor...    136   2e-35   
ref|XP_001660472.1|  AAEL009875-PB                                      139   2e-35   
ref|XP_009079156.1|  PREDICTED: alanine aminotransferase 2              137   2e-35   
gb|ETK88933.1|  hypothetical protein L915_06890                         135   2e-35   
gb|AHJ25706.1|  GPT2                                                    134   2e-35   
gb|KFV00293.1|  Alanine aminotransferase 2                              137   2e-35   
ref|XP_010078751.1|  PREDICTED: alanine aminotransferase 2              137   2e-35   
ref|XP_005608298.1|  PREDICTED: alanine aminotransferase 2 isofor...    139   2e-35   
ref|XP_006034404.1|  PREDICTED: alanine aminotransferase 2              139   2e-35   
ref|XP_010394851.1|  PREDICTED: alanine aminotransferase 2              139   2e-35   
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2              139   2e-35   
ref|XP_005490144.1|  PREDICTED: alanine aminotransferase 2              139   2e-35   
ref|XP_005426315.1|  PREDICTED: alanine aminotransferase 2              139   2e-35   
ref|XP_009976045.1|  PREDICTED: alanine aminotransferase 2              138   2e-35   
ref|XP_001490415.3|  PREDICTED: alanine aminotransferase 2 isofor...    139   2e-35   
ref|XP_010193171.1|  PREDICTED: alanine aminotransferase 2              138   2e-35   
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like         139   2e-35   
gb|KFU99477.1|  Alanine aminotransferase 2                              139   2e-35   
ref|XP_009274977.1|  PREDICTED: alanine aminotransferase 2              138   2e-35   
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    139   2e-35   
gb|KFQ20610.1|  Alanine aminotransferase 2                              138   3e-35   
ref|XP_009515714.1|  hypothetical protein PHYSODRAFT_476244             139   3e-35   
ref|XP_005526440.1|  PREDICTED: alanine aminotransferase 2 isofor...    139   3e-35   
ref|XP_003978704.1|  PREDICTED: alanine aminotransferase 2-like         139   3e-35   
emb|CCI42079.1|  unnamed protein product                                139   3e-35   
ref|XP_006641441.1|  PREDICTED: alanine aminotransferase 2-like         139   3e-35   
gb|KFZ65228.1|  Alanine aminotransferase 2                              138   3e-35   
ref|XP_008869166.1|  hypothetical protein H310_06043                    139   3e-35   
ref|XP_005052721.1|  PREDICTED: alanine aminotransferase 2 isofor...    139   3e-35   
ref|XP_009487594.1|  PREDICTED: alanine aminotransferase 2              138   3e-35   
ref|XP_009571057.1|  PREDICTED: alanine aminotransferase 2              138   3e-35   
gb|EPS60556.1|  hypothetical protein M569_14246                         139   3e-35   
ref|XP_010151513.1|  PREDICTED: alanine aminotransferase 2              138   3e-35   
ref|XP_010285870.1|  PREDICTED: alanine aminotransferase 2              138   3e-35   
ref|XP_009700544.1|  PREDICTED: alanine aminotransferase 2              138   3e-35   
ref|XP_008246599.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    139   3e-35   
ref|XP_009265680.1|  hypothetical protein J056_000007                   139   3e-35   
ref|XP_010166043.1|  PREDICTED: alanine aminotransferase 2              138   3e-35   
ref|XP_002194653.1|  PREDICTED: alanine aminotransferase 2              139   4e-35   
ref|XP_005526439.1|  PREDICTED: alanine aminotransferase 2 isofor...    139   4e-35   
ref|XP_004664888.1|  PREDICTED: alanine aminotransferase 2              139   4e-35   
ref|XP_009816631.1|  PREDICTED: alanine aminotransferase 2              138   4e-35   
gb|ETL42327.1|  hypothetical protein L916_06840                         133   4e-35   
gb|KFZ58051.1|  Alanine aminotransferase 2                              138   4e-35   
gb|KFP59082.1|  Alanine aminotransferase 2                              138   4e-35   
gb|KFQ69505.1|  Alanine aminotransferase 2                              138   4e-35   
gb|KFQ05762.1|  Alanine aminotransferase 2                              138   4e-35   
ref|XP_008637027.1|  PREDICTED: alanine aminotransferase 2              139   4e-35   
ref|XP_009920931.1|  PREDICTED: alanine aminotransferase 2              138   4e-35   
ref|XP_011499275.1|  PREDICTED: alanine aminotransferase 2              139   4e-35   
gb|KFQ54613.1|  Alanine aminotransferase 2                              138   4e-35   
ref|XP_002739142.1|  PREDICTED: alanine aminotransferase 2-like         139   4e-35   
gb|KFV58998.1|  Alanine aminotransferase 2                              138   4e-35   
ref|XP_008053205.1|  PREDICTED: alanine aminotransferase 2              138   4e-35   
ref|XP_005233896.1|  PREDICTED: alanine aminotransferase 2              137   4e-35   
gb|KFP49490.1|  Alanine aminotransferase 2                              137   4e-35   
ref|XP_001622550.1|  hypothetical protein NEMVEDRAFT_v1g236165          138   4e-35   
gb|KFP94695.1|  Alanine aminotransferase 2                              138   4e-35   
gb|KFO63157.1|  Alanine aminotransferase 2                              139   4e-35   
gb|KFM05788.1|  Alanine aminotransferase 2                              139   4e-35   
ref|XP_009461778.1|  PREDICTED: alanine aminotransferase 2 isofor...    138   4e-35   
gb|KFW64540.1|  Alanine aminotransferase 2                              139   4e-35   
ref|XP_010140032.1|  PREDICTED: alanine aminotransferase 2              137   4e-35   
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2              139   5e-35   
gb|AFK39904.1|  unknown                                                 138   5e-35   
ref|XP_006908800.1|  PREDICTED: alanine aminotransferase 2              137   5e-35   
gb|KFO93213.1|  Alanine aminotransferase 2                              138   5e-35   
ref|XP_006261713.1|  PREDICTED: alanine aminotransferase 2              137   5e-35   
ref|XP_010309159.1|  PREDICTED: alanine aminotransferase 2              137   5e-35   
ref|XP_008584771.1|  PREDICTED: alanine aminotransferase 2              138   5e-35   
ref|XP_011260421.1|  PREDICTED: alanine aminotransferase 1              138   6e-35   
ref|XP_004944250.1|  PREDICTED: alanine aminotransferase 2 isofor...    138   6e-35   
ref|XP_006729760.1|  PREDICTED: alanine aminotransferase 2 isofor...    138   6e-35   
gb|EFN75006.1|  Alanine aminotransferase 2                              138   6e-35   
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2              138   6e-35   
ref|XP_005141728.1|  PREDICTED: alanine aminotransferase 2              138   6e-35   
ref|XP_010716082.1|  PREDICTED: alanine aminotransferase 2              137   6e-35   
ref|XP_002042929.1|  GM11628                                            138   6e-35   
ref|XP_006828623.1|  hypothetical protein AMTR_s00129p00080070          137   6e-35   
gb|AAL39959.1|  SD05601p                                                138   6e-35   
ref|XP_009676627.1|  PREDICTED: alanine aminotransferase 2              137   7e-35   
gb|KHJ47772.1|  aminotransferase, class I/II                            138   7e-35   
ref|XP_008936281.1|  PREDICTED: alanine aminotransferase 2              137   7e-35   
ref|XP_005024206.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    137   7e-35   
gb|KFO06425.1|  Alanine aminotransferase 2                              137   7e-35   
ref|XP_001363190.1|  PREDICTED: alanine aminotransferase 2 isofor...    138   7e-35   
gb|KIY93453.1|  alanine transaminase                                    129   7e-35   
gb|ELK15350.1|  Alanine aminotransferase 2                              138   7e-35   
ref|XP_005664519.1|  PREDICTED: alanine aminotransferase 2 isofor...    138   7e-35   
gb|KFQ95766.1|  Alanine aminotransferase 2                              138   7e-35   
ref|XP_002106853.1|  GD17120                                            138   7e-35   
ref|NP_572879.2|  CG1640, isoform A                                     138   7e-35   
ref|NP_727696.2|  CG1640, isoform B                                     138   7e-35   
gb|KFQ82063.1|  Alanine aminotransferase 2                              137   7e-35   
ref|XP_009826737.1|  hypothetical protein H257_04062                    137   7e-35   
gb|KFV83100.1|  Alanine aminotransferase 2                              137   7e-35   
ref|XP_003802370.1|  PREDICTED: alanine aminotransferase 1              137   7e-35   
ref|XP_004697404.1|  PREDICTED: alanine aminotransferase 1              137   8e-35   
ref|XP_414111.3|  PREDICTED: alanine aminotransferase 2 isoform X2      138   8e-35   
ref|XP_005318527.1|  PREDICTED: alanine aminotransferase 2              137   8e-35   
ref|XP_010199869.1|  PREDICTED: alanine aminotransferase 2              137   8e-35   
gb|KHN72520.1|  Alanine aminotransferase 2                              137   8e-35   
gb|KFQ16813.1|  Alanine aminotransferase 2                              137   8e-35   
gb|KFP31561.1|  Alanine aminotransferase 2                              137   8e-35   
gb|EYU45916.1|  hypothetical protein MIMGU_mgv1a005454mg                137   8e-35   
ref|XP_007537772.1|  PREDICTED: alanine aminotransferase 2 isofor...    137   8e-35   
ref|NP_001012057.1|  alanine aminotransferase 2                         137   8e-35   
ref|XP_002760962.1|  PREDICTED: alanine aminotransferase 2              137   9e-35   
ref|NP_001135938.1|  alanine aminotransferase 2 isoform 2               137   9e-35   
dbj|BAC04465.1|  unnamed protein product                                137   9e-35   
gb|AET06148.1|  PLP-dependent aminotransferase                          137   9e-35   
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1              137   9e-35   
ref|XP_010776891.1|  PREDICTED: alanine aminotransferase 2-like         136   1e-34   
ref|XP_009636322.1|  PREDICTED: alanine aminotransferase 2              137   1e-34   
ref|XP_007474882.1|  PREDICTED: alanine aminotransferase 2 isofor...    137   1e-34   
gb|EHJ74142.1|  putative alanine aminotransferase                       137   1e-34   
gb|KFP15258.1|  Alanine aminotransferase 2                              137   1e-34   
gb|EMP35918.1|  Alanine aminotransferase 2                              137   1e-34   
ref|XP_006530621.1|  PREDICTED: alanine aminotransferase 2 isofor...    136   1e-34   
ref|XP_004690373.1|  PREDICTED: alanine aminotransferase 2              137   1e-34   
ref|XP_006191406.1|  PREDICTED: alanine aminotransferase 2              137   1e-34   
ref|XP_003724792.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    137   1e-34   
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...    137   1e-34   
ref|XP_008931733.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    136   1e-34   
ref|XP_008700888.1|  PREDICTED: alanine aminotransferase 2              137   1e-34   
gb|KDE04574.1|  hypothetical protein MVLG_05042                         137   1e-34   
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929              137   1e-34   
ref|XP_011235435.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    137   1e-34   
ref|XP_009051124.1|  hypothetical protein LOTGIDRAFT_114341             137   1e-34   
pdb|3IHJ|A  Chain A, Human Alanine Aminotransferase 2 In Complex ...    137   1e-34   
ref|XP_004265286.1|  PREDICTED: alanine aminotransferase 1              137   1e-34   
ref|XP_009555221.1|  PREDICTED: alanine aminotransferase 2              137   1e-34   
gb|KFO69634.1|  Alanine aminotransferase 2                              137   1e-34   
ref|XP_007059708.1|  PREDICTED: alanine aminotransferase 2              137   1e-34   
ref|NP_001237553.1|  alanine aminotransferase 1                         137   1e-34   
emb|CDS30789.1|  gag pol polyprotein                                    137   1e-34   
ref|XP_010221695.1|  PREDICTED: alanine aminotransferase 2              136   1e-34   
ref|XP_004744170.1|  PREDICTED: alanine aminotransferase 2 isofor...    137   1e-34   
ref|XP_004403733.1|  PREDICTED: alanine aminotransferase 2              137   2e-34   
ref|XP_009088853.1|  PREDICTED: alanine aminotransferase 2              136   2e-34   
gb|EHH31638.1|  Alanine aminotransferase 2                              136   2e-34   
ref|XP_006887880.1|  PREDICTED: alanine aminotransferase 2              137   2e-34   
ref|XP_005591897.1|  PREDICTED: alanine aminotransferase 2 isofor...    136   2e-34   
ref|XP_004479736.1|  PREDICTED: alanine aminotransferase 2 isoform 2    137   2e-34   
gb|EHJ78976.1|  putative Alanine aminotransferase                       137   2e-34   
ref|NP_597700.1|  alanine aminotransferase 2 isoform 1                  137   2e-34   
ref|XP_004479735.1|  PREDICTED: alanine aminotransferase 2 isoform 1    137   2e-34   
ref|XP_008827853.1|  PREDICTED: alanine aminotransferase 2 isofor...    136   2e-34   
gb|KFD51767.1|  hypothetical protein M513_07294                         137   2e-34   
gb|KGL83280.1|  Alanine aminotransferase 2                              136   2e-34   
ref|XP_009175684.1|  hypothetical protein T265_10908                    136   2e-34   
ref|XP_002112002.1|  hypothetical protein TRIADDRAFT_50189              136   2e-34   
gb|EFX71233.1|  hypothetical protein DAPPUDRAFT_309150                  136   2e-34   
ref|XP_003528736.1|  PREDICTED: alanine aminotransferase 2, mitoc...    137   2e-34   
gb|ERG84738.1|  alanine aminotransferase 2-like protein                 137   2e-34   
gb|EHH60359.1|  Alanine aminotransferase 2                              136   2e-34   
ref|XP_007439806.1|  PREDICTED: alanine aminotransferase 2              136   2e-34   
ref|XP_004443056.1|  PREDICTED: alanine aminotransferase 1              136   2e-34   
ref|XP_003280453.1|  PREDICTED: alanine aminotransferase 2              136   2e-34   
ref|XP_003127043.1|  PREDICTED: alanine aminotransferase 2 isofor...    136   2e-34   
ref|XP_006207932.1|  PREDICTED: alanine aminotransferase 2              136   2e-34   
ref|XP_009606549.1|  PREDICTED: alanine aminotransferase 2              136   2e-34   
ref|XP_004629253.1|  PREDICTED: alanine aminotransferase 2              136   2e-34   
ref|XP_010346117.1|  PREDICTED: alanine aminotransferase 2              136   2e-34   
ref|XP_010884988.1|  PREDICTED: alanine aminotransferase 2-like i...    136   2e-34   
ref|XP_005289905.1|  PREDICTED: alanine aminotransferase 2              136   3e-34   
ref|XP_010842208.1|  PREDICTED: alanine aminotransferase 2              135   3e-34   
ref|XP_005591896.1|  PREDICTED: alanine aminotransferase 2 isofor...    136   3e-34   
ref|XP_006746371.1|  PREDICTED: alanine aminotransferase 1              133   3e-34   
ref|XP_004324928.1|  PREDICTED: alanine aminotransferase 2              135   3e-34   
ref|XP_008827852.1|  PREDICTED: alanine aminotransferase 2 isofor...    136   3e-34   
ref|XP_003792568.1|  PREDICTED: alanine aminotransferase 2              136   3e-34   
ref|XP_004580835.1|  PREDICTED: alanine aminotransferase 1              136   3e-34   
ref|XP_004583880.1|  PREDICTED: alanine aminotransferase 2 isofor...    136   3e-34   
ref|XP_001745052.1|  hypothetical protein                               136   3e-34   
ref|XP_005367071.1|  PREDICTED: alanine aminotransferase 2              136   3e-34   
ref|XP_005401471.1|  PREDICTED: alanine aminotransferase 2-like i...    135   3e-34   
ref|XP_003416391.1|  PREDICTED: alanine aminotransferase 2              136   3e-34   
ref|XP_010884980.1|  PREDICTED: alanine aminotransferase 2-like i...    136   3e-34   
ref|XP_010835881.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    135   3e-34   
gb|KFK41472.1|  hypothetical protein AALP_AA2G135300                    136   3e-34   
ref|XP_009904992.1|  PREDICTED: alanine aminotransferase 2              136   3e-34   
ref|XP_003952890.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    136   3e-34   
ref|XP_007464592.1|  PREDICTED: alanine aminotransferase 1              136   3e-34   
gb|AAH34219.1|  Glutamic pyruvate transaminase (alanine aminotran...    136   3e-34   
ref|XP_005401470.1|  PREDICTED: alanine aminotransferase 2-like i...    135   3e-34   
ref|XP_007990329.1|  PREDICTED: alanine aminotransferase 2 isofor...    136   3e-34   
ref|NP_776291.1|  alanine aminotransferase 2                            136   4e-34   
ref|XP_003222977.1|  PREDICTED: alanine aminotransferase 2              136   4e-34   
ref|XP_005591895.1|  PREDICTED: alanine aminotransferase 2 isofor...    136   4e-34   
ref|XP_004371688.1|  PREDICTED: alanine aminotransferase 2              136   4e-34   
ref|XP_011226825.1|  PREDICTED: alanine aminotransferase 1 isofor...    135   4e-34   
ref|XP_005709075.1|  alanine transaminase                               135   4e-34   
gb|KFV72169.1|  Alanine aminotransferase 2                              136   4e-34   
ref|XP_001113757.2|  PREDICTED: alanine aminotransferase 2-like i...    136   4e-34   
ref|XP_011373236.1|  PREDICTED: alanine aminotransferase 1              135   4e-34   
ref|XP_005401469.1|  PREDICTED: alanine aminotransferase 2-like i...    135   4e-34   
ref|XP_003819840.1|  PREDICTED: alanine aminotransferase 2              135   4e-34   
gb|ETI43741.1|  hypothetical protein F443_11357                         135   4e-34   
ref|XP_007548658.1|  PREDICTED: alanine aminotransferase 2-like i...    135   4e-34   
gb|EDL11016.1|  glutamic pyruvate transaminase (alanine aminotran...    135   4e-34   
ref|XP_010812871.1|  PREDICTED: alanine aminotransferase 2 isofor...    135   4e-34   
ref|XP_006971818.1|  PREDICTED: alanine aminotransferase 2 isofor...    135   4e-34   
ref|XP_007119541.1|  PREDICTED: alanine aminotransferase 2              135   4e-34   
ref|NP_001016805.1|  alanine aminotransferase 2                         135   4e-34   
ref|XP_006971817.1|  PREDICTED: alanine aminotransferase 2 isofor...    135   5e-34   
ref|XP_006062821.1|  PREDICTED: alanine aminotransferase 2              135   5e-34   
ref|XP_004264915.1|  PREDICTED: alanine aminotransferase 2              135   5e-34   
ref|XP_007548657.1|  PREDICTED: alanine aminotransferase 2-like i...    135   5e-34   
ref|XP_009557985.1|  PREDICTED: alanine aminotransferase 2-like         135   5e-34   
ref|XP_006064662.1|  PREDICTED: alanine aminotransferase 1 isofor...    135   5e-34   
gb|AIT69936.1|  alanine transaminase                                    135   5e-34   
ref|XP_008499534.1|  PREDICTED: alanine aminotransferase 2              135   5e-34   
ref|XP_004472119.1|  PREDICTED: alanine aminotransferase 1              135   6e-34   
gb|AIT69941.1|  alanine transaminase                                    135   6e-34   
ref|XP_005613478.1|  PREDICTED: alanine aminotransferase 1              134   6e-34   



