BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021K03

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAM91528.1|  putative casein kinase                                  328   5e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895    339   5e-108   Nicotiana sylvestris
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627    339   6e-108   Sesamum indicum [beniseed]
gb|EPS68531.1|  hypothetical protein M569_06230                         339   6e-108   Genlisea aurea
emb|CDP14324.1|  unnamed protein product                                339   7e-108   Coffea canephora [robusta coffee]
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400    339   7e-108   Nicotiana tomentosiformis
gb|KDO55049.1|  hypothetical protein CISIN_1g005214mg                   332   2e-107   Citrus sinensis [apfelsine]
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130    337   3e-107   Nicotiana sylvestris
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184    337   3e-107   Nicotiana tomentosiformis
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479    336   8e-107   Cucumis sativus [cucumbers]
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979    336   8e-107   Cucumis melo [Oriental melon]
ref|XP_002525432.1|  casein kinase, putative                            336   9e-107   Ricinus communis
ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    336   2e-106   
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459    335   2e-106   Sesamum indicum [beniseed]
gb|AAO41895.1|  putative casein kinase                                  322   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg             335   3e-106   Citrus clementina [clementine]
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg                335   3e-106   Erythranthe guttata [common monkey flower]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...    335   3e-106   Citrus sinensis [apfelsine]
ref|XP_002325416.1|  kinase family protein                              335   4e-106   
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442    334   6e-106   Solanum lycopersicum
ref|XP_007030718.1|  Kinase family protein                              333   6e-106   Theobroma cacao [chocolate]
gb|AAF00624.1|AC009540_1  unknown protein, 5' partial                   327   9e-106   Arabidopsis thaliana [mouse-ear cress]
gb|KDP39706.1|  hypothetical protein JCGZ_02726                         333   1e-105   Jatropha curcas
ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072    333   2e-105   Solanum tuberosum [potatoes]
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg             332   2e-105   Prunus persica
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555    332   2e-105   Populus euphratica
emb|CBI29940.3|  unnamed protein product                                329   3e-105   Vitis vinifera
ref|XP_010088042.1|  Casein kinase I isoform delta                      332   4e-105   
gb|ADE75678.1|  unknown                                                 317   6e-105   Picea sitchensis
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977    331   9e-105   Prunus mume [ume]
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210    330   1e-104   Pyrus x bretschneideri [bai li]
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268    330   1e-104   Eucalyptus grandis [rose gum]
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151    330   1e-104   
ref|NP_187044.1|  protein kinase family protein                         330   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297091.1|  hypothetical protein CARUB_v10013094mg             330   2e-104   Capsella rubella
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624    330   2e-104   Vitis vinifera
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...    330   2e-104   Tarenaya hassleriana [spider flower]
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...    330   2e-104   
ref|XP_002884421.1|  kinase family protein                              330   2e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_004288418.1|  PREDICTED: uncharacterized protein LOC101290807    329   2e-104   Fragaria vesca subsp. vesca
gb|KJB45108.1|  hypothetical protein B456_007G289500                    330   2e-104   Gossypium raimondii
emb|CDY29971.1|  BnaC01g40370D                                          329   4e-104   Brassica napus [oilseed rape]
ref|XP_010463863.1|  PREDICTED: uncharacterized protein LOC104744499    329   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010516062.1|  PREDICTED: uncharacterized protein LOC104791...    329   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...    329   4e-104   Glycine max [soybeans]
ref|XP_010485760.1|  PREDICTED: uncharacterized protein LOC104764...    329   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg             328   5e-104   Eutrema salsugineum [saltwater cress]
emb|CDY21155.1|  BnaA01g33860D                                          328   9e-104   Brassica napus [oilseed rape]
gb|KHG27523.1|  hypothetical protein F383_15264                         328   1e-103   Gossypium arboreum [tree cotton]
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...    328   1e-103   Cicer arietinum [garbanzo]
emb|CDY42890.1|  BnaC05g47610D                                          327   2e-103   Brassica napus [oilseed rape]
gb|KHG04306.1|  Casein kinase I-like protein                            327   2e-103   Gossypium arboreum [tree cotton]
gb|KJB82583.1|  hypothetical protein B456_013G203000                    327   2e-103   Gossypium raimondii
gb|KJB82579.1|  hypothetical protein B456_013G203000                    327   2e-103   Gossypium raimondii
gb|KHG17118.1|  Casein kinase I isoform delta                           327   2e-103   Gossypium arboreum [tree cotton]
ref|XP_003624626.1|  Casein kinase I isoform alpha                      327   2e-103   Medicago truncatula
gb|KJB80965.1|  hypothetical protein B456_013G123300                    327   3e-103   Gossypium raimondii
gb|KJB80963.1|  hypothetical protein B456_013G123300                    327   3e-103   Gossypium raimondii
ref|XP_009130401.1|  PREDICTED: uncharacterized protein LOC103855200    326   3e-103   Brassica rapa
ref|XP_009102089.1|  PREDICTED: uncharacterized protein LOC103828226    326   4e-103   Brassica rapa
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g             326   6e-103   Phaseolus vulgaris [French bean]
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684    326   7e-103   Nelumbo nucifera [Indian lotus]
ref|XP_009413883.1|  PREDICTED: uncharacterized protein LOC103995100    325   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...    323   6e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006400366.1|  hypothetical protein EUTSA_v10012841mg             323   6e-102   Eutrema salsugineum [saltwater cress]
gb|ABF99312.1|  protein kinase family protein, putative, expressed      318   8e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016    323   8e-102   Elaeis guineensis
ref|XP_010516137.1|  PREDICTED: uncharacterized protein LOC104791...    322   1e-101   Camelina sativa [gold-of-pleasure]
ref|NP_197320.1|  protein kinase                                        322   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485763.1|  PREDICTED: uncharacterized protein LOC104764...    322   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369    323   1e-101   Phoenix dactylifera
ref|XP_010424160.1|  PREDICTED: uncharacterized protein LOC104709208    320   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010492820.1|  PREDICTED: uncharacterized protein LOC104770147    322   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_009418951.1|  PREDICTED: uncharacterized protein LOC103999...    322   2e-101   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY38493.1|  BnaA10g16650D                                          321   3e-101   Brassica napus [oilseed rape]
emb|CDY25451.1|  BnaC09g39660D                                          321   3e-101   Brassica napus [oilseed rape]
gb|EEC71557.1|  hypothetical protein OsI_03913                          320   3e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_009418950.1|  PREDICTED: uncharacterized protein LOC103999...    322   5e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009121003.1|  PREDICTED: uncharacterized protein LOC103845859    320   6e-101   Brassica rapa
ref|XP_010454044.1|  PREDICTED: uncharacterized protein LOC104735873    320   7e-101   Camelina sativa [gold-of-pleasure]
ref|NP_001044393.1|  Os01g0772600                                       320   7e-101   
dbj|BAJ90552.1|  predicted protein                                      320   7e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAN15568.1|  heading date 16                                        320   1e-100   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051531.1|  Os03g0793500                                       320   1e-100   
gb|EAY92152.1|  hypothetical protein OsI_13865                          320   1e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_002873876.1|  kinase family protein                              320   1e-100   
emb|CDY50866.1|  BnaA05g37270D                                          322   2e-100   Brassica napus [oilseed rape]
ref|XP_006287189.1|  hypothetical protein CARUB_v10000361mg             319   2e-100   Capsella rubella
ref|XP_003569928.1|  PREDICTED: uncharacterized protein LOC100845295    319   2e-100   Brachypodium distachyon [annual false brome]
ref|XP_006644782.1|  PREDICTED: uncharacterized protein LOC102714869    319   2e-100   Oryza brachyantha
gb|KJB46016.1|  hypothetical protein B456_007G343500                    319   3e-100   Gossypium raimondii
dbj|BAJ93086.1|  predicted protein                                      319   3e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010228600.1|  PREDICTED: uncharacterized protein LOC100829940    319   3e-100   
ref|XP_004970128.1|  PREDICTED: uncharacterized protein LOC101772174    319   3e-100   Setaria italica
ref|NP_001058996.1|  Os07g0171300                                       319   3e-100   
ref|XP_006657490.1|  PREDICTED: uncharacterized protein LOC102719500    318   4e-100   Oryza brachyantha
ref|XP_008655390.1|  PREDICTED: uncharacterized protein LOC100502...    321   6e-100   
ref|XP_009132256.1|  PREDICTED: uncharacterized protein LOC103856881    317   7e-100   Brassica rapa
emb|CDY51243.1|  BnaA03g06950D                                          317   1e-99    Brassica napus [oilseed rape]
emb|CDX70801.1|  BnaC03g08850D                                          317   1e-99    
ref|XP_004955583.1|  PREDICTED: uncharacterized protein LOC101773...    317   2e-99    Setaria italica
ref|XP_008651588.1|  PREDICTED: ATP binding protein isoform X1          317   2e-99    Zea mays [maize]
ref|NP_001152463.1|  ATP binding protein                                316   3e-99    Zea mays [maize]
ref|XP_004955580.1|  PREDICTED: uncharacterized protein LOC101773...    316   5e-99    Setaria italica
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...    315   8e-99    
ref|NP_001152101.1|  LOC100285738                                       315   9e-99    Zea mays [maize]
gb|ACN36158.1|  unknown                                                 315   9e-99    Zea mays [maize]
ref|XP_003557523.1|  PREDICTED: uncharacterized protein LOC100821235    315   1e-98    Brachypodium distachyon [annual false brome]