>ref|XP_008467047.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Cucumis melo]
Length=238

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AIE 
Sbjct  102  GDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIEA  161

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  162  AKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKF  221

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM++YEDHRGYSRM
Sbjct  222  NDSFMEEYEDHRGYSRM  238



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKKLGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   270 bits (691),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIET
Sbjct  345  GDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIET  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A  LGKAPDV YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  ANKLGKAPDVLYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM++YEDH+GYSRM
Sbjct  465  NDEFMEKYEDHKGYSRM  481



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQ+VRESKGILESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYDQYVRESKGILESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKKLGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QF+RESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYEQFIRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AQRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFMDQYED RGYSRM
Sbjct  465  NDEFMDQYEDQRGYSRM  481



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQ+VRESKGILESLR+RA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET
Sbjct  345  GDISYDQYVRESKGILESLRRRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A  LGKA DV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  ANKLGKAADVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM++YEDH+GYSRM
Sbjct  465  NDEFMEKYEDHKGYSRM  481



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QFVRESKGILESLRKRARIMTDGFN+CRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYEQFVRESKGILESLRKRARIMTDGFNNCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QF+RESKGILESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYEQFIRESKGILESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFMDQYED RGYSRM
Sbjct  465  NDEFMDQYEDRRGYSRM  481



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QF+RESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYEQFIRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AQRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            N+EFMDQYED RGYSRM
Sbjct  465  NNEFMDQYEDQRGYSRM  481



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   266 bits (680),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  324  GDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDA  383

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  384  AKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKF  443

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM++YEDHRGYSRM
Sbjct  444  NDSFMEEYEDHRGYSRM  460



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QFVRESKGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  327  GDISYEQFVRESKGILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  386

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCL+LLEATGISTVPGSGFGQKEG+FHLRTTILPAEEDMPAIMESFKKF
Sbjct  387  AKRAGKVPDVFYCLRLLEATGISTVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKF  446

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED+RGYSRM
Sbjct  447  NDEFMEQYEDYRGYSRM  463



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QFVRESKGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYEQFVRESKGILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCL+LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  AKRAGKVPDVFYCLRLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED+RGYSRM
Sbjct  465  NDEFMEQYEDYRGYSRM  481



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+Q+VRESKGILESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYEQYVRESKGILESLRRRASIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEG+FHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  AKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGMFHLRTTILPAEEDMPAIMESFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRE KGILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYDQFVREGKGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM SFKKF
Sbjct  405  AKRLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMSSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDH GYSRM
Sbjct  465  NDEFMEQYEDHTGYSRM  481



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QFVRESKGILESLR+RARIMTDGFN+CRN+VCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYEQFVRESKGILESLRRRARIMTDGFNNCRNIVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  345  GDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM++YEDHRGYSRM
Sbjct  465  NDSFMEEYEDHRGYSRM  481



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYD+FVRESKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPP+A+ET
Sbjct  345  GDISYDRFVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPKALET  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKA DVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKF
Sbjct  405  AKQAGKAADVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            ND+FM+QY+DHRGYSR+
Sbjct  465  NDDFMEQYDDHRGYSRL  481



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY++F+RESKGILESLR+RA++MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  344  GDISYERFIRESKGILESLRRRAQLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  403

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  404  AQKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  463

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDH+GYSRM
Sbjct  464  NDEFMEQYEDHKGYSRM  480



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYD +VRESKGI+ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI+ 
Sbjct  345  GDISYDLYVRESKGIIESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYD+FVRES GILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E 
Sbjct  345  GDISYDKFVRESTGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKF
Sbjct  405  AKQAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPDIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED RGYSR+
Sbjct  465  NDEFMEQYEDDRGYSRL  481



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY QF+RESKGILESL++RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLQFMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  AKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+++VRESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  342  GDISYERYVRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  401

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  402  AKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKF  461

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  462  NDEFMEQYEDHRGYSRM  478



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   262 bits (670),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY QF+RESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLQFMRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIMESFKKF
Sbjct  405  AKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMESFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   262 bits (670),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+++VRESK +LESLRKRA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYERYVRESKAVLESLRKRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDH+GYSRM
Sbjct  465  NDEFMEQYEDHKGYSRM  481



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   262 bits (669),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E 
Sbjct  345  GDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKF
Sbjct  405  AKQAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPDIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED RGYSR+
Sbjct  465  NDEFMEQYEDDRGYSRL  481



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI+ 
Sbjct  345  GDISYDQFARESKEILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQK+GVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  405  AKSAGKVPDVFYCLKLLEATGISTVPGSGFGQKDGVFHLRTTILPAEEDMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            N+EFM+QYED RGYSRM
Sbjct  465  NNEFMEQYEDDRGYSRM  481



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +FV ESK IL+SLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYLKFVTESKAILDSLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKNAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+Q++RESKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A+ET
Sbjct  345  GDISYEQYLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKALET  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKF
Sbjct  405  AKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            ND+FM+QYEDHRGYSR+
Sbjct  465  NDDFMEQYEDHRGYSRL  481



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E 
Sbjct  345  GDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTILP EEDMPAIM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTILPDEEDMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED+RGYSR+
Sbjct  465  NDEFMEQYEDNRGYSRL  481



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYDQFVRESNGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFK F
Sbjct  405  AKQAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKNF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED+RGYSR+
Sbjct  465  NDEFMEQYEDNRGYSRL  481



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY QF+RESKGILESL++RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLQFMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE MPAIMESFKKF
Sbjct  405  AKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEXMPAIMESFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYEDHRGYSRM
Sbjct  465  NDEFMEQYEDHRGYSRM  481



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   259 bits (663),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF+RESKGILESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  345  GDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM++YED  GYSRM
Sbjct  465  NDSFMEEYEDXWGYSRM  481



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYD+FVRES GILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E 
Sbjct  344  GDISYDKFVRESTGILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEA  403

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+   K PDV+YCLKLLEATGISTVPGSGFGQ+EGVFHLRTTILP EEDMPAIM+SFKKF
Sbjct  404  AKQAAKVPDVFYCLKLLEATGISTVPGSGFGQREGVFHLRTTILPDEEDMPAIMDSFKKF  463

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED+RGYSR+
Sbjct  464  NDEFMEQYEDNRGYSRL  480



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +FV+ESK ILESLRKRA IMT+GFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  344  GDISYQKFVQESKTILESLRKRAHIMTNGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEV  403

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKF
Sbjct  404  AKMAGKVPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKF  463

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM+QYED RGYSRM
Sbjct  464  NDAFMEQYEDQRGYSRM  480



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +FV ES  ILESL++RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYLRFVAESTAILESLKRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKSAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED+RGYSRM
Sbjct  465  NDEFMEQYEDYRGYSRM  481



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   257 bits (657),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QF+RESKGILESLR+RAR+MTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  345  GDISYEQFIRESKGILESLRRRARMMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKF
Sbjct  405  AKMAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYE H GYSR+
Sbjct  465  NDEFMEQYEGHGGYSRL  481



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   257 bits (656),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYGDNFGYSRM  481



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   257 bits (656),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYGDNFGYSRM  481



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  373  GDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  432

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKF
Sbjct  433  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKF  492

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY D+ GYSRM
Sbjct  493  NDEFMSQYGDNFGYSRM  509



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY QF+RESKGILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLQFMRESKGILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF
Sbjct  405  AKKAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  464

Query  182  NDEFMDQYEDHRG  144
            NDEFM+QYEDHRG
Sbjct  465  NDEFMEQYEDHRG  477



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD+SYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIE 
Sbjct  345  GDVSYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQLRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QYED+   SRM
Sbjct  465  NDEFMAQYEDNWNRSRM  481



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY ++ +ESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+AIE 
Sbjct  345  GDISYLRYEQESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQICLPPKAIED  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFH+RTTILPAEEDMPAIM+SFKKF
Sbjct  405  AKKAGKHPDVFYCLKLLEATGISTVPGSGFGQKEGVFHMRTTILPAEEDMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM+QYEDHRGYSRM
Sbjct  465  NDAFMEQYEDHRGYSRM  481



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QF+RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LP RAIE 
Sbjct  345  GDISYEQFIRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPARAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  ARQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QYED+ GYSRM
Sbjct  465  NDEFMSQYEDNFGYSRM  481



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   254 bits (649),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD+SYDQ+VRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI LPP+AIE 
Sbjct  345  GDVSYDQYVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIHLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QYED+  +SRM
Sbjct  465  NDEFMAQYEDNWNHSRM  481



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   254 bits (650),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD+SYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIE 
Sbjct  359  GDVSYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQLRLPPKAIEA  418

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  419  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKF  478

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QYED+   SRM
Sbjct  479  NDEFMAQYEDNWNRSRM  495



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP AI+ 
Sbjct  345  GDISYDQFARESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY+++ GYSRM
Sbjct  465  NDEFMTQYDNNVGYSRM  481



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY D  GYSRM
Sbjct  465  NDEFMSQYGDSFGYSRM  481



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRES+GILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESEGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            N EFM QY D+ GYSRM
Sbjct  465  NHEFMSQYGDNFGYSRM  481



>emb|CDX91708.1| BnaC08g06270D [Brassica napus]
Length=403

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  267  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  326

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  327  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  386

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QYE+  GYSRM
Sbjct  387  NDEFMAQYENGFGYSRM  403



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   252 bits (644),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  342  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  401

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  402  AKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  461

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QYE+  GYSRM
Sbjct  462  NDEFMAQYENGFGYSRM  478



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   252 bits (644),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDIS+ +F  ESK ILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISFMRFAAESKEILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE+DMP IM SFKKF
Sbjct  405  AKRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEQDMPEIMASFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYE HRGYSRM
Sbjct  465  NDEFMEQYEHHRGYSRM  481



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +FV+ESK +LESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLKFVQESKAVLESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF+KF
Sbjct  405  ARKAGKAPDVFYCLGLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFRKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYE+ RGYSRM
Sbjct  465  NDEFMEQYENCRGYSRM  481



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   252 bits (643),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+Q+VRESKGIL+SLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP+A+E 
Sbjct  345  GDISYEQYVRESKGILDSLRRRAWIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPKAVEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED+  +SRM
Sbjct  465  NDEFMEQYEDNWSHSRM  481



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   252 bits (643),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QF+RESKGI+ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYEQFIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKF
Sbjct  405  AKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            N+EFM+QY+D  GYSR+
Sbjct  465  NNEFMEQYDDRSGYSRL  481



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   251 bits (642),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYADNFGYSRM  481



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   251 bits (642),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYADNFGYSRM  481



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   251 bits (642),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYADNFGYSRM  481



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ES  ILESL++RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GDISYLRFAAESNAILESLKRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCLKL+EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKF
Sbjct  405  AKRAGKAPDVFYCLKLVEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED+RGYSRM
Sbjct  465  NDEFMEQYEDYRGYSRM  481



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY + V+ESK +LESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP +AIE 
Sbjct  345  GDISYLKLVQESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPLKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCLKLLEATGI+TVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF+KF
Sbjct  405  ARKAGKAPDVFYCLKLLEATGIATVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFRKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED+RGYSRM
Sbjct  465  NDEFMEQYEDYRGYSRM  481



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY+++ GYSRM
Sbjct  465  NDEFMTQYDNNVGYSRM  481



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMGSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY D+ GYSRM
Sbjct  465  NDEFMSQYGDNFGYSRM  481