gb|ADE77861.1|  unknown                                                 297   3e-98    Picea sitchensis
ref|XP_006842223.1|  hypothetical protein AMTR_s00078p00181940          313   6e-98    
gb|EMS51431.1|  Casein kinase I isoform beta                            311   1e-97    Triticum urartu
emb|CDY02641.1|  BnaC02g07940D                                          311   2e-97    
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg                311   2e-97    Erythranthe guttata [common monkey flower]
ref|XP_002466312.1|  hypothetical protein SORBIDRAFT_01g005460          311   2e-97    Sorghum bicolor [broomcorn]
ref|XP_009126244.1|  PREDICTED: uncharacterized protein LOC103851164    310   4e-97    Brassica rapa
ref|XP_010552201.1|  PREDICTED: serine/threonine-protein kinase s...    310   9e-97    Tarenaya hassleriana [spider flower]
emb|CDY53253.1|  BnaA02g04010D                                          311   1e-96    Brassica napus [oilseed rape]
ref|NP_001183608.1|  uncharacterized protein LOC100502202               292   2e-96    
ref|XP_010500967.1|  PREDICTED: uncharacterized protein LOC104778...    300   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_004981469.1|  PREDICTED: uncharacterized protein LOC101783...    308   5e-96    
ref|XP_010936995.1|  PREDICTED: casein kinase I isoform gamma-1-l...    305   7e-96    
ref|XP_010936996.1|  PREDICTED: casein kinase I isoform gamma-1-l...    305   7e-96    
ref|XP_010542444.1|  PREDICTED: serine/threonine-protein kinase S...    306   2e-95    Tarenaya hassleriana [spider flower]
ref|XP_010534909.1|  PREDICTED: serine/threonine-protein kinase S...    306   2e-95    Tarenaya hassleriana [spider flower]
ref|XP_008797930.1|  PREDICTED: uncharacterized protein LOC103712...    306   3e-95    Phoenix dactylifera
ref|XP_008797939.1|  PREDICTED: uncharacterized protein LOC103712...    306   3e-95    Phoenix dactylifera
ref|XP_008797922.1|  PREDICTED: uncharacterized protein LOC103712...    306   4e-95    Phoenix dactylifera
ref|XP_008797915.1|  PREDICTED: uncharacterized protein LOC103712...    306   5e-95    Phoenix dactylifera
ref|XP_006651899.1|  PREDICTED: uncharacterized protein LOC102717146    306   6e-95    Oryza brachyantha
gb|EMT21659.1|  Casein kinase I-RAG8-like protein                       303   1e-94    
ref|XP_010472589.1|  PREDICTED: uncharacterized protein LOC104752210    290   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002960894.1|  hypothetical protein SELMODRAFT_139482             301   1e-94    
ref|XP_002967119.1|  hypothetical protein SELMODRAFT_144765             301   1e-94    
ref|XP_001770883.1|  predicted protein                                  301   2e-94    
ref|XP_001764211.1|  predicted protein                                  301   2e-94    
gb|AAC42254.1|  unknown protein                                         291   2e-94    Arabidopsis thaliana [mouse-ear cress]
gb|KHN37292.1|  Casein kinase I                                         300   2e-94    Glycine soja [wild soybean]
emb|CDY23629.1|  BnaC05g39650D                                          298   2e-94    Brassica napus [oilseed rape]
ref|XP_006407187.1|  hypothetical protein EUTSA_v10020172mg             303   3e-94    Eutrema salsugineum [saltwater cress]
ref|XP_008787870.1|  PREDICTED: uncharacterized protein LOC103705792    304   3e-94    Phoenix dactylifera
gb|KHF98002.1|  hypothetical protein F383_12939                         302   3e-94    Gossypium arboreum [tree cotton]
ref|XP_010939945.1|  PREDICTED: uncharacterized protein LOC105058...    303   4e-94    
ref|XP_010939947.1|  PREDICTED: uncharacterized protein LOC105058...    303   4e-94    Elaeis guineensis
emb|CDY55141.1|  BnaC01g44810D                                          300   6e-94    Brassica napus [oilseed rape]
emb|CBI28086.3|  unnamed protein product                                300   6e-94    Vitis vinifera
tpg|DAA54811.1|  TPA: hypothetical protein ZEAMMB73_098757              286   6e-94    
ref|XP_002882838.1|  kinase family protein                              302   7e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_006297084.1|  hypothetical protein CARUB_v10013087mg             302   7e-94    Capsella rubella
ref|XP_003536792.1|  PREDICTED: uncharacterized protein LOC100783819    301   7e-94    Glycine max [soybeans]
ref|XP_009382978.1|  PREDICTED: uncharacterized protein LOC103970784    303   7e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK38714.1|  hypothetical protein AALP_AA3G150500                    302   8e-94    Arabis alpina [alpine rockcress]
gb|KHN27094.1|  Casein kinase I                                         301   9e-94    Glycine soja [wild soybean]
ref|XP_003556554.1|  PREDICTED: uncharacterized protein LOC100807373    301   1e-93    Glycine max [soybeans]
emb|CDY51730.1|  BnaA01g37130D                                          301   1e-93    Brassica napus [oilseed rape]
gb|KDP33655.1|  hypothetical protein JCGZ_07226                         301   1e-93    Jatropha curcas
ref|XP_006445886.1|  hypothetical protein CICLE_v10014444mg             301   1e-93    Citrus clementina [clementine]
emb|CDX97505.1|  BnaA05g25740D                                          300   1e-93    
ref|XP_010465212.1|  PREDICTED: uncharacterized protein LOC104745616    301   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010500960.1|  PREDICTED: uncharacterized protein LOC104778...    301   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010487127.1|  PREDICTED: serine/threonine-protein kinase S...    301   2e-93    
ref|XP_009146466.1|  PREDICTED: uncharacterized protein LOC103870106    301   2e-93    Brassica rapa