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ISY+QF+RESKGI+ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQIRLPP+AIE 
Sbjct  345  GNISYEQFIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIRLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKF
Sbjct  405  AKKAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            N+EFM+QY+D  GYSR+
Sbjct  465  NNEFMEQYDDRSGYSRL  481



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDIS+ +FV ESK +LESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+AIE 
Sbjct  345  GDISHLKFVVESKAVLESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQICLPPKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM SFKKF
Sbjct  405  AKKVGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMASFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED RGYSRM
Sbjct  465  NDEFMEQYEDCRGYSRM  481



>emb|CDY25780.1| BnaA07g10020D [Brassica napus]
Length=403

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  267  GDISYDQFTRESKGILESLRRRANIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  326

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLE TGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  327  AKQAGKVPDVFYCLKLLETTGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  386

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY+++ GYSRM
Sbjct  387  NDEFMTQYDNNFGYSRM  403



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP A++ 
Sbjct  342  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPGALQA  401

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  402  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  461

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QYE+  GYSRM
Sbjct  462  NDEFMTQYENSFGYSRM  478



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  342  GDISYDQFSRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  401

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  402  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  461

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY+++ GYSRM
Sbjct  462  NDEFMTQYDNNFGYSRM  478



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ 
Sbjct  342  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQA  401

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  402  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  461

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY++  GYSRM
Sbjct  462  NDEFMAQYDNGFGYSRM  478



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   249 bits (636),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+++VRESKGILESLR+RARIMTDGFN CRNVVCNFTEGAMYSFPQIRLP + +E 
Sbjct  345  GDISYERYVRESKGILESLRRRARIMTDGFNCCRNVVCNFTEGAMYSFPQIRLPLKVMEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKRAGKVADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QYED+ GYSRM
Sbjct  465  NDEFMEQYEDNGGYSRM  481



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   249 bits (635),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 2/139 (1%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYD+F+ ESKGILESLR+RARIMTDGFNSCRN+VCNFTEGAMYSFPQI+LP RAIE 
Sbjct  343  GDISYDKFITESKGILESLRRRARIMTDGFNSCRNIVCNFTEGAMYSFPQIQLPARAIEA  402

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A   GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKF
Sbjct  403  ANRAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKF  462

Query  182  NDEFMDQYED--HRGYSRM  132
            ND+FMDQYE+  H+ YSRM
Sbjct  463  NDDFMDQYEEDHHKAYSRM  481



>gb|AAM22749.1| alanine aminotransferase [Deschampsia antarctica]
Length=147

 Score =   237 bits (604),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++T
Sbjct  14   GDISYLKYATESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDT  73

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  74   AKSAGKAPDVFYCLMLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  133

Query  182  NDEFMDQYEDH  150
            ND FM+QY+D+
Sbjct  134  NDSFMEQYQDY  144



>gb|AAK68842.1| alanine aminotransferase-like protein [Arabidopsis thaliana]
Length=379

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  243  GDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQA  302

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKF
Sbjct  303  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKF  362

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY+++ GYS+M
Sbjct  363  NDEFMTQYDNNFGYSKM  379



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 127/137 (93%), Gaps = 2/137 (1%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY    GYSRM
Sbjct  465  NDEFMSQY--GVGYSRM  479



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 127/137 (93%), Gaps = 2/137 (1%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY    GYSRM
Sbjct  465  NDEFMSQY--GVGYSRM  479



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   247 bits (630),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPAGALQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY++  GYSRM
Sbjct  465  NDEFMTQYDNTVGYSRM  481



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   248 bits (633),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+N VCNFTEGAMYSFPQI+LPP A++ 
Sbjct  401  GDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNAVCNFTEGAMYSFPQIQLPPGALQA  460

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  461  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  520

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY+++ GYSRM
Sbjct  521  NDEFMTQYDNNFGYSRM  537



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   246 bits (628),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NV CNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVACNFTEGAMYSFPQIRLPAGALQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY+++ GYSRM
Sbjct  465  NDEFMTQYDNNVGYSRM  481



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPAGALQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            ND+FM QY+++ GYSRM
Sbjct  465  NDDFMTQYDNNFGYSRM  481



>dbj|BAJ90574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ 
Sbjct  162  GDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDV  221

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  222  AKSAGKEPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  281

Query  182  NDEFMDQYEDH  150
            ND FMDQY+DH
Sbjct  282  NDSFMDQYQDH  292



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYDQ++ ESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQIRLPPRAIE+
Sbjct  205  GDFSYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPRAIES  264

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  265  AKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKF  324

Query  182  NDEFMDQY  159
            ND FM++Y
Sbjct  325  NDAFMEEY  332



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY+++ GYS+M
Sbjct  465  NDEFMTQYDNNFGYSKM  481



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY+++ GYS+M
Sbjct  465  NDEFMTQYDNNFGYSKM  481



>ref|XP_009151206.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Brassica 
rapa]
Length=155

 Score =   233 bits (595),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  35   GDISYDQFVRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  94

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKF
Sbjct  95   AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPLIMESFKKF  154

Query  182  N  180
            N
Sbjct  155  N  155



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   244 bits (622),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQI LPP A++ 
Sbjct  342  GDISYDQFTRESKGILESLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQILLPPGALQA  401

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEA GISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  402  AKQAGKVPDVFYCLKLLEAAGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  461

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM QY+++ GYSRM
Sbjct  462  NDAFMTQYDNNFGYSRM  478



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 2/137 (1%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY QFVRESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  345  GDISYAQFVRESKGILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            ND+FM QY    GYSRM
Sbjct  465  NDDFMSQY--GVGYSRM  479



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQ++ ESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPPRAIE 
Sbjct  345  GDISYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKF
Sbjct  405  AKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKF  464

Query  182  NDEFMDQY  159
            ND FM++Y
Sbjct  465  NDAFMEEY  472



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ 
Sbjct  345  GDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDV  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  405  AKSAGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  464

Query  182  NDEFMDQYEDH  150
            ND FM+QY+DH
Sbjct  465  NDSFMEQYQDH  475



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDIS+DQFV ESK ILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AIE 
Sbjct  345  GDISHDQFVCESKRILESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHR-GYSRM  132
            NDEFM QY D+  GYSRM
Sbjct  465  NDEFMSQYGDNNFGYSRM  482



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVV NFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVRNFTEGAMYSFPQIRLPTGALQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKF
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM QY+++ GYS+M
Sbjct  465  NDEFMTQYDNNFGYSKM  481



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 122/137 (89%), Gaps = 3/137 (2%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK IL+SLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYLKFAAESKSILDSLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFK F
Sbjct  405  AKRAGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKNF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM QYE   GYSRM
Sbjct  465  NDSFMAQYE---GYSRM  478



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 124/137 (91%), Gaps = 3/137 (2%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  351  GDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDA  410

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  411  AKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKF  470

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FMDQY+   GYSRM
Sbjct  471  NDTFMDQYD---GYSRM  484



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPPRAI+ 
Sbjct  345  GDISYEQFARESKGILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPRAIDA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ L KAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP+IM SFKKF
Sbjct  405  AKKLEKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPSIMASFKKF  464

Query  182  NDEFMDQYE  156
            NDEFM +YE
Sbjct  465  NDEFMARYE  473



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 124/137 (91%), Gaps = 3/137 (2%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AI+ 
Sbjct  352  GDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDA  411

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  412  AKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKF  471

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FMDQY+   GYSRM
Sbjct  472  NDTFMDQYD---GYSRM  485



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RA IMT GFNSCRNV+CNFTEGAMYSFPQI+LP  AI+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRAHIMTGGFNSCRNVLCNFTEGAMYSFPQIQLPRGAIDA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGKAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP+IM SFKKF
Sbjct  405  AKKLGKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPSIMASFKKF  464

Query  182  NDEFMDQYE  156
            ND+FM QYE
Sbjct  465  NDDFMKQYE  473



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RA +MTDGFNSCRNVVCNFTEGAMYSFPQI+LP   I+ 
Sbjct  345  GDISYDQFVRESKGILESLRRRAHLMTDGFNSCRNVVCNFTEGAMYSFPQIQLPRGVIDA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LGK PDV+YC+KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP+IM SFKKF
Sbjct  405  AKKLGKTPDVFYCIKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPSIMASFKKF  464

Query  182  NDEFMDQYE  156
            ND+FM+QYE
Sbjct  465  NDDFMEQYE  473



>tpg|DAA59363.1| TPA: putative MATE efflux family protein isoform 1 [Zea mays]
 tpg|DAA59364.1| TPA: putative MATE efflux family protein isoform 2 [Zea mays]
Length=399

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 122/137 (89%), Gaps = 3/137 (2%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK I ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  266  GDISYLKFAAESKSIHESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  325

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK+ DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFKKF
Sbjct  326  ARRAGKSADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKKF  385

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM+QYE   GYSR+
Sbjct  386  NDSFMEQYE---GYSRL  399



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 124/137 (91%), Gaps = 3/137 (2%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK IL+SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP RAI+T
Sbjct  346  GDISYLKFATESKSILDSLRRRAQIMTDGFNSCQNVVCNFTEGAMYSFPQIRLPKRAIDT  405

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  406  AKSAGKEPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  465

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM+QY+D   YSR+
Sbjct  466  NDSFMEQYQD---YSRL  479



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+QF RESKGILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP AI+ 
Sbjct  348  GDISYEQFARESKGILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPGAIDA  407

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ L KAPDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MP+IM SFKKF
Sbjct  408  AKKLEKAPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPVEEEMPSIMASFKKF  467

Query  182  NDEFMDQYE  156
            NDEFM QYE
Sbjct  468  NDEFMAQYE  476



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 123/140 (88%), Gaps = 3/140 (2%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLP RAI+ 
Sbjct  355  GDISYLKFAAESKAILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAIDA  414

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A   GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  415  ANRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKF  474

Query  182  NDEFMDQYEDHRG---YSRM  132
            ND FMD+Y+ + G   YSRM
Sbjct  475  NDSFMDEYDGYGGGSSYSRM  494



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 122/137 (89%), Gaps = 3/137 (2%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK I ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE 
Sbjct  345  GDISYLKFAAESKSIHESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK+ DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFKKF
Sbjct  405  ARRAGKSADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKKF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM+QYE   GYSR+
Sbjct  465  NDSFMEQYE---GYSRL  478



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD+SY+Q+ RESKGIL+SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AIET
Sbjct  345  GDVSYEQYHRESKGILDSLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIET  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MPAIM SFKKF
Sbjct  405  AKRAGKEADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPAIMASFKKF  464

Query  182  NDEFMDQY  159
            NDEFM+QY
Sbjct  465  NDEFMEQY  472



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 121/137 (88%), Gaps = 3/137 (2%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE 
Sbjct  346  GDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEA  405

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKF
Sbjct  406  AKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKF  465

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM+QYE   GYSRM
Sbjct  466  NDSFMEQYE---GYSRM  479



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 121/137 (88%), Gaps = 3/137 (2%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE 
Sbjct  346  GDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEA  405

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKF
Sbjct  406  AKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKF  465

Query  182  NDEFMDQYEDHRGYSRM  132
            ND FM+QYE   GYSRM
Sbjct  466  NDSFMEQYE---GYSRM  479



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD+SY+Q+ RESKGILESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AIET
Sbjct  345  GDVSYEQYHRESKGILESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIET  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MP IM SF+KF
Sbjct  405  AKRAGKEADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPGIMASFRKF  464

Query  182  NDEFMDQY  159
            NDEFM+QY
Sbjct  465  NDEFMEQY  472



>ref|XP_010248614.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Nelumbo nucifera]
Length=338

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 118/137 (86%), Gaps = 6/137 (4%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F      I ESL++RA IMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIET
Sbjct  208  GDISYLKF------ITESLKRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQMRLPPKAIET  261

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEATGIS VPGSGFGQKE  FHL TTILPAEEDMPAIM SFKKF
Sbjct  262  AKRAGKVPDVFYCLKLLEATGISMVPGSGFGQKEEAFHLMTTILPAEEDMPAIMASFKKF  321

Query  182  NDEFMDQYEDHRGYSRM  132
            NDEFM+QY DHRGYS M
Sbjct  322  NDEFMEQYGDHRGYSWM  338



>gb|AFK42206.1| unknown [Lotus japonicus]
Length=305

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRESKGILESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPPRAIE 
Sbjct  189  GDISYDQFVRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPRAIEA  248

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  192
            A+   KAPDVYYCLKLLEATGISTVPGSGFGQK+G FHLRTTILP EE+MPAIM  F
Sbjct  249  AKQARKAPDVYYCLKLLEATGISTVPGSGFGQKDGYFHLRTTILPLEEEMPAIMGEF  305



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
             DISY +FV ESK ILESLR+RA +MTDGFN+CRNV+CNFTEGAMYSFPQI+LPP+AI  
Sbjct  345  ADISYQRFVAESKAILESLRRRAHLMTDGFNNCRNVICNFTEGAMYSFPQIKLPPKAIAA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCLKLLEATG+STVPGSGFGQKEGVFHLRTTILP EE+MP IM  FK F
Sbjct  405  AKEAGKAPDVFYCLKLLEATGMSTVPGSGFGQKEGVFHLRTTILPPEEEMPEIMNVFKIF  464

Query  182  NDEFMDQYEDHRGYSRM  132
            ND+FM +YE++  +SR+
Sbjct  465  NDDFMAKYENY-SWSRL  480



>ref|XP_011034252.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Populus euphratica]
Length=382

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 3/139 (2%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD+SY+QF+RESKGILESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQI  PP+AI+ 
Sbjct  245  GDVSYEQFIRESKGILESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIX-PPKAIDA  303

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG--VFHLRTTILPAEEDMPAIMESFK  189
            A+  GK PDV+YCLKLLEATGISTVP  G        VFHLRTTILPAEEDMP IM+SFK
Sbjct  304  AKRAGKVPDVFYCLKLLEATGISTVPQIGLIVIRSCRVFHLRTTILPAEEDMPEIMDSFK  363

Query  188  KFNDEFMDQYEDHRGYSRM  132
            KFNDEFM++YE H GYSR+
Sbjct  364  KFNDEFMERYEGHGGYSRL  382



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK ILESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE 
Sbjct  346  GDISYPKFTAESKSILESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEA  405

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKF
Sbjct  406  AKRAGKAADVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKF  465

Query  182  NDEF  171
            ND F
Sbjct  466  NDSF  469



>ref|XP_010230121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Brachypodium distachyon]
Length=164

 Score =   208 bits (529),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY +F  ESK IL+SLR+RA+IMTDGFNSC+NVVCNFTEGAMYS+ QI LP RAI+T
Sbjct  37   GDISYLKFATESKSILDSLRRRAQIMTDGFNSCQNVVCNFTEGAMYSYFQICLPKRAIDT  96

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+YCLKLLEAT ISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKF
Sbjct  97   AKSAGKEPDVFYCLKLLEATRISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMLSFKKF  156

Query  182  N  180
            N
Sbjct  157  N  157



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD+S+  +  ES  I++SLRKRA IMTDGFN+C NVVCNFTEGAMYSFPQ++LP  AI  
Sbjct  346  GDVSFPLYAAESAAIMQSLRKRAHIMTDGFNACENVVCNFTEGAMYSFPQVKLPKAAIAA  405

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E+DMPAIMESFK F
Sbjct  406  ARQAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSEKDMPAIMESFKMF  465

Query  182  NDEFMDQYEDHR  147
            N +FM QY D +
Sbjct  466  NADFMAQYSDSK  477



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY Q+  ESK I  SLRKRA IMTDGFN+C NVVCNFTEGAMYSFPQ++LP  A+  
Sbjct  346  GDISYPQYEAESKAISLSLRKRAHIMTDGFNACENVVCNFTEGAMYSFPQVKLPQAAVAA  405

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E+DMP IMESFKKF
Sbjct  406  AKKAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSEKDMPGIMESFKKF  465

Query  182  NDEFMDQYEDHR  147
            N +FM QY D +
Sbjct  466  NQDFMAQYADAK  477



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY  +  ES+ I  SLRKRA IMTDGFN+C N+VCNFTEGAMYSFPQ++LP  AI  
Sbjct  346  GDISYPLYKAESEAISLSLRKRAHIMTDGFNACENIVCNFTEGAMYSFPQVKLPQAAIAA  405

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPDV+YCL+LLEATGISTVPGSGFGQKEG FH+RTTILP+E DMP IMESFKKF
Sbjct  406  AKKAGKAPDVFYCLRLLEATGISTVPGSGFGQKEGTFHVRTTILPSERDMPGIMESFKKF  465

Query  182  NDEFMDQYEDHR  147
            N +FM Q+ D +
Sbjct  466  NADFMAQHSDTK  477



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = -2

Query  539  DISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETA  360
            DISY Q+  ESK I+ES+R+RA IMTDGFN C +VVCNFTEGAMYSFP+I+L   A++ A
Sbjct  346  DISYPQYQAESKAIIESMRRRAHIMTDGFNKCEDVVCNFTEGAMYSFPRIKLSKAAMDAA  405

Query  359  QGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  180
               GKA DV+YCLKLLEATGISTVPGSGFGQKEG  HLRTTILP E+DMP IM  F+KF+
Sbjct  406  AQAGKAADVFYCLKLLEATGISTVPGSGFGQKEGTLHLRTTILPLEQDMPGIMAKFQKFH  465

Query  179  DEFMDQYEDHRGYSRM  132
             +FM QY D+   SR+
Sbjct  466  ADFMAQYSDYSVSSRL  481



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   186 bits (472),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYD+FVRESKG+LESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPP+A+ET
Sbjct  345  GDISYDRFVRESKGVLESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPKALET  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFH  249
            A+  GKA DVYYCLKLLEATGISTVPGSGFGQKEG  H
Sbjct  405  AKQAGKAADVYYCLKLLEATGISTVPGSGFGQKEGYVH  442



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S++Q   E+ GI+ S+R+RAR+MTDGFN+C  + CN+TEGAMYSFP++ LPP+A++ 
Sbjct  395  GDPSHEQHEAEAAGIIASMRRRARMMTDGFNACEGITCNYTEGAMYSFPRLNLPPKALQA  454

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPD +YCLKLL+ATG+ TVPGSGFGQ+EG FHLRTTILP E+ +  ++ SF+KF
Sbjct  455  AKKAGKAPDTWYCLKLLDATGVLTVPGSGFGQEEGTFHLRTTILPQEDKIKDVIASFQKF  514

Query  182  NDEFMDQY  159
            +  FMD+Y
Sbjct  515  HASFMDEY  522



>emb|CDX91589.1| BnaC02g15710D [Brassica napus]
 emb|CDX88411.1| BnaC06g38550D [Brassica napus]
 emb|CDX86159.1| BnaA06g28760D [Brassica napus]
Length=131

 Score =   172 bits (435),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 8/100 (8%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQFVRE        R+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ 
Sbjct  35   GDISYDQFVRE--------RRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQA  86

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLR  243
            A+  GK PDV+YCLKL EATGISTVPGSGFGQKEGVFHLR
Sbjct  87   AKQAGKVPDVFYCLKLFEATGISTVPGSGFGQKEGVFHLR  126



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY+Q++RESKGIL SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A+ET
Sbjct  345  GDISYEQYLRESKGILGSLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKALET  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  258
            A+  GKAPDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  405  AKQAGKAPDVFYCLKLLEATGISTVPGSGFGQKEG  439



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISYDQF RESKGILESLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ 
Sbjct  345  GDISYDQFARESKGILESLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  258
            A+  GK PDV+YCLKLLEATGISTVPGSGFGQKEG
Sbjct  405  AKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEG  439



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ + +E    L SLR+RA ++TDGFNS   V CNFTEGAMYSFPQI+LPP+A+E 
Sbjct  394  GDSSYEMYTKEKAAELASLRRRAHMVTDGFNSLDGVTCNFTEGAMYSFPQIKLPPKALEA  453

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKA DV+YCLKLLE+TGISTVPGSGFGQ++G FHLRTTILP EE M + +E F+KF
Sbjct  454  AKAAGKAGDVFYCLKLLESTGISTVPGSGFGQEDGTFHLRTTILPREEVMSSFVEKFEKF  513

Query  182  NDEFMDQY  159
            + +FM QY
Sbjct  514  HKDFMKQY  521



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GDISY ++  ESK ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ 
Sbjct  345  GDISYLKYSAESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDV  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  258
            A+  GKAPDVYYCLKLLEATGISTVPGSGFGQKEG
Sbjct  405  AKSAGKAPDVYYCLKLLEATGISTVPGSGFGQKEG  439



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYDQ+ +E    L SLR+RA ++TDGFN+   V CNFTEGAMYSFPQI+LP +A+E 
Sbjct  393  GDPSYDQYTKEKASELVSLRRRAHMVTDGFNALDGVTCNFTEGAMYSFPQIKLPAKALEA  452

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQ+EG FHLRTTILP EE M   +E F KF
Sbjct  453  AKAAGKAGDVFYCLKLLEATGISTVPGSGFGQEEGTFHLRTTILPREEVMTHFVEKFDKF  512

Query  182  NDEFMDQY  159
            + +FM QY
Sbjct  513  HKDFMKQY  520



>gb|AFK38994.1| unknown [Lotus japonicus]
Length=136

 Score =   156 bits (395),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E + IL SL +RA+I+ DGFN    V CN  EGAMY FPQIRLP +AI+ 
Sbjct  7    GDESYESFMAEKENILSSLARRAKILEDGFNKLEGVTCNQAEGAMYLFPQIRLPQKAIKA  66

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+  F +F
Sbjct  67   AEAANTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVSRFTEF  126

Query  182  NDEFMDQYED  153
            +++FM+++ D
Sbjct  127  HEKFMNEFRD  136



>gb|AFK36743.1| unknown [Lotus japonicus]
Length=171

 Score =   157 bits (397),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E + IL SL +RA+I+ DGFN    V CN  EGAMY FPQIRLP +AI+ 
Sbjct  42   GDESYESFMAEKENILSSLARRAKILEDGFNKLEGVTCNKAEGAMYLFPQIRLPQKAIKA  101

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+  F +F
Sbjct  102  AEAANTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVSRFTEF  161

Query  182  NDEFMDQYED  153
            +++FM+++ D
Sbjct  162  HEKFMNEFRD  171



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYDQ+ +E    L SLR+R  ++TDGFN+   V CNFTEGAMYSFPQI+LP +A+E 
Sbjct  393  GDPSYDQYTKEKASELVSLRRRRHMVTDGFNALDGVTCNFTEGAMYSFPQIKLPAKALEA  452

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKA DV+YCLKLLEATGISTVPGSGFGQ+EG FHLRTTILP EE M   +E F KF
Sbjct  453  AKAAGKAGDVFYCLKLLEATGISTVPGSGFGQEEGTFHLRTTILPREEVMTTFVEKFDKF  512

Query  182  NDEFMDQY  159
            + +FM QY
Sbjct  513  HKDFMKQY  520



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 106/159 (67%), Gaps = 7/159 (4%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY Q+ RE + +L+SLR+RAR +TD FNSC  +VC  TEGAMYSFP+I LPP A+  
Sbjct  391  GDESYAQYAREKQDLLDSLRRRARAITDAFNSCEGIVCQETEGAMYSFPKITLPPAAMAA  450

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK+PDV+YCLKLLE TGISTVPGSGF Q++G FH RTTILP E     I++ F  F
Sbjct  451  AKAAGKSPDVFYCLKLLETTGISTVPGSGFKQRDGTFHFRTTILPPESKFQDIIQRFLAF  510

Query  182  NDEFMDQYE-------DHRGYSRM*QIADNMKQLLKSHK  87
            +  FM +Y+       D R   R  Q    +  ++ +H+
Sbjct  511  HSAFMAEYKGSTGRGTDSRDVKRAEQQESEVNWMIPAHR  549



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S++ +++E +G L SL +RA+++ DGFNS + V CN TEGAMY+FP++ LPPRA+E 
Sbjct  493  GDPSHELWIQEQQGELASLNRRAKMVVDGFNSLQGVSCNATEGAMYAFPRLSLPPRALEA  552

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APD +YCL+LLEATGI  VPGSGFGQ EG FHLRTTILP EE M   ++ F+ F
Sbjct  553  ARKAGRAPDAFYCLRLLEATGIVAVPGSGFGQAEGSFHLRTTILPREERMAEFVQKFRTF  612

Query  182  NDEFMDQY  159
            +  FM ++
Sbjct  613  HQSFMAEF  620



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +++E  GI +SL+KRA ++    NS   V CN +EGAMY+FPQIRLP +A+E 
Sbjct  402  GDSSYELYIKERDGIYDSLKKRANLLNKALNSLEGVTCNPSEGAMYAFPQIRLPKKAVEY  461

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ +GKAPD YYC++LLE TGI  VPGSGFGQK+G +H RTT LP+EE +  + E    F
Sbjct  462  AQSIGKAPDAYYCIQLLEHTGICVVPGSGFGQKDGTYHFRTTFLPSEEAIEGVCERIADF  521

Query  182  NDEFMDQYE  156
            + +FM++Y+
Sbjct  522  HKQFMNKYK  530



>gb|EEE58449.1| hypothetical protein OsJ_09677 [Oryza sativa Japonica Group]
Length=254

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD +  E   IL+SL +RA+ M   FNS   + CN TEGAMY FP+I LP +AIE 
Sbjct  125  GDASYDLYEEEKDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAIEA  184

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ + KAPDV+Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F
Sbjct  185  ARAVNKAPDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFREF  244

Query  182  NDEFMDQYED  153
            ++EFM QY D
Sbjct  245  HEEFMSQYRD  254



>ref|NP_001060284.1| Os07g0617800 [Oryza sativa Japonica Group]
 dbj|BAF22198.1| Os07g0617800 [Oryza sativa Japonica Group]
Length=329

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  200  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGA  259

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  260  AQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  319

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  320  HEKFMDEFRD  329



>ref|XP_006649511.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=482

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 93/130 (72%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD ++ E  GIL+SL +RA+ M   FNS   + CN TEGAMY FPQI LP +AIE 
Sbjct  353  GDGSYDLYMEEKDGILKSLARRAKAMESAFNSIDGITCNKTEGAMYLFPQIYLPHKAIEA  412

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ + KAPD +Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F
Sbjct  413  ARAVNKAPDAFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMIARFREF  472

Query  182  NDEFMDQYED  153
            ++EFM QY D
Sbjct  473  HEEFMAQYRD  482



>ref|XP_006657961.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Oryza 
brachyantha]
Length=453

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  324  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQKAIGA  383

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G  PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  384  AQAAGTVPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  443

Query  182  NDEFMDQYED  153
            +++FMD+Y D
Sbjct  444  HEKFMDEYRD  453



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  362  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQKAIGA  421

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G  PD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  422  AQAAGTVPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  481

Query  182  NDEFMDQYED  153
            +++FMD+Y D
Sbjct  482  HEKFMDEYRD  491



>gb|ETK83815.1| hypothetical protein L915_11053 [Phytophthora parasitica]
Length=200

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  72   GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  131

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF
Sbjct  132  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKF  191

Query  182  NDEFMDQY  159
            +  FMD+Y
Sbjct  192  HARFMDKY  199



>ref|XP_006661735.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=483

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY  +  E  GIL+SL +RA+ + D FN+   + CN TEGAMY FPQ+ LP +AIE 
Sbjct  354  GDASYASYKAEKDGILQSLARRAKALEDAFNNLEGITCNKTEGAMYLFPQLLLPRKAIEA  413

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F
Sbjct  414  AKAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIITRFKTF  473

Query  182  NDEFMDQYED  153
            ++ FM  Y D
Sbjct  474  HESFMAAYRD  483



>ref|NP_001064504.1| Os10g0390500 [Oryza sativa Japonica Group]
 dbj|BAA77260.1| alanine aminotransferase [Oryza sativa]
 dbj|BAA77261.1| alanine aminotransferase [Oryza sativa]
 gb|ABB47494.1| Alanine aminotransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26418.1| Os10g0390500 [Oryza sativa Japonica Group]
 gb|ACA50484.1| alanine aminotransferase [Oryza sativa Japonica Group]
 gb|EEC66876.1| hypothetical protein OsI_33417 [Oryza sativa Indica Group]
 gb|EEE50893.1| hypothetical protein OsJ_31385 [Oryza sativa Japonica Group]
Length=483

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY  +  E  GIL+SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP +AI+ 
Sbjct  354  GDASYASYKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDA  413

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+   KAPD +Y L+LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F
Sbjct  414  AKAANKAPDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAF  473

Query  182  NDEFMDQYED  153
            ++ FM  Y D
Sbjct  474  HEGFMAAYRD  483



>gb|EEC74641.1| hypothetical protein OsI_10280 [Oryza sativa Indica Group]
Length=494

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD +  E   IL+SL +RA+ M   FNS   + CN TEGAMY FP+I LP +AIE 
Sbjct  365  GDASYDLYEEERDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAIEA  424

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ + KAPDV+Y L+LL+ TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F
Sbjct  425  ARAVNKAPDVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFREF  484

Query  182  NDEFMDQYED  153
            ++EFM QY D
Sbjct  485  HEEFMSQYRD  494



>gb|AAK52114.1|AC079936_10 Putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=484

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY  +  E  GIL+SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP +AI+ 
Sbjct  355  GDASYASYKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDA  414

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+   KAPD +Y L+LLEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F
Sbjct  415  AKAANKAPDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAF  474

Query  182  NDEFMDQYED  153
            ++ FM  Y D
Sbjct  475  HEGFMAAYRD  484



>dbj|BAC79866.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC79995.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=486

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  357  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGA  416

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  417  AQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  476

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  477  HEKFMDEFRD  486



>tpg|DAA63613.1| TPA: hypothetical protein ZEAMMB73_743428 [Zea mays]
Length=329

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  200  GDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  259

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F
Sbjct  260  AQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEF  319

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  320  HEKFMDEFRD  329



>gb|ETL90369.1| hypothetical protein L917_10859 [Phytophthora parasitica]
Length=170

 Score =   147 bits (370),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  42   GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  101

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E+ +  ++E   KF
Sbjct  102  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIEKTSKF  161

Query  182  NDEFMDQY  159
            +  FMD+Y
Sbjct  162  HARFMDKY  169



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  417  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGA  476

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  477  AQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  536

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  537  HEKFMDEFRD  546



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  
Sbjct  417  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGA  476

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  477  AQAAGTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEF  536

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  537  HEKFMDEFRD  546



>tpg|DAA41461.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
 tpg|DAA41462.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
Length=330

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S++ F  E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  200  GDESFESFRLERDGILSSLGRRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPRKAIGA  259