ref|XP_010656334.1|  PREDICTED: uncharacterized protein LOC100254414    301   2e-93    Vitis vinifera
ref|XP_008367866.1|  PREDICTED: casein kinase I                         296   2e-93    
ref|NP_187977.1|  protein kinase family protein                         301   3e-93    Arabidopsis thaliana [mouse-ear cress]
emb|CDX75726.1|  BnaC03g38090D                                          299   3e-93    
ref|XP_008351086.1|  PREDICTED: uncharacterized protein LOC103414488    294   4e-93    
emb|CDX82524.1|  BnaA03g32970D                                          299   5e-93    
ref|XP_009117581.1|  PREDICTED: uncharacterized protein LOC103842673    300   5e-93    Brassica rapa
ref|XP_009135319.1|  PREDICTED: uncharacterized protein LOC103859531    299   5e-93    Brassica rapa
ref|XP_009404157.1|  PREDICTED: uncharacterized protein LOC103987553    300   6e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007024284.1|  Casein kinase I protein isoform 1                  300   6e-93    
gb|ADE76410.1|  unknown                                                 292   6e-93    Picea sitchensis
gb|EMS55588.1|  Casein kinase I-like protein 2                          297   8e-93    Triticum urartu
ref|XP_003552750.1|  PREDICTED: serine/threonine-protein kinase V...    299   8e-93    Glycine max [soybeans]
ref|XP_003532324.1|  PREDICTED: serine/threonine-protein kinase V...    299   8e-93    Glycine max [soybeans]
dbj|BAJ99119.1|  predicted protein                                      293   8e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010249770.1|  PREDICTED: uncharacterized protein LOC104592236    300   8e-93    Nelumbo nucifera [Indian lotus]
ref|XP_006849555.1|  hypothetical protein AMTR_s00024p00176520          299   1e-92    Amborella trichopoda
emb|CBI16476.3|  unnamed protein product                                296   1e-92    Vitis vinifera
ref|XP_009413490.1|  PREDICTED: uncharacterized protein LOC103994778    299   1e-92    
ref|XP_007139114.1|  hypothetical protein PHAVU_008G002500g             298   1e-92    Phaseolus vulgaris [French bean]
ref|XP_003621013.1|  Casein kinase I isoform alpha                      296   1e-92    Medicago truncatula
gb|KHN24964.1|  Casein kinase I isoform alpha                           299   1e-92    Glycine soja [wild soybean]
gb|KHN18151.1|  Casein kinase I like 2                                  293   2e-92    Glycine soja [wild soybean]
ref|XP_010915404.1|  PREDICTED: uncharacterized protein LOC105040538    298   2e-92    Elaeis guineensis
ref|XP_010267167.1|  PREDICTED: uncharacterized protein LOC104604...    298   2e-92    
tpg|DAA54810.1|  TPA: hypothetical protein ZEAMMB73_098757              287   2e-92    
ref|XP_009395055.1|  PREDICTED: uncharacterized protein LOC103980...    298   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395056.1|  PREDICTED: uncharacterized protein LOC103980...    298   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004142151.1|  PREDICTED: uncharacterized protein LOC101213194    298   2e-92    Cucumis sativus [cucumbers]
ref|XP_010047289.1|  PREDICTED: uncharacterized protein LOC104436263    296   2e-92    Eucalyptus grandis [rose gum]
gb|KDO79864.1|  hypothetical protein CISIN_1g005420mg                   293   2e-92    Citrus sinensis [apfelsine]
gb|KJB56821.1|  hypothetical protein B456_009G137100                    298   3e-92    Gossypium raimondii
ref|XP_010249522.1|  PREDICTED: uncharacterized protein LOC104592...    298   3e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010257513.1|  PREDICTED: uncharacterized protein LOC104597586    298   3e-92    Nelumbo nucifera [Indian lotus]
gb|KDP44321.1|  hypothetical protein JCGZ_19188                         298   3e-92    Jatropha curcas
ref|XP_004162011.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    298   3e-92    
ref|XP_008338530.1|  PREDICTED: casein kinase I homolog 2-like          293   3e-92    
ref|XP_010249521.1|  PREDICTED: uncharacterized protein LOC104592...    298   3e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010267169.1|  PREDICTED: uncharacterized protein LOC104604...    298   3e-92    Nelumbo nucifera [Indian lotus]
emb|CBI36074.3|  unnamed protein product                                295   3e-92    Vitis vinifera
emb|CAN69523.1|  hypothetical protein VITISV_040873                     297   3e-92    Vitis vinifera
gb|KJB21848.1|  hypothetical protein B456_004G018000                    298   4e-92    Gossypium raimondii
emb|CDP13154.1|  unnamed protein product                                295   4e-92    Coffea canephora [robusta coffee]
ref|XP_008655737.1|  PREDICTED: uncharacterized protein LOC103634938    286   5e-92    
gb|EMT06030.1|  Casein kinase I-2-like protein                          295   5e-92    
ref|XP_008352012.1|  PREDICTED: uncharacterized protein LOC103415457    296   5e-92    
ref|XP_002531638.1|  casein kinase, putative                            297   6e-92    Ricinus communis
tpg|DAA54809.1|  TPA: hypothetical protein ZEAMMB73_098757              287   6e-92    
gb|ACO87665.1|  protein kinase                                          296   6e-92    Brachypodium sylvaticum
gb|KHG14825.1|  hypothetical protein F383_08945                         297   6e-92    Gossypium arboreum [tree cotton]
ref|XP_002283346.1|  PREDICTED: uncharacterized protein LOC100263956    297   7e-92    Vitis vinifera
ref|XP_008791563.1|  PREDICTED: uncharacterized protein LOC103708420    296   7e-92    Phoenix dactylifera
ref|XP_004491691.1|  PREDICTED: serine/threonine-protein kinase V...    296   7e-92    Cicer arietinum [garbanzo]
ref|XP_002283957.2|  PREDICTED: uncharacterized protein LOC100253221    297   8e-92    Vitis vinifera