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H+R+TILP E+ +P I+  FK+F
Sbjct  260  AQAAGTAPDAYYAKRLLEATGIVFVPGSGFGQVPGTWHIRSTILPQEDKIPGIVSRFKEF  319

Query  182  NDEFMDQYEDH  150
            +D+FMD++ D+
Sbjct  320  HDKFMDEFRDY  330



>gb|ETL37230.1| hypothetical protein L916_10951 [Phytophthora parasitica]
 gb|ETM43674.1| hypothetical protein L914_10886 [Phytophthora parasitica]
Length=200

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  72   GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  131

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E+ +  ++E   KF
Sbjct  132  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIEKTSKF  191

Query  182  NDEFMDQY  159
            +  FMD+Y
Sbjct  192  HARFMDKY  199



>gb|AAV64199.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  387  GDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  446

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F
Sbjct  447  AQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEF  506

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  507  HEKFMDEFRD  516



>ref|XP_002463187.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
 gb|EER99708.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
Length=541

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  412  GDESFESFMLERDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  471

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  472  AQAAGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRFKEF  531

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  532  HEKFMDEFRD  541



>emb|CDJ93113.1| Aminotransferase domain containing protein [Haemonchus contortus]
Length=505

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYDQ+++E   +L SL++RA ++ + + S   + CN  +GAMY+FPQ+ LPPRA+E 
Sbjct  377  GDPSYDQWLKEKNAVLASLKERATLVKEAYGSIEGIKCNEVQGAMYAFPQLMLPPRAVEK  436

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ L   PD +Y ++LLE+TG+  VPGSGFGQKEG +H RTTILP  E M  ++E FK F
Sbjct  437  ARSLNMEPDFFYAMQLLESTGVCIVPGSGFGQKEGTYHFRTTILPQTEMMKDMLERFKSF  496

Query  182  NDEFMDQYE  156
            + +FM++Y+
Sbjct  497  HTKFMEEYK  505



>gb|EFA80185.1| alanine transaminase [Polysphondylium pallidum PN500]
Length=599

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SYD +V+E   I +SL++RA ++    N    V CN  EGAMY+FPQIRLP RAIE 
Sbjct  471  GEQSYDTYVKERDTIFDSLKRRANLLAAALNGLEGVTCNQPEGAMYAFPQIRLPARAIEE  530

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPD YYC++LLEATGI  VPGSGFGQK+G +H RTT LP+E+ +  +      F
Sbjct  531  AKANGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTYHFRTTFLPSEQAIQGVCTRIADF  590

Query  182  NDEFMDQYE  156
            +  FM +Y+
Sbjct  591  HKNFMAKYK  599



>ref|XP_008653343.1| PREDICTED: alanine aminotransferase 2 [Zea mays]
Length=541

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  412  GDESFESFMSEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  471

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F
Sbjct  472  AQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEF  531

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  532  HEKFMDEFRD  541



>gb|AAV64237.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S++ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  387  GDESFESFMSERDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  446

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ +G APD YY  +LLEATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F
Sbjct  447  AQAVGTAPDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEF  506

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  507  HEKFMDEFRD  516



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -2

Query  524  QFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  345
            Q+ ++ +  L SLR+RA +MTD FN      CNFTEGAMYSFP++ LP +AI+ A+  GK
Sbjct  364  QYAKQYEDSLASLRRRAHVMTDAFNGLEGASCNFTEGAMYSFPRLHLPAKAIQAAKEAGK  423

Query  344  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  165
             PD +YCL LL  TGI TVPGSGFGQ EG FHLRTTILP E+ M   ++  + F+  FM 
Sbjct  424  DPDTFYCLALLADTGIVTVPGSGFGQVEGTFHLRTTILPQEDVMHEFVDKLRTFHKSFMA  483

Query  164  QYED  153
            +Y+D
Sbjct  484  KYKD  487



>ref|XP_002887430.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63689.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
Length=535

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 87/130 (67%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD ++ E  GIL S+ KRA+ + DG NS   V CN  EGAMY FP+I LP +AIE 
Sbjct  406  GDDSYDSYMAERDGILSSMAKRAKTLEDGLNSLEGVTCNRAEGAMYLFPRINLPQKAIEA  465

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  466  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQAPGTWHFRCTILPQEDKIPAIVNRLTEF  525

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  526  HKSFMDEFRD  535



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE 
Sbjct  397  GDESYESFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEA  456

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F
Sbjct  457  AKAVNVAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISHLKAF  516

Query  182  NDEFMDQYED  153
            ++ FM+++ D
Sbjct  517  HESFMEEFHD  526



>gb|KIY92376.1| hypothetical protein MNEG_15586 [Monoraphidium neglectum]
Length=157

 Score =   142 bits (358),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G  SYD + +E +G L SLR+RA ++TDGFNS   V CNFTEGAMY+FP++ LPP+A+  
Sbjct  40   GSPSYDLWRQEREGELASLRRRAHMVTDGFNSLEGVTCNFTEGAMYAFPRLHLPPKAVAA  99

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFK  189
            A+  GKAPDV+YCL+LLEATGISTVPGSGFGQ+EG FHLRTTILP EE M   ++ FK
Sbjct  100  AKAAGKAPDVFYCLRLLEATGISTVPGSGFGQEEGTFHLRTTILPREEKMAEFVQLFK  157



>gb|ETP13560.1| hypothetical protein F441_11279 [Phytophthora parasitica CJ01A1]
Length=499

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  371  GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  430

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF
Sbjct  431  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKF  490

Query  182  NDEFMDQY  159
            +  FMD+Y
Sbjct  491  HARFMDKY  498



>gb|ETP41623.1| hypothetical protein F442_11247 [Phytophthora parasitica P10297]
Length=499

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  371  GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  430

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF
Sbjct  431  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKF  490

Query  182  NDEFMDQY  159
            +  FMD+Y
Sbjct  491  HARFMDKY  498



>ref|XP_008907369.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETN06993.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETO72425.1| hypothetical protein F444_11432 [Phytophthora parasitica P1976]
Length=499

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  371  GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  430

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G APD +YC+++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF
Sbjct  431  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKF  490

Query  182  NDEFMDQY  159
            +  FMD+Y
Sbjct  491  HARFMDKY  498



>ref|XP_010937250.1| PREDICTED: alanine aminotransferase 2 [Elaeis guineensis]
Length=526

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE 
Sbjct  397  GDESYESFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEA  456

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F
Sbjct  457  AKVVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRLKAF  516

Query  182  NDEFMDQYED  153
            ++ FM+++ D
Sbjct  517  HESFMEEFHD  526



>ref|XP_010939850.1| PREDICTED: alanine aminotransferase 2 isoform X3 [Elaeis guineensis]
Length=329

 Score =   146 bits (368),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE 
Sbjct  200  GDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEA  259

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F
Sbjct  260  ANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAF  319

Query  182  NDEFMDQYED  153
            ++ F+ ++ D
Sbjct  320  HESFLGEFRD  329



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ ++ E   IL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AI+ 
Sbjct  401  GDESYESYIAERDEILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIKA  460

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +  APD YY  +LL+ATGI  VPGSGFGQ  G +H+R+TILP E+ +PAI+   K F
Sbjct  461  AEAVKTAPDAYYAHRLLDATGIVVVPGSGFGQVPGTWHIRSTILPQEDKIPAILSRLKAF  520

Query  182  NDEFMDQYED  153
            ++ FMD++ D
Sbjct  521  HEAFMDEFRD  530



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 88/130 (68%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY  F+ E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AI+ 
Sbjct  358  GDESYKSFIAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIDA  417

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +  APD  Y  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+   K F
Sbjct  418  AKAVIAAPDTLYARRLLDATGIVVVPGSGFGQVPGTWHVRCTILPQEDKIPAIISRLKAF  477

Query  182  NDEFMDQYED  153
            ++ FMD++ D
Sbjct  478  HEAFMDEFRD  487



>emb|CDJ93112.1| Aminotransferase domain containing protein [Haemonchus contortus]
Length=416

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYDQ+++E   +L SL++RA ++ + + S   + CN  +GAMY+FPQI LP RAIE 
Sbjct  288  GDPSYDQWLKEKTAVLASLKERATLVKEAYGSIDGIKCNEVQGAMYAFPQIMLPRRAIEK  347

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ L   PD +Y ++LLEATG+  VPGSGFGQKEG +H RTTILP    M  ++E FK F
Sbjct  348  ARSLNMEPDFFYAMQLLEATGVCIVPGSGFGQKEGTWHFRTTILPQTAMMKDMLERFKSF  407

Query  182  NDEFMDQYE  156
            + +FM +Y+
Sbjct  408  HTKFMKEYK  416



>gb|ETI43749.1| hypothetical protein F443_11362 [Phytophthora parasitica P1569]
Length=499

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  371  GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  430

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H RTTILP E+ +  ++E   KF
Sbjct  431  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIEKTSKF  490

Query  182  NDEFMDQY  159
            +  FMD+Y
Sbjct  491  HARFMDKY  498



>ref|XP_002906656.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
 gb|EEY66057.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
Length=499

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+++  +  G L SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E 
Sbjct  371  GDASYERYAEQRDGTLGSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEA  430

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G APD +YC ++L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF
Sbjct  431  AKEAGMAPDAFYCTQMLDDTGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEMTSKF  490

Query  182  NDEFMDQY  159
            + +FMD Y
Sbjct  491  HAKFMDTY  498



>dbj|GAM23260.1| hypothetical protein SAMD00019534_064350 [Acytostelium subglobosum 
LB1]
Length=531

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ S+ Q++ E   I  SL++RA ++    NS   V CN  EGAMY+FPQIRLPP+A+E 
Sbjct  403  GEASHKQYIEERDAIYNSLKRRANLLATALNSLEGVTCNAPEGAMYAFPQIRLPPKAVEE  462

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PD +YC++LLEATGI  VPGSGFGQ++G +H RTT LP+E+ +  + +    F
Sbjct  463  AKQNGKQPDAHYCIQLLEATGICVVPGSGFGQRDGTYHFRTTFLPSEQAIEGVCKKVADF  522

Query  182  NDEFMDQYE  156
            +  FM +Y+
Sbjct  523  HKAFMAKYK  531



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+Q+ +E   I +SL++RA ++++ FN+   V C   EGA+Y+FP++RLP  A++ 
Sbjct  348  GDASYEQYEQECDAIFQSLKRRAEMISNAFNALPGVSCQNVEGALYAFPRVRLPEAAVKE  407

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+     PD++YCL+LL ATGI  VPGSGFGQ+EG FH RTTILPAEE MP +++ F  F
Sbjct  408  AEKKDMGPDLFYCLELLHATGICAVPGSGFGQEEGTFHFRTTILPAEEQMPRVIDLFTSF  467

Query  182  NDEFMDQY  159
            + +F+ ++
Sbjct  468  HKDFLQRF  475



>gb|KJB68683.1| hypothetical protein B456_011G0552001, partial [Gossypium raimondii]
Length=331

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ 
Sbjct  202  GDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKA  261

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F
Sbjct  262  AEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDF  321

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  322  HKRFMDEFRD  331



>ref|XP_008560719.1| PREDICTED: alanine aminotransferase 1 [Microplitis demolitor]
Length=577

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY+QF++E   +LESL +R+R++ D  NS      N   GAMY FP+I LPP+AIE 
Sbjct  449  GEPSYEQFIKEKTAVLESLAERSRLVVDTLNSIPGFKSNPAMGAMYVFPRINLPPKAIEA  508

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APDV+Y  KLLE+TGI  +PGSGFGQK G +H+RTTILP +E +  ++ S K+F
Sbjct  509  AKAAGQAPDVFYAFKLLESTGICVIPGSGFGQKPGTYHIRTTILPQKEMIKTMLNSLKEF  568

Query  182  NDEFMDQY  159
            + +FM +Y
Sbjct  569  HLKFMKEY  576



>gb|KJB68682.1| hypothetical protein B456_011G0552001 [Gossypium raimondii]
Length=329

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ 
Sbjct  200  GDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKA  259

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F
Sbjct  260  AEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDF  319

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  320  HKRFMDEFRD  329



>gb|ADB91976.1| alanine aminotransferase [Branchiostoma belcheri]
Length=500

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY+ F++E   +L SL +RA+++ + FNS   V CN  +GAMY FP+I LP RA+E 
Sbjct  371  GEPSYESFIKEKTAVLTSLAERAKLVAETFNSIEGVTCNTVQGAMYPFPRIHLPRRAVEK  430

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LG++PD +Y L+LLE  GI  VPGSGFGQ+EG +H RTTILP  + +   M++F  F
Sbjct  431  AKSLGQSPDGFYALQLLEQAGICVVPGSGFGQREGTYHFRTTILPQPDKLKIFMDAFTAF  490

Query  182  NDEFMDQYED  153
            +++F+ +Y D
Sbjct  491  HNKFLQEYAD  500



>ref|XP_004303756.1| PREDICTED: alanine aminotransferase 2 [Fragaria vesca subsp. 
vesca]
Length=541

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (68%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ ++ E  GIL SL++RA+ + D  NS   V CN  EGAMY FP+I LP +AI  
Sbjct  412  GDESYELYLSEKDGILSSLKRRAKTLEDALNSLEGVTCNRAEGAMYLFPRIELPQKAIHA  471

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA+++   +F
Sbjct  472  AEAAKTAPDAFYCKRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVVDRLTEF  531

Query  182  NDEFMDQYED  153
            + +FMD++ D
Sbjct  532  HKKFMDEFRD  541



>emb|CEF68484.1| Alanine aminotransferase 1 [Strongyloides ratti]
Length=481

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY+Q+  E   +L SL++RA ++ + +     + CN  +GAMY+FP++ LP +AIE 
Sbjct  353  GEESYEQWNSEKNAVLASLKERATLVKEAYEKLEGITCNPVQGAMYAFPRVHLPTKAIEK  412

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LG+ PD +Y + LLE TGI  VPGSGFGQ+EG +H RTTILP  E M  +ME F KF
Sbjct  413  AKSLGQEPDFFYAMSLLEETGICVVPGSGFGQREGTYHFRTTILPQPELMKEMMERFTKF  472

Query  182  NDEFMDQYE  156
            ++EFM +YE
Sbjct  473  HNEFMKKYE  481



>ref|XP_004342401.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR20285.1| alanine aminotransferase, mitochondrial, putative [Acanthamoeba 
castellanii str. Neff]
Length=514

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SYD + +E+ GI ESL++RA  +T+ FN    V CN  EGAMY FP++RLP +A+  
Sbjct  385  GEPSYDLYHQETTGIFESLKRRALRLTEAFNKLEGVTCNEAEGAMYLFPRVRLPAKAVHE  444

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A    K PD +YCL LL+ TGI  VPGSGFGQK+G +H RTT LP E+ + A+ +S  KF
Sbjct  445  AVKQKKTPDSFYCLALLDQTGICVVPGSGFGQKDGTYHFRTTFLPPEDKIDAVAKSIAKF  504

Query  182  NDEFMDQYED  153
            + +FM +Y D
Sbjct  505  HHDFMQKYRD  514



>dbj|BAN21041.1| alanine aminotransferase [Riptortus pedestris]
Length=522

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY  F++E +G+L SL +RAR++T+ FNS   + CN  +GAMY+FP+I LP +AI+ 
Sbjct  394  GDPSYATFIKEKQGVLSSLAERARMVTETFNSVEGMSCNTVQGAMYAFPRIHLPQKAIDK  453