emb|CAN77676.1|  hypothetical protein VITISV_013722                     297   9e-92    Vitis vinifera
ref|XP_009406168.1|  PREDICTED: uncharacterized protein LOC103989128    296   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002516524.1|  casein kinase, putative                            295   1e-91    
ref|XP_009388687.1|  PREDICTED: casein kinase I isoform delta-like      293   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006853659.1|  hypothetical protein AMTR_s00056p00104010          296   2e-91    Amborella trichopoda
ref|XP_007024285.1|  Kinase family protein isoform 2                    290   2e-91    
ref|XP_003577056.1|  PREDICTED: uncharacterized protein LOC100836999    294   2e-91    Brachypodium distachyon [annual false brome]
ref|XP_007208054.1|  hypothetical protein PRUPE_ppa002206mg             295   3e-91    Prunus persica
ref|XP_008338507.1|  PREDICTED: uncharacterized protein LOC103401...    295   3e-91    
ref|XP_008338505.1|  PREDICTED: uncharacterized protein LOC103401...    295   3e-91    
ref|XP_008390151.1|  PREDICTED: uncharacterized protein LOC103452441    295   3e-91    
ref|XP_009375296.1|  PREDICTED: uncharacterized protein LOC103964127    295   3e-91    
ref|XP_009364099.1|  PREDICTED: uncharacterized protein LOC103954016    295   3e-91    Pyrus x bretschneideri [bai li]
gb|KJB07481.1|  hypothetical protein B456_001G026300                    289   3e-91    Gossypium raimondii
emb|CBI20566.3|  unnamed protein product                                293   3e-91    Vitis vinifera
ref|XP_011019588.1|  PREDICTED: uncharacterized protein LOC105122...    289   4e-91    Populus euphratica
emb|CDY21505.1|  BnaC03g26920D                                          293   4e-91    Brassica napus [oilseed rape]
ref|XP_008445007.1|  PREDICTED: uncharacterized protein LOC103488176    295   4e-91    Cucumis melo [Oriental melon]
gb|KJB21850.1|  hypothetical protein B456_004G018100                    295   4e-91    Gossypium raimondii
ref|XP_008378069.1|  PREDICTED: uncharacterized protein LOC103441148    294   5e-91    
ref|XP_004294964.1|  PREDICTED: uncharacterized protein LOC101294343    295   5e-91    Fragaria vesca subsp. vesca
gb|KHN10182.1|  Casein kinase I like 2                                  292   5e-91    Glycine soja [wild soybean]
ref|XP_009367436.1|  PREDICTED: uncharacterized protein LOC103957076    294   5e-91    Pyrus x bretschneideri [bai li]
ref|XP_004517304.1|  PREDICTED: uncharacterized protein LOC101495334    292   5e-91    
emb|CDY11509.1|  BnaA09g40750D                                          291   5e-91    Brassica napus [oilseed rape]
ref|XP_010526089.1|  PREDICTED: casein kinase I-like                    292   6e-91    Tarenaya hassleriana [spider flower]
gb|EEC78673.1|  hypothetical protein OsI_18806                          292   6e-91    Oryza sativa Indica Group [Indian rice]
dbj|BAG92829.1|  unnamed protein product                                292   6e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008804603.1|  PREDICTED: negative regulator of sexual conj...    290   6e-91    
gb|AAT44311.1|  putative casein kinase                                  292   6e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010243375.1|  PREDICTED: uncharacterized protein LOC104587456    295   6e-91    Nelumbo nucifera [Indian lotus]
emb|CDX76739.1|  BnaC08g33250D                                          292   7e-91    
ref|XP_009117039.1|  PREDICTED: casein kinase I                         292   7e-91    Brassica rapa
gb|KFK32550.1|  hypothetical protein AALP_AA6G257400                    294   7e-91    Arabis alpina [alpine rockcress]
ref|XP_010093160.1|  Casein kinase I                                    296   7e-91    
ref|XP_002882289.1|  hypothetical protein ARALYDRAFT_340491             281   7e-91    
gb|KDO79859.1|  hypothetical protein CISIN_1g005420mg                   294   8e-91    Citrus sinensis [apfelsine]
ref|XP_004148393.1|  PREDICTED: uncharacterized protein LOC101218249    294   8e-91    
ref|XP_006476018.1|  PREDICTED: uncharacterized protein LOC102627...    294   9e-91    Citrus sinensis [apfelsine]
ref|XP_006450715.1|  hypothetical protein CICLE_v10007635mg             294   9e-91    
ref|XP_010033842.1|  PREDICTED: uncharacterized protein LOC104423081    294   9e-91    
ref|XP_010546534.1|  PREDICTED: uncharacterized protein LOC104818596    294   9e-91    Tarenaya hassleriana [spider flower]
gb|KGN62809.1|  hypothetical protein Csa_2G373520                       294   9e-91    Cucumis sativus [cucumbers]
ref|XP_010925551.1|  PREDICTED: uncharacterized protein LOC105048062    293   9e-91    Elaeis guineensis
ref|XP_006408871.1|  hypothetical protein EUTSA_v10001925mg             293   9e-91    Eutrema salsugineum [saltwater cress]
ref|XP_003526502.1|  PREDICTED: uncharacterized protein LOC100800...    291   9e-91    Glycine max [soybeans]
gb|AES58679.2|  casein kinase I-like protein                            293   9e-91    Medicago truncatula
ref|XP_011081763.1|  PREDICTED: uncharacterized protein LOC105164726    291   1e-90    Sesamum indicum [beniseed]
ref|XP_003523750.1|  PREDICTED: uncharacterized protein LOC100778...    293   1e-90    Glycine max [soybeans]
ref|XP_002272679.2|  PREDICTED: serine/threonine-protein kinase S...    294   1e-90    Vitis vinifera
ref|XP_010102418.1|  Casein kinase I-2-like protein                     294   1e-90    
ref|XP_003523751.1|  PREDICTED: uncharacterized protein LOC100779...    294   1e-90    Glycine max [soybeans]
ref|XP_011037977.1|  PREDICTED: uncharacterized protein LOC105135003    294   1e-90    Populus euphratica
ref|XP_008228435.1|  PREDICTED: uncharacterized protein LOC103327845    294   1e-90    Prunus mume [ume]
ref|XP_002297651.2|  hypothetical protein POPTR_0001s04710g             294   1e-90    Populus trichocarpa [western balsam poplar]
ref|XP_002309535.1|  kinase family protein                              291   1e-90    
gb|KHN39248.1|  Casein kinase I isoform delta-like                      292   2e-90    Glycine soja [wild soybean]
gb|KJB07483.1|  hypothetical protein B456_001G026300                    291   2e-90    Gossypium raimondii
ref|XP_007014774.1|  Casein kinase I protein isoform 1                  297   2e-90    
ref|NP_001054881.2|  Os05g0200500                                       292   2e-90    
ref|XP_010044967.1|  PREDICTED: uncharacterized protein LOC104433...    293   2e-90    Eucalyptus grandis [rose gum]
ref|XP_011025189.1|  PREDICTED: uncharacterized protein LOC105126132    293   2e-90    Populus euphratica
ref|XP_010044966.1|  PREDICTED: uncharacterized protein LOC104433...    293   2e-90    Eucalyptus grandis [rose gum]
ref|XP_004963353.1|  PREDICTED: probable casein kinase I homolog ...    291   2e-90    Setaria italica
ref|XP_007013205.1|  Kinase family protein isoform 1                    292   2e-90    
ref|XP_010924661.1|  PREDICTED: uncharacterized protein LOC105047...    293   2e-90    
ref|XP_010673525.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    294   2e-90    
gb|KDP34168.1|  hypothetical protein JCGZ_07739                         293   2e-90    
ref|XP_008462429.1|  PREDICTED: uncharacterized protein LOC103500783    293   2e-90    
ref|XP_009787105.1|  PREDICTED: uncharacterized protein LOC104235125    293   2e-90    
ref|XP_010924659.1|  PREDICTED: uncharacterized protein LOC105047...    293   2e-90    
emb|CDO97984.1|  unnamed protein product                                290   3e-90    
ref|XP_002979683.1|  hypothetical protein SELMODRAFT_177864             289   3e-90    
ref|XP_011006418.1|  PREDICTED: uncharacterized protein LOC105112417    293   3e-90    
ref|NP_001141429.1|  uncharacterized protein LOC100273539               286   3e-90    
ref|XP_003592802.1|  Casein kinase-like protein                         292   3e-90    
ref|XP_002304015.1|  kinase family protein                              293   3e-90    
ref|XP_002880706.1|  kinase family protein                              292   3e-90    
ref|XP_011458971.1|  PREDICTED: uncharacterized protein LOC101301711    292   3e-90    
ref|XP_011072424.1|  PREDICTED: serine/threonine-protein kinase S...    293   3e-90    
ref|XP_011072423.1|  PREDICTED: serine/threonine-protein kinase S...    293   4e-90    
ref|XP_006644695.1|  PREDICTED: casein kinase I homolog 1-like          290   4e-90    
ref|XP_006583050.1|  PREDICTED: uncharacterized protein LOC100800869    293   4e-90    
dbj|BAD73224.1|  putative serine/threonine protein kinase               281   4e-90    
gb|KJB54778.1|  hypothetical protein B456_009G048800                    289   4e-90    
ref|XP_010472590.1|  PREDICTED: uncharacterized protein LOC104752211    291   5e-90    
ref|XP_011019579.1|  PREDICTED: casein kinase I homolog 1-like is...    290   5e-90    
ref|XP_004960930.1|  PREDICTED: uncharacterized protein LOC101765228    290   5e-90    
ref|XP_008220112.1|  PREDICTED: uncharacterized protein LOC103320244    292   5e-90    
ref|XP_010915613.1|  PREDICTED: uncharacterized protein LOC105040...    291   5e-90    
ref|XP_004141661.1|  PREDICTED: uncharacterized protein LOC101213589    292   5e-90    
ref|NP_973532.1|  protein kinase family protein                         291   5e-90    
ref|XP_002985391.1|  hypothetical protein SELMODRAFT_269002             289   5e-90    
ref|XP_004155952.1|  PREDICTED: uncharacterized protein LOC101230855    292   5e-90    
ref|XP_006426889.1|  hypothetical protein CICLE_v10025028mg             292   5e-90    
ref|XP_010915579.1|  PREDICTED: uncharacterized protein LOC105040...    291   6e-90    
ref|NP_180147.2|  protein kinase family protein                         291   6e-90    
gb|KGN45587.1|  hypothetical protein Csa_7G452910                       292   6e-90    
ref|XP_002324211.2|  hypothetical protein POPTR_0018s08230g             291   6e-90    
ref|XP_009592153.1|  PREDICTED: uncharacterized protein LOC104089043    292   7e-90    
ref|XP_006465683.1|  PREDICTED: uncharacterized protein LOC102607770    292   7e-90    
gb|KJB54779.1|  hypothetical protein B456_009G048800                    289   7e-90    
gb|KJB07478.1|  hypothetical protein B456_001G026300                    290   7e-90    
ref|XP_007225173.1|  hypothetical protein PRUPE_ppa002269mg             291   7e-90    
ref|XP_003531651.1|  PREDICTED: uncharacterized protein LOC100799630    292   8e-90    
emb|CDP08183.1|  unnamed protein product                                292   8e-90    
dbj|BAD87518.1|  putative serine/threonine protein kinase               289   8e-90    
gb|KHG27580.1|  Casein kinase I                                         291   9e-90    
ref|XP_007217013.1|  hypothetical protein PRUPE_ppa002136mg             291   9e-90    
tpg|DAA52911.1|  TPA: hypothetical protein ZEAMMB73_402791              285   9e-90    
ref|XP_010668618.1|  PREDICTED: uncharacterized protein LOC104885660    292   9e-90    
ref|XP_008804602.1|  PREDICTED: uncharacterized protein LOC103717...    291   1e-89    
ref|XP_008804601.1|  PREDICTED: uncharacterized protein LOC103717...    291   1e-89    
ref|XP_009587685.1|  PREDICTED: uncharacterized protein LOC104085378    291   1e-89    
ref|XP_002440770.1|  hypothetical protein SORBIDRAFT_09g006270          289   1e-89    
gb|KHG03332.1|  hypothetical protein F383_28165                         291   1e-89    
ref|XP_010417348.1|  PREDICTED: uncharacterized protein LOC104703...    290   1e-89    