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ L + P V+Y  +LLE TGI  VPGSGFGQ EG +H RTTILP  E + +++++FK F
Sbjct  454  AKSLNQDPSVFYAFQLLEETGICIVPGSGFGQVEGTYHFRTTILPQPEQLKSMLKTFKTF  513

Query  182  NDEFMDQYE  156
            + +F+ +Y+
Sbjct  514  HQKFVQEYK  522



>ref|NP_001185380.1| alanine aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35307.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=553

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE 
Sbjct  424  GDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEA  483

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  484  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEF  543

Query  182  NDEFMDQYED  153
            +  FMD++ +
Sbjct  544  HKSFMDEFRN  553



>gb|ENN78579.1| hypothetical protein YQE_04947, partial [Dendroctonus ponderosae]
 gb|ERL91463.1| hypothetical protein D910_08793 [Dendroctonus ponderosae]
Length=525

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY+ F +E + +L+SL+ RA+++ D FNS     CN  +GAMY+FPQI LP +AIE 
Sbjct  397  GEPSYESFTKEKQAVLDSLKVRAKMVADTFNSMEGFSCNTVQGAMYAFPQITLPAKAIEA  456

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PDV+Y  +LLE TGI  VPGSGFGQK+G +H RTTILP  + + +++E F +F
Sbjct  457  AKKEGKQPDVFYAFELLENTGICIVPGSGFGQKQGTYHFRTTILPQPDKLKSMLEKFAEF  516

Query  182  NDEFMDQY  159
            + +F+ +Y
Sbjct  517  HSQFIKKY  524



>ref|NP_565040.2| alanine aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9LDV4.1|ALAT2_ARATH RecName: Full=Alanine aminotransferase 2, mitochondrial; Short=AtAlaAT2; 
Short=AtAlaATm; AltName: Full=Alanine-2-oxoglutarate 
aminotransferase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82781.1|AF275371_1 alanine aminotransferase [Arabidopsis thaliana]
 gb|AAG52580.1|AC016529_11 putative alanine aminotransferase; 79592-76658 [Arabidopsis thaliana]
 gb|AEE35305.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=540

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE 
Sbjct  411  GDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEA  470

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  471  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEF  530

Query  182  NDEFMDQYED  153
            +  FMD++ +
Sbjct  531  HKSFMDEFRN  540



>gb|AAK59591.2| putative alanine aminotransferase [Arabidopsis thaliana]
Length=532

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD ++ E  GIL S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE 
Sbjct  403  GDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEA  462

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  463  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEF  522

Query  182  NDEFMDQYED  153
            +  FMD++ +
Sbjct  523  HKSFMDEFRN  532



>ref|XP_010939849.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Elaeis guineensis]
Length=475

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE 
Sbjct  346  GDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEA  405

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F
Sbjct  406  ANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAF  465

Query  182  NDEFMDQYED  153
            ++ F+ ++ D
Sbjct  466  HESFLGEFRD  475



>ref|XP_010428116.1| PREDICTED: alanine aminotransferase 2, mitochondrial [Camelina 
sativa]
Length=549

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD ++ E  GIL S+ KRA+ + +  N+   V CN  EGAMY FP+I LP +AIE 
Sbjct  420  GDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRINLPQKAIEA  479

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+E    F
Sbjct  480  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVERLTAF  539

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  540  HKSFMDEFRD  549



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F  E  GIL SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE 
Sbjct  389  GDESYESFTAEKNGILSSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEA  448

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A  +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F
Sbjct  449  ANAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAF  508

Query  182  NDEFMDQYED  153
            ++ F+ ++ D
Sbjct  509  HESFLGEFRD  518



>gb|ETN63742.1| alanine aminotransferase [Anopheles darlingi]
Length=489

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY+QF RE + +L+SLR RA ++ + FNS     CN  +GAMY+FPQIRLPP+A+E 
Sbjct  361  GEPSYEQFTREKQNVLDSLRDRAELVANTFNSIEGFSCNPVQGAMYAFPQIRLPPKALEA  420

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  D +Y  +LLE TGI  VPGSGFGQ+ G +H RTTILP  E +  ++  FK F
Sbjct  421  AKKDGKPADTFYAFRLLEETGICIVPGSGFGQRPGTYHFRTTILPQTEKLKEMLGLFKTF  480

Query  182  NDEFMDQYE  156
            +++F+ +Y+
Sbjct  481  HEKFLQKYK  489



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F  E  GIL SL +RA+ + D FN    V CN  EGAMY FP++ LP +AIE 
Sbjct  401  GDESYESFAAEKNGILSSLARRAKALEDAFNGLVGVTCNKAEGAMYLFPRLHLPQKAIEA  460

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F
Sbjct  461  AKAVNAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIARLKAF  520

Query  182  NDEFMDQYED  153
            ++ FM ++ D
Sbjct  521  HESFMGEFRD  530



>gb|KHN39571.1| Alanine aminotransferase 2, mitochondrial [Glycine soja]
Length=536

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 87/130 (67%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F  E + ILESL +RA+ + D FN    V CN  EGAMY FPQIRL  +AI+ 
Sbjct  407  GDESYESFNAEKENILESLARRAKTLEDAFNKLEGVTCNKAEGAMYLFPQIRLSQKAIKA  466

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A     APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+    +F
Sbjct  467  AGDANTAPDNFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPPEEKIPAIVTRLTEF  526

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  527  HEKFMDEFRD  536



>ref|XP_005775483.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
 gb|EOD23054.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
Length=541

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E   IL S+++RA ++ DG N+   V CN  +GAMY+FP I LPP+AI  
Sbjct  413  GDASYEIYSGERDAILASMKRRATMLVDGLNALEGVTCNQPQGAMYAFPSITLPPKAIAA  472

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK PD +Y L LLEATGI  VPGSGFGQKEG +H RTT LP E +M  +++    F
Sbjct  473  AKDAGKVPDTFYALALLEATGIVVVPGSGFGQKEGTWHFRTTFLPPESEMTDVVDRMTAF  532

Query  182  NDEFMDQY  159
            + +FM +Y
Sbjct  533  HADFMGKY  540



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 88/130 (68%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F  E  GIL SL +RA+ + D FN    V CN  EGAMY FP++ LP +AIE 
Sbjct  394  GDESYESFDAEKTGILSSLARRAKALEDAFNGLEEVTCNKAEGAMYLFPRLHLPKKAIEA  453

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +  APD +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+   K F
Sbjct  454  AKAVKAAPDAFYARRLLDATGIVVVPGSGFGQVPGTWHVRCTILPHEDKIPAIISRLKAF  513

Query  182  NDEFMDQYED  153
            ++ FM+++ D
Sbjct  514  HEAFMEEFRD  523



>gb|KHN77825.1| Alanine aminotransferase 1 [Toxocara canis]
Length=552

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD +++E    L+SL++RAR++ + + S   + CN  +GAMY+FPQI LPP+A++ 
Sbjct  424  GDPSYDLWLKEKTATLDSLKERARLVKEAYGSIEGIKCNPVQGAMYAFPQIMLPPKAVQK  483

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ L +A D +Y ++LLEATG+  VPGSGFGQK+G +H RTTILP    M  ++E FK F
Sbjct  484  AKSLNQAADFFYAMQLLEATGVCVVPGSGFGQKDGTYHFRTTILPQPPLMKEMLERFKGF  543

Query  182  NDEFMDQY  159
            + +FM +Y
Sbjct  544  HTKFMKEY  551



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E   IL SL  RA+ + +  N    V CN  EGAMY FPQIRLP +AIE 
Sbjct  402  GDESYESFMAEKGSILSSLATRAKSLEEALNKLEGVTCNKAEGAMYLFPQIRLPKKAIEA  461

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  462  AEAENTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTEF  521

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  522  HEKFMDEFRD  531



>ref|XP_007441690.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Python 
bivittatus]
 ref|XP_007441691.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Python 
bivittatus]
 ref|XP_007441692.1| PREDICTED: alanine aminotransferase 2-like isoform X5 [Python 
bivittatus]
Length=492

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY QF +E   +L +L ++A++  + FN    + CN  +GAMY+FP+I LPPRA++ 
Sbjct  360  GDPSYQQFSQEKAAVLGALARKAQLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQD  419

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APD+++CLKLLE TGI  VPGSGFGQKEG FH R TILP +E +  +++   +F
Sbjct  420  AEAQGQAPDMFFCLKLLEETGICVVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQF  479

Query  182  NDEFMDQYEDHR  147
            + +F  +Y   +
Sbjct  480  HAKFTQEYSQRQ  491



>ref|XP_005443445.1| PREDICTED: alanine aminotransferase 2-like [Falco cherrug]
Length=422

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E K +L +L  +AR+  + FN    + CN  +GAMYSFP+I LPPRA+  
Sbjct  294  GDPSYELFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIELPPRALAA  353

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APD+++C+KLLE TGI  VPGSGFGQ+EG FH R TILP  E +  ++E    F
Sbjct  354  AKAQGQAPDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVLLEKLSSF  413

Query  182  NDEFMDQY  159
              +F+ +Y
Sbjct  414  YTKFVKEY  421



>ref|XP_007024768.1| Alanine aminotransferase 2 [Theobroma cacao]
 gb|EOY27390.1| Alanine aminotransferase 2 [Theobroma cacao]
Length=539

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E  GIL +L +RA+ + D FN    V CN  EGAMY FP+I LP +AI+ 
Sbjct  410  GDESYESYSAERDGILSALARRAKTLEDAFNKLEGVTCNKAEGAMYLFPRIHLPEKAIKA  469

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP EE +PAI+     F
Sbjct  470  AQVAKTAPDAFYCRRLLSATGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTHLTDF  529

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  530  HKSFMDEFRD  539



>ref|XP_007441689.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Python 
bivittatus]
Length=507

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY QF +E   +L +L ++A++  + FN    + CN  +GAMY+FP+I LPPRA++ 
Sbjct  375  GDPSYQQFSQEKAAVLGALARKAQLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQD  434

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APD+++CLKLLE TGI  VPGSGFGQKEG FH R TILP +E +  +++   +F
Sbjct  435  AEAQGQAPDMFFCLKLLEETGICVVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQF  494

Query  182  NDEFMDQYEDHR  147
            + +F  +Y   +
Sbjct  495  HAKFTQEYSQRQ  506



>ref|XP_007441688.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Python 
bivittatus]
Length=518

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY QF +E   +L +L ++A++  + FN    + CN  +GAMY+FP+I LPPRA++ 
Sbjct  386  GDPSYQQFSQEKAAVLGALARKAQLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQD  445

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APD+++CLKLLE TGI  VPGSGFGQKEG FH R TILP +E +  +++   +F
Sbjct  446  AEAQGQAPDMFFCLKLLEETGICVVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQF  505

Query  182  NDEFMDQYEDHR  147
            + +F  +Y   +
Sbjct  506  HAKFTQEYSQRQ  517



>ref|XP_005230442.1| PREDICTED: alanine aminotransferase 2-like [Falco peregrinus]
Length=436

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E K +L +L  +AR+  + FN    + CN  +GAMYSFP+I LPPRA+  
Sbjct  308  GDPSYELFIAEKKAVLSALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIELPPRALAA  367

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APD+++C+KLLE TGI  VPGSGFGQ+EG FH R TILP  E +  ++E    F
Sbjct  368  AKAQGQAPDMFFCMKLLEETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVLLEKLSSF  427

Query  182  NDEFMDQY  159
              +F+ +Y
Sbjct  428  YTKFIKEY  435



>ref|XP_005833147.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
 gb|EKX46167.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
Length=473

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S+DQ+ RE K + ESL++R++ +    NS +N+ C    GAMY+FP I LPP A++ 
Sbjct  345  GDPSHDQYEREMKDLFESLKRRSQKLHAALNSMKNITCTEIGGAMYAFPSIHLPPSAVQA  404

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G  PD +Y ++LL+ATGI  VPGSGF QK+G FH RTT LP+E  M  +++  +KF
Sbjct  405  AKEAGMTPDTFYAVELLDATGICVVPGSGFRQKQGSFHFRTTFLPSESKMDDVIDKLRKF  464

Query  182  NDEFMDQY  159
            N  FMD+Y
Sbjct  465  NQSFMDKY  472



>ref|XP_637993.1| alanine transaminase [Dictyostelium discoideum AX4]
 sp|Q54MJ7.1|ALAM_DICDI RecName: Full=Probable alanine aminotransferase, mitochondrial; 
Short=ALT; AltName: Full=Glutamate pyruvate transaminase; 
Short=GPT; AltName: Full=Glutamic--alanine transaminase; AltName: 
Full=Glutamic--pyruvic transaminase; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL64484.1| alanine transaminase [Dictyostelium discoideum AX4]
Length=534

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ S+D +++E   I ESL+KRA ++T+  N+   V CN +EGAMY+FPQIRLP +A+E 
Sbjct  406  GEQSHDLYLKERDNIYESLKKRANLLTNALNNLEGVTCNPSEGAMYAFPQIRLPAKAVEY  465

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A  +GKAPD YYC++LLEATGI  VPGSGFGQK+G +H RTT LP+EE +  + +    F
Sbjct  466  ANSIGKAPDAYYCIQLLEATGICVVPGSGFGQKDGTWHFRTTFLPSEEAIEGVCKRIADF  525

Query  182  NDEFMDQYE  156
            +  FM++Y+
Sbjct  526  HQSFMNKYK  534



>ref|XP_008120969.1| PREDICTED: alanine aminotransferase 1-like [Anolis carolinensis]
Length=504

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY QF +E + +L +L K+A +    FN    + CN  +GAMY+FP+I+LPPRA++ 
Sbjct  361  GDPSYQQFSQEKQAVLGALAKKAHLTEQTFNKAPGIHCNPVQGAMYAFPRIQLPPRAVQE  420

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APD+++CL+LLE TGI  VPGSGFGQKEG FH R TILP  E +  +++   +F
Sbjct  421  AKAQGQAPDMFFCLRLLEETGICVVPGSGFGQKEGTFHFRMTILPPMEKLEVVLQKLSQF  480

Query  182  NDEFMDQY  159
            + +F  +Y
Sbjct  481  HAKFTQEY  488



>gb|KHG30536.1| Alanine aminotransferase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=482

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ ++ E  GIL SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ 
Sbjct  353  GDKSYESYIAERDGILSSLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKA  412

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +  APD++YC +LL  TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F
Sbjct  413  AEEVKTAPDLFYCRRLLNETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDF  472

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  473  HKRFMDEFRD  482



>ref|XP_003573850.1| PREDICTED: alanine aminotransferase 2 [Brachypodium distachyon]
Length=481

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY  +  E   IL SL +RA+ + D FN+   + CN  EGAMY FP+I LP +AI+ 
Sbjct  352  GDESYASYQAEKDRILTSLARRAKALEDAFNNLEGITCNKAEGAMYLFPRINLPQKAIDA  411

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A    KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  FK F
Sbjct  412  ANAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFKVF  471

Query  182  NDEFMDQYED  153
            ++ FM ++ D
Sbjct  472  HEAFMAEHRD  481



>ref|XP_010235387.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Brachypodium 
distachyon]
Length=514

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  324  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  383

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G +PD YY L+LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  384  AQAAGASPDAYYALRLLQATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIISRFKEF  443

Query  182  NDEFMDQYED  153
            +++FMD+Y +
Sbjct  444  HEKFMDEYRE  453



>ref|XP_009059448.1| hypothetical protein LOTGIDRAFT_192553, partial [Lottia gigantea]
 gb|ESO89980.1| hypothetical protein LOTGIDRAFT_192553, partial [Lottia gigantea]
Length=484