ref|XP_009776610.1|  PREDICTED: uncharacterized protein LOC104226336    291   1e-89    
ref|XP_002515975.1|  casein kinase, putative                            290   2e-89    
ref|XP_009416478.1|  PREDICTED: uncharacterized protein LOC103997068    290   2e-89    
ref|NP_001169571.1|  hypothetical protein                               288   2e-89    
ref|XP_004253105.1|  PREDICTED: uncharacterized protein LOC101244359    290   2e-89    
gb|EEE55368.1|  hypothetical protein OsJ_03423                          288   2e-89    
gb|KHG22911.1|  Casein kinase I                                         288   3e-89    
gb|KJB82582.1|  hypothetical protein B456_013G203000                    290   3e-89    
ref|XP_010062521.1|  PREDICTED: uncharacterized protein LOC104449912    290   3e-89    
gb|EEC71464.1|  hypothetical protein OsI_03705                          289   3e-89    
ref|XP_006342517.1|  PREDICTED: uncharacterized protein LOC102599332    290   3e-89    
ref|XP_006293796.1|  hypothetical protein CARUB_v10022778mg             289   4e-89    
ref|NP_001044224.1|  Os01g0744300                                       290   4e-89    
gb|EYU29288.1|  hypothetical protein MIMGU_mgv1a002190mg                290   4e-89    
gb|KDP40868.1|  hypothetical protein JCGZ_24867                         290   4e-89    
ref|XP_008810650.1|  PREDICTED: uncharacterized protein LOC103722...    289   4e-89    
ref|XP_008810649.1|  PREDICTED: uncharacterized protein LOC103722...    289   5e-89    
ref|XP_004291170.1|  PREDICTED: uncharacterized protein LOC101299149    288   5e-89    
ref|XP_010429582.1|  PREDICTED: uncharacterized protein LOC104714043    289   5e-89    
ref|XP_010417347.1|  PREDICTED: uncharacterized protein LOC104703...    289   6e-89    
ref|XP_008392669.1|  PREDICTED: uncharacterized protein LOC103454855    290   6e-89    
ref|XP_008672449.1|  PREDICTED: uncharacterized protein LOC100273...    286   6e-89    
ref|XP_004497365.1|  PREDICTED: casein kinase I isoform delta-like      289   6e-89    
emb|CDM82151.1|  unnamed protein product                                287   7e-89    
ref|XP_008226475.1|  PREDICTED: protein kinase 3                        289   7e-89    
dbj|BAJ94407.1|  predicted protein                                      286   7e-89    
ref|XP_009349729.1|  PREDICTED: uncharacterized protein LOC103941...    289   7e-89    
ref|XP_008673564.1|  PREDICTED: casein kinase I isoform X2              286   8e-89    
ref|XP_009349728.1|  PREDICTED: uncharacterized protein LOC103941...    289   8e-89    
ref|XP_007137240.1|  hypothetical protein PHAVU_009G111300g             289   8e-89    
dbj|BAK02283.1|  predicted protein                                      286   9e-89    
ref|XP_002303307.2|  hypothetical protein POPTR_0003s04820g             283   1e-88    
ref|XP_002455001.1|  hypothetical protein SORBIDRAFT_03g002790          286   1e-88    
ref|XP_004968538.1|  PREDICTED: casein kinase I-like                    286   1e-88    
ref|XP_009336928.1|  PREDICTED: uncharacterized protein LOC103929445    288   1e-88    
ref|XP_008242613.1|  PREDICTED: uncharacterized protein LOC103340922    288   1e-88    
gb|ADI78885.1|  casein kinase I                                         288   1e-88    
ref|XP_008386593.1|  PREDICTED: uncharacterized protein LOC103449090    288   1e-88    
ref|XP_004510300.1|  PREDICTED: uncharacterized protein LOC101511720    288   1e-88    
ref|XP_009596024.1|  PREDICTED: uncharacterized protein LOC104092197    288   1e-88    
ref|XP_007135639.1|  hypothetical protein PHAVU_010G145900g             288   2e-88    
gb|KDO50862.1|  hypothetical protein CISIN_1g005947mg                   287   2e-88    
ref|XP_008673563.1|  PREDICTED: uncharacterized protein LOC103649...    286   2e-88    
ref|XP_003565003.1|  PREDICTED: uncharacterized protein LOC100839189    286   2e-88    
ref|XP_003568762.1|  PREDICTED: uncharacterized protein LOC100825718    286   2e-88    
ref|XP_008794114.1|  PREDICTED: uncharacterized protein LOC103710237    287   2e-88    
gb|EMT25395.1|  Casein kinase I-2-like protein                          285   2e-88    
ref|XP_009801165.1|  PREDICTED: uncharacterized protein LOC104246947    288   2e-88    
ref|XP_007012164.1|  Casein kinase I protein                            288   2e-88    
ref|XP_006451129.1|  hypothetical protein CICLE_v10007666mg             287   3e-88    
ref|XP_004969923.1|  PREDICTED: uncharacterized protein LOC101760429    287   3e-88    
dbj|BAJ99167.1|  predicted protein                                      286   3e-88    
gb|KJB27133.1|  hypothetical protein B456_004G279600                    286   3e-88    
gb|KHG18897.1|  Casein kinase I                                         288   4e-88    
ref|XP_007203777.1|  hypothetical protein PRUPE_ppa002378mg             286   4e-88    
ref|XP_010098134.1|  Casein kinase I-2-like protein                     287   5e-88    
gb|KJB70401.1|  hypothetical protein B456_011G072100                    287   6e-88    
ref|XP_004228598.1|  PREDICTED: casein kinase I isoform gamma-3         286   8e-88    
gb|ABR25333.1|  protein kinase family protein                           268   8e-88    
gb|EMS66552.1|  Casein kinase I-like protein 2                          283   9e-88    
ref|XP_011003700.1|  PREDICTED: uncharacterized protein LOC105110375    286   9e-88    
emb|CDM84047.1|  unnamed protein product                                285   9e-88    
gb|KEH36077.1|  casein kinase I-like protein                            286   1e-87    
ref|XP_006354169.1|  PREDICTED: casein kinase I isoform gamma-3-like    286   1e-87    
ref|XP_003569789.1|  PREDICTED: serine/threonine-protein kinase VRK1    285   1e-87    