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD+SYD F +E   +L+SL ++A ++TD FNS   + CN  +GAMY+FP+I LP +AIE 
Sbjct  357  GDLSYDLFKKEKDEVLKSLAEKATLVTDTFNSIEGIKCNQVQGAMYAFPRIFLPDKAIEE  416

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+   K+PD +YC +LLE TGI TVPGSGF Q++G FH RTTILP  + + ++++ FK+F
Sbjct  417  AKKNDKSPDAFYCFQLLEETGICTVPGSGFRQRDGTFHFRTTILPPIDTLKSVLKDFKEF  476

Query  182  NDEFMDQY  159
            +  FM +Y
Sbjct  477  HVNFMKKY  484



>ref|XP_010415979.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD ++ E  GIL S+ KRA+ + +  N+   V CN  EGAMY FP+I LP +AIE 
Sbjct  419  GDDSYDSYMVERDGILSSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRISLPQKAIEA  478

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ +PAI++    F
Sbjct  479  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVDRLTAF  538

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  539  HKSFMDEFRD  548



>ref|XP_002166762.2| PREDICTED: alanine aminotransferase 2-like [Hydra vulgaris]
Length=444

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SYD FV+E   +L SL+KRAR++ +  N    V CN  +GAMY+FPQI LP +AI+ 
Sbjct  316  GEPSYDLFVQEKFSVLSSLKKRARLVYETLNKIEGVTCNEVQGAMYAFPQIHLPQKAIDH  375

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ L +A D +YC++ LE TGI  VPGSGF QKEG +H R TILP E+ +   +E FK+F
Sbjct  376  AKSLDQAADFFYCMQFLEQTGICVVPGSGFRQKEGTYHFRLTILPPEDQLKVFLEKFKEF  435

Query  182  NDEFMDQYE  156
            + +F++ Y+
Sbjct  436  HIKFLEIYK  444



>ref|XP_003055208.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60460.1| predicted protein [Micromonas pusilla CCMP1545]
Length=477

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (68%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY  + +E   IL SL++RA  + +G N+   V C   EGAMY+FP+I LP + ++ 
Sbjct  348  GDASYPLYKQEKDDILSSLKRRAVTLVNGLNALEGVSCQEAEGAMYAFPKIDLPAKFLKE  407

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+G G APD  YC++LLEATGI  VPGSGFGQ EG +H RTT LPAE D+  +++   KF
Sbjct  408  AEGSGMAPDALYCMRLLEATGIVVVPGSGFGQVEGTWHFRTTFLPAEADIEGVVQKMTKF  467

Query  182  NDEFMDQYED  153
            + +FMD Y +
Sbjct  468  HGDFMDAYRN  477



>ref|XP_002499950.1| alanine aminotransferase [Micromonas sp. RCC299]
 gb|ACO61208.1| alanine aminotransferase [Micromonas sp. RCC299]
Length=463

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E   IL SL++RA  +  G N+   V CN  +GAMY+FP++ LP + +  
Sbjct  334  GDPSYELYAAERDAILSSLKRRALKLVSGLNALEGVTCNEAQGAMYAFPKVSLPEKFVAE  393

Query  362  AQGLGK-APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKK  186
            A   GK APD  YC+KLLEATGI  VPGSGFGQ EG +H RTT LP+EED+  ++E   K
Sbjct  394  ATASGKMAPDALYCMKLLEATGIVVVPGSGFGQVEGTWHFRTTFLPSEEDIGGVVEKLAK  453

Query  185  FNDEFMDQY  159
            F+ EFMD Y
Sbjct  454  FHAEFMDTY  462



>ref|XP_010096539.1| Alanine aminotransferase 2 [Morus notabilis]
 gb|EXB64659.1| Alanine aminotransferase 2 [Morus notabilis]
Length=537

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 87/130 (67%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E  GIL SL +RA+ + D FN+   + CN  EGAMY FP+I LP +AI+ 
Sbjct  408  GDESYESYRAERDGILSSLARRAKTLEDAFNNLEGITCNKAEGAMYLFPRINLPQKAIKA  467

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ + +APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  468  AEAVKEAPDAFYCHRLLNATGIVFVPGSGFGQAPGTWHFRCTILPQEDKIPAIVSRLTDF  527

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  528  HKGFMDEFRD  537



>ref|XP_005880402.1| PREDICTED: alanine aminotransferase 2 [Myotis brandtii]
Length=587

 Score =   144 bits (363),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 60/128 (47%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ S++QF+RE + +L +L ++A++  D FN    + CN  +GAMY+FP+I LPPRA+E 
Sbjct  459  GEESFEQFLREKESVLSNLAEKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIVLPPRAVEA  518

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ    APD++YC+KLLE TG+  VPGSGFGQ+EG +H R TILP  E +  +++  K F
Sbjct  519  AQAHNMAPDMFYCMKLLEETGVCVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQRVKDF  578

Query  182  NDEFMDQY  159
            + +F++++
Sbjct  579  HIQFLEEF  586



>ref|XP_001660470.1| AAEL009872-PA [Aedes aegypti]
 gb|EAT38206.1| AAEL009872-PA [Aedes aegypti]
Length=544

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY+QF++E   +L SL+ RA ++   FNS     CN  +GAMY FPQIRLP +AIE 
Sbjct  416  GEPSYEQFMKEKNAVLASLKVRAEMVASTFNSIEGFSCNPVQGAMYCFPQIRLPEKAIEA  475

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APDV+Y  +LLE TGI  VPGSGFGQ+ G +H RTTILP    +  +++ F+ F
Sbjct  476  AKKAGQAPDVFYAFQLLEQTGICIVPGSGFGQRPGTYHFRTTILPQPAKLKEMLDMFRAF  535

Query  182  NDEFMDQYE  156
            +++F+ QY+
Sbjct  536  HEKFLKQYK  544



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -2

Query  539  DISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETA  360
            D SY  +  E  GIL SL +RA+ +   FN    + CN  EGAMY FPQI LP +AIE A
Sbjct  354  DESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEAA  413

Query  359  QGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  180
            +   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP E+ +PA++  F  F+
Sbjct  414  KAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVFH  473

Query  179  DEFMDQYED  153
            + FM +Y D
Sbjct  474  EAFMSEYRD  482



>ref|XP_010235383.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Brachypodium 
distachyon]
Length=599

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E  GIL SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  
Sbjct  409  GDESYESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGA  468

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G +PD YY L+LL+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F
Sbjct  469  AQAAGASPDAYYALRLLQATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIISRFKEF  528

Query  182  NDEFMDQYED  153
            +++FMD+Y +
Sbjct  529  HEKFMDEYRE  538



>ref|XP_002826439.1| PREDICTED: alanine aminotransferase 2 [Pongo abelii]
Length=201

 Score =   137 bits (346),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ S++QF RE + +L +L K+A++  D FN    + CN  +GAMY+FP+I +P +A+E 
Sbjct  73   GEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEA  132

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ    APD++YC+KLLE TGI  VPGSGFGQ+EG +H R TILP  E +  +++  K F
Sbjct  133  AQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDF  192

Query  182  NDEFMDQY  159
            +  F+++Y
Sbjct  193  HINFLEKY  200



>ref|XP_002681562.1| alanine aminotransferase [Naegleria gruberi]
 gb|EFC48818.1| alanine aminotransferase [Naegleria gruberi]
Length=492

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY ++V E   IL SL++RA  +    NS   V C   EGAMY+FPQI LP +AI+ 
Sbjct  364  GEASYQEYVAERDNILNSLKRRAEKLVKMLNSLEGVSCQPVEGAMYAFPQITLPEKAIQK  423

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +G APD+ Y L+LLE TGI  VPGSGF QK G +H RTTILP+EE +  ++++  KF
Sbjct  424  AKEMGVAPDLMYVLELLEETGICVVPGSGFQQKPGTYHFRTTILPSEEQIEGVVQTLAKF  483

Query  182  NDEFMDQYE  156
            +D+FM QY+
Sbjct  484  HDKFMKQYK  492



>ref|XP_006634237.1| PREDICTED: alanine aminotransferase 2-like [Lepisosteus oculatus]
Length=489

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ S+ QF++E   +L SL +RAR++    NS   + CN  +GAMYSFP+I +P RAI+ 
Sbjct  361  GEPSHPQFIKERTAVLSSLAERARLVEQLLNSIPGISCNPVQGAMYSFPRINIPERAIKE  420

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ +G+APD++YCL+LLE TGI  VPGSGFGQK+G +H R TILP  E +  ++   K+F
Sbjct  421  AQAMGQAPDMFYCLRLLEETGICLVPGSGFGQKDGTYHFRMTILPPTEKLEVLLSKLKEF  480

Query  182  NDEFMDQY  159
            +  F  +Y
Sbjct  481  HQRFTREY  488



>gb|KDR12685.1| Alanine aminotransferase 2 [Zootermopsis nevadensis]
Length=538

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY++F +E K +L SL +RA+++ + FNS   V CN  +GAMY+FP++ LP +AIE 
Sbjct  410  GEPSYEEFTKEKKAVLNSLAERAKMVAETFNSIEGVSCNEVQGAMYAFPKLDLPKKAIEK  469

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ LG+  DV+Y  +LLE TGI  VPGSGFGQK G FH RTTILP  + +  ++  FK+F
Sbjct  470  AESLGQCADVFYAFQLLENTGICIVPGSGFGQKAGTFHFRTTILPQPDKLKIMLNKFKEF  529

Query  182  NDEFMDQYE  156
            + +F+ QY+
Sbjct  530  HLKFLTQYK  538



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -2

Query  539  DISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETA  360
            D SY  +  E  GIL SL +RA+ +   FN    + CN  EGAMY FPQI LP +AIE A
Sbjct  372  DESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEAA  431

Query  359  QGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  180
            +   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP E+ +PA++  F  F+
Sbjct  432  KAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVFH  491

Query  179  DEFMDQYED  153
            + FM +Y D
Sbjct  492  EAFMSEYRD  500



>ref|XP_002969652.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
 gb|EFJ29740.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
Length=503

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +VRE  GIL SL +RA+++ +GFN    V CN  EGAMY FP++ LP RA++ 
Sbjct  374  GDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSCNQAEGAMYLFPRLHLPERALKA  433

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A  +  A D +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILPAEE MPA++     F
Sbjct  434  AAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWHIRCTILPAEEKMPALITRLTSF  493

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  494  HQRFMDEFRD  503



>ref|XP_002970914.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
 gb|EFJ28240.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
Length=503

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +VRE  GIL SL +RA+++ +GFN    V CN  EGAMY FP++ LP RA++ 
Sbjct  374  GDESYEDYVRERDGILASLARRAKLLAEGFNKLEGVSCNQAEGAMYLFPRLHLPERALKA  433

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A  +  A D +Y  +LL+ATGI  VPGSGFGQ  G +H+R TILPAEE MPA++     F
Sbjct  434  AAAVSMAADTFYARRLLDATGIVVVPGSGFGQVPGTWHIRCTILPAEEKMPALITRLTSF  493

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  494  HQRFMDEFRD  503



>ref|XP_007135364.1| hypothetical protein PHAVU_010G123200g [Phaseolus vulgaris]
 gb|ESW07358.1| hypothetical protein PHAVU_010G123200g [Phaseolus vulgaris]
Length=541

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 87/130 (67%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ ++ E   ILESL +RA+ + D FN    V CN  EGAMY FPQIRL  +AI+ 
Sbjct  412  GDESYESYMAEKGNILESLARRAKTLEDAFNKLEGVTCNKAEGAMYLFPQIRLSQKAIKA  471

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A     +PD +YC +LL ATG+  VPGSGFGQ  G +H R TILP EE +PAI+    +F
Sbjct  472  AGDENTSPDNFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVSRLTEF  531

Query  182  NDEFMDQYED  153
            +++FMD++ D
Sbjct  532  HEKFMDEFRD  541



>ref|XP_008462239.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Cucumis 
melo]
Length=488

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD+ Y  +  E  GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP +AI+ 
Sbjct  359  GDLIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKAIKA  418

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++     F
Sbjct  419  AEAANTAPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRLTDF  478

Query  182  NDEFMDQYED  153
            +  FM++Y D
Sbjct  479  HKAFMNEYRD  488



>ref|XP_004235528.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Solanum lycopersicum]
Length=484

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F  E   IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +AI+ 
Sbjct  355  GDESYESFSAEKDAILSSLARRAKILEDAFNSLEGVTCYKAEGALYSFPRINLPDKAIKA  414

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F +F
Sbjct  415  AEEAKTAPDAFYAWRLLNATGIVVVSGSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQF  474

Query  182  NDEFMDQY  159
            + +FMD++
Sbjct  475  HKQFMDEF  482



>ref|XP_010318452.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X1 [Solanum lycopersicum]
Length=487

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F  E   IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +AI+ 
Sbjct  358  GDESYESFSAEKDAILSSLARRAKILEDAFNSLEGVTCYKAEGALYSFPRINLPDKAIKA  417

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F +F
Sbjct  418  AEEAKTAPDAFYAWRLLNATGIVVVSGSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQF  477

Query  182  NDEFMDQY  159
            + +FMD++
Sbjct  478  HKQFMDEF  485



>ref|XP_008228107.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Prunus 
mume]
Length=544

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E  GIL SL +RA+ + D  N+   V CN  EGAMY FP+I LP +AI+ 
Sbjct  415  GDESYELYCAEKDGILSSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPQKAIKA  474

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  475  AEAANTAPDAFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  534

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  535  HKSFMDEFRD  544



>ref|XP_007217248.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
 gb|EMJ18447.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
Length=544

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E  GIL SL +RA+ + D  N+   V CN  EGAMY FP+I LP +AI+ 
Sbjct  415  GDESYELYCAEKDGILSSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPQKAIKA  474

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  475  AEAANTAPDAFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  534

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  535  HKSFMDEFRD  544



>ref|XP_006342897.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=545

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F  E +GIL SL +RA+ + D F++   V CN  EGAMY FP+I LP +AI+ 
Sbjct  416  GDESYESFAAEKEGILSSLARRAKTLEDAFSNLEGVTCNKAEGAMYLFPRINLPNKAIKA  475

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +Y  +LL ATGI  VPGSGFGQ+ G +H R TILP EE +PAI+    +F
Sbjct  476  AEEAKTAPDAFYARRLLNATGIVVVPGSGFGQRPGTWHFRCTILPQEEKIPAIVSRLTEF  535

Query  182  NDEFMDQY  159
            + +FMD++
Sbjct  536  HKQFMDEF  543



>ref|XP_006342898.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=487

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F  E + IL SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +AI+ 
Sbjct  358  GDESYESFSAEKEAILSSLARRAKILEDAFNSLEGVTCYNAEGALYSFPRINLPDKAIKA  417

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +Y  +LL ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F +F
Sbjct  418  AEEAKTAPDAFYAWRLLNATGIVIVLGSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQF  477

Query  182  NDEFMDQY  159
            + +FMD++
Sbjct  478  HKQFMDEF  485



>ref|XP_010471259.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010471260.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SYD ++ E  GIL S+ KRA+ + D  N+   V CN  EGAMY FP+I LP +AIE 
Sbjct  419  GDDSYDSYMVERDGILSSMAKRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPHKAIEA  478

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATG+  VPGSGFGQ  G +H R TILP E+ + AI++    F
Sbjct  479  AEAEKTAPDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKILAIVDRLTAF  538

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  539  HKSFMDEFRD  548



>gb|ADE77246.1| unknown [Picea sitchensis]
Length=329

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S++ F  E  GIL SL +RA+ + D  N    V CN  EGAMY FP+I LP +AI+ 
Sbjct  200  GDESFEMFFAERDGILSSLARRAKTLVDALNQLEGVTCNEAEGAMYVFPRIHLPQQAIKA  259

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +   PD +Y  +LLEATGI TVPGSGFGQ  G +H R+TILP E+ +P I+     F
Sbjct  260  AEAVNMVPDAFYSQRLLEATGIVTVPGSGFGQVPGTWHFRSTILPPEDKIPTIVSRMTTF  319

Query  182  NDEFMDQYED  153
            + +FM+++ D
Sbjct  320  HQKFMEEFHD  329



>gb|KGB32667.1| Alanine aminotransferase 2 [Schistosoma haematobium]
Length=493

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY  FV+E   +L +L+ +A I     NS  N+ CN  +GAMY+FP+I LPP+AI+ 
Sbjct  365  GEASYSLFVKERDDVLSALKDKADITYSALNSMPNMSCNPVQGAMYAFPRIHLPPKAIQE  424

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APD +YCL+LLE  GI  VPGSGFGQ+EG +H RTTILP+ E M  +M+  ++F
Sbjct  425  AKRRGEAPDFFYCLQLLEEKGICVVPGSGFGQQEGTYHFRTTILPSVEKMKYVMKQVEEF  484

Query  182  NDEFMDQY  159
            +  FM +Y
Sbjct  485  HISFMKKY  492



>ref|XP_008150574.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Eptesicus fuscus]
Length=471

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ S++QF+RE + +L +L ++A++  D FN    + CN  +GAMY+FP+I LPPRA+E 
Sbjct  343  GEESFEQFIREKESVLSNLAEKAKLTEDLFNQVPGIRCNPLQGAMYAFPRIFLPPRAVEA  402

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ    APD++YC+KLLE TGI  VPGSGFGQ+EG +H R TILP  E +  +++  K F
Sbjct  403  AQAHNMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQRVKDF  462

Query  182  NDEFMDQY  159
            + +F+ ++
Sbjct  463  HIQFLGEF  470



>ref|XP_002430266.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
 gb|EEB17528.1| Alanine aminotransferase, putative [Pediculus humanus corporis]
Length=485

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY  +  E + +L  L+KRA+++ D FNS     CN  +GAMY+FPQ++LPP+A+E 
Sbjct  357  GEPSYPLYKEEREQVLSELKKRAKMVADTFNSIPGFSCNEVQGAMYAFPQMQLPPKAVEA  416

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GKAPD +Y L+LLE TGI  VPGSGFGQ+ G  H RTTILP  + + A++++FK F
Sbjct  417  AKKEGKAPDTFYALQLLENTGICIVPGSGFGQQPGTHHFRTTILPQTDKLKAMLDTFKTF  476

Query  182  NDEFMDQY  159
            + +F+ +Y
Sbjct  477  HKKFLKEY  484



>gb|ETL95505.1| hypothetical protein L917_06707 [Phytophthora parasitica]
 gb|ETM48704.1| hypothetical protein L914_06798 [Phytophthora parasitica]
 gb|ETO72416.1| hypothetical protein F444_11426 [Phytophthora parasitica P1976]
Length=177

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY +++ +  G L SL++RA  +   FN+   + CN TEGA+Y+FP I LP +A+E 
Sbjct  42   GDASYQRYIEQRDGTLHSLKRRAIKLVKAFNNLEGITCNETEGALYTFPSISLPAKAVEA  101

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G APD +YC+++L+ TGI  VPGSGFGQK G +H R+TILP EE +  ++E   KF
Sbjct  102  AKEAGMAPDAFYCMQMLDETGIVVVPGSGFGQKAGTWHFRSTILPPEEAVDEVIEKTAKF  161

Query  182  NDEFMDQYEDH  150
            + +FMD+Y ++
Sbjct  162  HAKFMDKYREN  172



>gb|ELK29365.1| Alanine aminotransferase 2 [Myotis davidii]
Length=416

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ S++QF+RE + +L +L ++A++  D FN    + CN  +GAMY+FP+I LPPRA+E 
Sbjct  288  GEESFEQFLREKESVLSNLAEKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIVLPPRAVEA  347

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ    APD++YC+KLLE TG+  VPGSGFGQ+EG +H R TILP  E +  +++  K F
Sbjct  348  AQAHNMAPDMFYCMKLLEETGVCVVPGSGFGQREGTYHFRMTILPPMEKLKTVLQRVKDF  407

Query  182  NDEFMDQY  159
            + +F+ ++
Sbjct  408  HIQFLGEF  415



>ref|XP_011036545.1| PREDICTED: alanine aminotransferase 2-like [Populus euphratica]
Length=533

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E  GIL SL +RA+ +   FN+   V CN  EGAMY FP IRLP +AI+T
Sbjct  404  GDESYESYSAEKDGILSSLARRAKTLEVAFNNLEGVTCNKAEGAMYLFPCIRLPEKAIKT  463

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++    +F
Sbjct  464  AEAAKTAPDNFYCRRLLNATGIVFVPGSGFGQLPGTWHFRCTILPQEDKIPAVVSRLTEF  523

Query  182  NDEFMDQYED  153
            +  FMD++ D
Sbjct  524  HKSFMDEFRD  533



>gb|EYC32542.1| hypothetical protein Y032_0003g1641 [Ancylostoma ceylanicum]
Length=499

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SYD +++E   +L+SL++RA ++ + + S   + CN  +GAMY+FPQI++P +AIE 
Sbjct  371  GEPSYDLWLKEKTAVLDSLKQRATLVKEAYGSIEGIRCNEVQGAMYAFPQIQIPQKAIEK  430

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ L + PD +Y ++LLE+TG+  VPGSGFGQKEG +H RTTILP  E M  ++  FK F
Sbjct  431  ARSLNQEPDFFYAMQLLESTGVCIVPGSGFGQKEGTYHFRTTILPQPELMKDMLNRFKSF  490

Query  182  NDEFMDQYE  156
            + +F+ +Y+
Sbjct  491  HTKFLQEYK  499



>ref|XP_008150573.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Eptesicus fuscus]
Length=523

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ S++QF+RE + +L +L ++A++  D FN    + CN  +GAMY+FP+I LPPRA+E 
Sbjct  395  GEESFEQFIREKESVLSNLAEKAKLTEDLFNQVPGIRCNPLQGAMYAFPRIFLPPRAVEA  454

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ    APD++YC+KLLE TGI  VPGSGFGQ+EG +H R TILP  E +  +++  K F
Sbjct  455  AQAHNMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQRVKDF  514

Query  182  NDEFMDQY  159
            + +F+ ++
Sbjct  515  HIQFLGEF  522



>ref|NP_001086104.1| alanine aminotransferase 2 [Xenopus laevis]
 sp|Q6GM82.1|ALAT2_XENLA RecName: Full=Alanine aminotransferase 2; Short=ALT2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT 2; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Xenopus laevis]
 gb|AAH74194.1| Gpt2 protein [Xenopus laevis]
Length=540

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY QF+ E + +L +L ++AR+  +  N    + CN  +GAMYSFP+I +P +AI+ 
Sbjct  412  GEPSYKQFISEKQAVLNNLAEKARLTEEILNQAPGIRCNPVQGAMYSFPRIHIPEKAIKL  471

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            AQ  G+APD+++C+KLLE TGI  VPGSGFGQ+EG  H R TILP  + + +++E  K F
Sbjct  472  AQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDF  531

Query  182  NDEFMDQY  159
            + +FMD+Y
Sbjct  532  HQKFMDEY  539



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = -2

Query  524  QFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK  345
            +   E++ I ES+++RA  +T  FN+   V CN TEGAMY+FP++ LPP+A+E A+  GK
Sbjct  363  EHATETRAIHESMQRRAAKVTAAFNALPGVTCNPTEGAMYAFPRLHLPPKAVEAARAAGK  422

Query  344  APDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMD  165
            APD +YCL LL+ TGI TVPG+GFGQ +G +H+RTTILP E+ +      F +F+ +FMD
Sbjct  423  APDTFYCLALLDYTGIVTVPGTGFGQVDGTWHMRTTILPQEDVLDDFCNRFAEFHQQFMD  482

Query  164  QY  159
            +Y
Sbjct  483  KY  484



>gb|KFB49063.1| AGAP000901-PA-like protein [Anopheles sinensis]
Length=546

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY+ F +E   +LESLR+RA ++   FNS     CN  +GAMY+FPQIRLPP+A+E 
Sbjct  418  GEPSYELFAKEKAAVLESLRERAELVARTFNSIEGFSCNPVQGAMYAFPQIRLPPKALEA  477

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  GK  D +Y  +LLE TGI  VPGSGFGQ+ G +H RTTILP  E +  ++  FK F
Sbjct  478  AKADGKPADTFYAFQLLEETGICIVPGSGFGQRPGTYHFRTTILPQPEKLKEMLGLFKSF  537

Query  182  NDEFMDQYE  156
            +++F+ +Y+
Sbjct  538  HEKFLAKYK  546



>emb|CCD81366.1| putative alanine aminotransferase [Schistosoma mansoni]
Length=481

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SY  FV+E   +L +L+ +A I     NS  N+ CN  +GAMY+FP+I LPP+AI+ 
Sbjct  353  GEPSYSLFVKERDDVLSALKDKADITYSALNSMPNMSCNPVQGAMYAFPRIHLPPKAIQE  412

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+  G+APD +YCL+LLE  GI  VPGSGFGQ+EG +H RTTILP+ E M  +M+  ++F
Sbjct  413  AKRRGEAPDFFYCLQLLEEKGICVVPGSGFGQQEGTYHFRTTILPSIEKMKYVMKQIEEF  472

Query  182  NDEFMDQY  159
            +  FM +Y
Sbjct  473  HISFMKKY  480



>gb|KDO53767.1| hypothetical protein CISIN_1g009517mg [Citrus sinensis]
Length=533

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +AI+ 
Sbjct  404  GDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKAIKA  463

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  464  AEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  523

Query  182  NDEFMDQYED  153
            +  FMD++ +
Sbjct  524  HKNFMDKFRN  533



>gb|EYC32543.1| hypothetical protein Y032_0003g1641 [Ancylostoma ceylanicum]
Length=529

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            G+ SYD +++E   +L+SL++RA ++ + + S   + CN  +GAMY+FPQI++P +AIE 
Sbjct  401  GEPSYDLWLKEKTAVLDSLKQRATLVKEAYGSIEGIRCNEVQGAMYAFPQIQIPQKAIEK  460

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ L + PD +Y ++LLE+TG+  VPGSGFGQKEG +H RTTILP  E M  ++  FK F
Sbjct  461  ARSLNQEPDFFYAMQLLESTGVCIVPGSGFGQKEGTYHFRTTILPQPELMKDMLNRFKSF  520

Query  182  NDEFMDQYE  156
            + +F+ +Y+
Sbjct  521  HTKFLQEYK  529



>gb|EMT23015.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=508

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -2

Query  539  DISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETA  360
            D SY  +  E  GIL SL +RA+ +   F+    + CN  EGAMY FPQI LP +AIE A
Sbjct  380  DESYASYKAEKDGILASLARRAKALEVAFSKLEGITCNKAEGAMYLFPQICLPQKAIEAA  439

Query  359  QGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  180
            +   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  F  F+
Sbjct  440  KAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFTVFH  499

Query  179  DEFMDQYED  153
            + FM +Y D
Sbjct  500  ETFMAEYRD  508



>ref|XP_006426797.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40037.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=529

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +AI+ 
Sbjct  400  GDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKAIKA  459

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  460  AEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  519

Query  182  NDEFMDQYED  153
            +  FMD++ +
Sbjct  520  HKSFMDKFRN  529



>ref|XP_008620886.1| alanine transaminase [Saprolegnia diclina VS20]
 gb|EQC25667.1| alanine transaminase [Saprolegnia diclina VS20]
Length=489

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ ++ +  GIL SL++RA  +   FN    V CN  EGAMY+FP+I +P +A+E 
Sbjct  361  GDESYELYIAQRDGILSSLKRRAVKLVAAFNELEGVSCNAAEGAMYTFPRITVPEKAVEE  420

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A   G APD +Y + LL+ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E   KF
Sbjct  421  ATKRGVAPDAFYAMALLDATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIEKTAKF  480

Query  182  NDEFMDQY  159
            + EFMD Y
Sbjct  481  HAEFMDLY  488



>ref|XP_006465804.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Citrus 
sinensis]
Length=533

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +AI+ 
Sbjct  404  GDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKAIKA  463

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  464  AEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  523

Query  182  NDEFMDQYED  153
            +  FMD++ +
Sbjct  524  HKNFMDKFRN  533



>ref|XP_006426798.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40038.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=533

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ +  E  GIL SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +AI+ 
Sbjct  404  GDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKAIKA  463

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F
Sbjct  464  AEAEKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF  523

Query  182  NDEFMDQYED  153
            +  FMD++ +
Sbjct  524  HKSFMDKFRN  533



>gb|ACJ85860.1| unknown [Medicago truncatula]
Length=524

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD SY+ F+ E   IL SL  RA+ + +  N    V CN  EGAMY FP+IRLP +AI+ 
Sbjct  395  GDESYESFMAERGAILSSLTTRAKALEEALNKLEGVTCNKAEGAMYLFPRIRLPEKAIKA  454

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+    APD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  455  AEAEKSAPDAFYCKRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDRIPAIVTRLTEF  514

Query  182  NDEFMDQYED  153
            + +FMD++ D
Sbjct  515  HQKFMDEFRD  524



>ref|XP_004141733.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
 gb|KGN45438.1| hypothetical protein Csa_7G448000 [Cucumis sativus]
Length=488

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 83/130 (64%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD+ Y  +  E  GIL SL +RA+++    NS  NV CN  EGAMY FP I+LP +AI+ 
Sbjct  359  GDLIYKSYCAERDGILSSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKAIKA  418

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+     PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PA++     F
Sbjct  419  AEAANTVPDTFYCRQLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRLTDF  478

Query  182  NDEFMDQYED  153
            +  FM++Y D
Sbjct  479  HKAFMNEYRD  488



>ref|XP_004144444.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=528

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 87/130 (67%), Gaps = 0/130 (0%)
 Frame = -2

Query  542  GDISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIET  363
            GD S++ +  E  GIL SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ 
Sbjct  399  GDESFESYSAEKDGILSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKA  458

Query  362  AQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKF  183
            A+ +  +PD +YC +LL ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F
Sbjct  459  AEAVNTSPDTFYCRRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEF  518

Query  182  NDEFMDQYED  153
            + +FM+++ D
Sbjct  519  HKQFMEEFRD  528



>gb|EMS46317.1| Alanine aminotransferase 2 [Triticum urartu]
Length=519

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -2

Query  539  DISYDQFVRESKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETA  360
            D SY  +  E  GIL SL +RA+ +   F+    + CN  EGAMY FPQI LP +AIE A
Sbjct  391  DESYASYKAEKDGILASLARRAKALEIAFSKLEGITCNKAEGAMYLFPQICLPQKAIEAA  450

Query  359  QGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  180
            +   KAPD +Y L+LLE+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  F  F+
Sbjct  451  KAANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFTVFH  510

Query  179  DEFMDQYED  153
            + FM +Y D
Sbjct  511  ETFMAEYRD  519



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490