gb|KJB82881.1|  hypothetical protein B456_013G219500                    283   1e-87    
ref|XP_011092199.1|  PREDICTED: uncharacterized protein LOC105172435    286   1e-87    
gb|EMT27276.1|  Casein kinase I-2-like protein                          285   2e-87    
ref|XP_005850218.1|  hypothetical protein CHLNCDRAFT_34546              283   2e-87    
gb|EYU21509.1|  hypothetical protein MIMGU_mgv1a002137mg                285   2e-87    
ref|XP_004252842.1|  PREDICTED: casein kinase I-like                    283   3e-87    
gb|EPS63371.1|  hypothetical protein M569_11412                         272   3e-87    
ref|XP_006643875.1|  PREDICTED: casein kinase I homolog 2-like          283   4e-87    
ref|XP_004302863.1|  PREDICTED: uncharacterized protein LOC101305860    284   5e-87    
ref|XP_002298239.1|  hypothetical protein POPTR_0001s18990g             284   6e-87    
ref|XP_006340257.1|  PREDICTED: uncharacterized protein LOC102583902    284   6e-87    
ref|XP_004251171.2|  PREDICTED: uncharacterized protein LOC101245026    284   6e-87    
ref|XP_002884419.1|  hypothetical protein ARALYDRAFT_340552             271   7e-87    
ref|XP_009347166.1|  PREDICTED: uncharacterized protein LOC103938...    283   8e-87    
ref|XP_009347165.1|  PREDICTED: uncharacterized protein LOC103938...    283   8e-87    
ref|NP_001042306.1|  Os01g0198200                                       282   9e-87    
dbj|BAD73223.1|  putative serine/threonine protein kinase               282   1e-86    
ref|XP_009353558.1|  PREDICTED: uncharacterized protein LOC103944824    283   1e-86    
gb|EEE54054.1|  hypothetical protein OsJ_00747                          282   1e-86    
gb|EEC70115.1|  hypothetical protein OsI_00774                          281   2e-86    
ref|XP_002514324.1|  casein kinase, putative                            281   3e-86    
ref|XP_011013372.1|  PREDICTED: uncharacterized protein LOC105117...    276   5e-86    
ref|XP_007161527.1|  hypothetical protein PHAVU_001G076900g             281   5e-86    
ref|NP_187043.1|  protein kinase-related protein                        269   6e-86    
ref|XP_011013369.1|  PREDICTED: uncharacterized protein LOC105117...    276   7e-86    
ref|XP_007013209.1|  Kinase family protein isoform 5                    275   9e-86    
gb|EMT06466.1|  Casein kinase I isoform alpha                           281   9e-86    
ref|XP_008337441.1|  PREDICTED: uncharacterized protein LOC103400...    280   1e-85    
ref|XP_008337442.1|  PREDICTED: uncharacterized protein LOC103400...    280   1e-85    
ref|XP_008380865.1|  PREDICTED: uncharacterized protein LOC103443751    281   1e-85    
ref|XP_003057011.1|  Serine/Threonine protein kinase                    281   1e-85    
gb|EMS55265.1|  Casein kinase I isoform alpha                           280   1e-85    
ref|XP_002954481.1|  hypothetical protein VOLCADRAFT_76324              278   2e-85    
ref|XP_001701465.1|  MUT9-related serine/threonine protein kinase       278   2e-85    
ref|XP_007014775.1|  Kinase family protein isoform 2                    280   2e-85    
ref|XP_005649643.1|  MUT9-related serine/threonine protein kinase       275   3e-84    
ref|XP_002502422.1|  predicted protein                                  275   3e-84    
ref|XP_011013374.1|  PREDICTED: uncharacterized protein LOC105117...    276   5e-84    
ref|XP_011013373.1|  PREDICTED: uncharacterized protein LOC105117...    276   6e-84    
ref|XP_003588428.1|  Casein kinase I isoform alpha                      275   2e-83    
gb|KJB54170.1|  hypothetical protein B456_009G024100                    273   3e-83    
gb|KHG22741.1|  Casein kinase I isoform delta                           272   4e-83    
emb|CEG01140.1|  Serine/threonine-protein kinase, active site           270   1e-82    
gb|EMS54400.1|  Casein kinase I-like protein 2                          274   1e-82    
ref|XP_009781261.1|  PREDICTED: casein kinase I isoform gamma-3         272   1e-82    
ref|XP_009625624.1|  PREDICTED: casein kinase I isoform gamma-3-like    272   2e-82    
ref|XP_003075213.1|  protein kinase family protein (ISS)                271   2e-82    
gb|KJB54173.1|  hypothetical protein B456_009G024100                    271   3e-82    
ref|XP_001416335.1|  predicted protein                                  268   6e-82    
ref|XP_008655345.1|  PREDICTED: hypothetical protein isoform X3         270   6e-82    
ref|XP_008655344.1|  PREDICTED: hypothetical protein isoform X2         270   7e-82    
ref|XP_006299519.1|  hypothetical protein CARUB_v10015691mg             256   4e-81    
ref|XP_007514232.1|  predicted protein                                  263   1e-79    
ref|XP_010690200.1|  PREDICTED: casein kinase I isoform gamma-2-like    262   3e-79    
ref|XP_010088832.1|  Casein kinase I isoform alpha                      264   4e-79    
gb|KJB46017.1|  hypothetical protein B456_007G343500                    264   5e-79    
ref|XP_007014776.1|  Kinase family protein isoform 3                    262   1e-78    
gb|KDD72198.1|  hypothetical protein H632_c3713p0                       248   5e-78    
gb|EMT12651.1|  Casein kinase I-2-like protein                          262   5e-78    
ref|XP_011396021.1|  Casein kinase I isoform delta-like protein         256   7e-78    
ref|XP_004963352.1|  PREDICTED: probable casein kinase I homolog ...    256   3e-77    
ref|XP_008655343.1|  PREDICTED: hypothetical protein isoform X1         256   2e-76    
ref|XP_010915572.1|  PREDICTED: uncharacterized protein LOC105040...    257   2e-76    
ref|XP_010915562.1|  PREDICTED: uncharacterized protein LOC105040...    257   2e-76    
ref|XP_010915554.1|  PREDICTED: uncharacterized protein LOC105040...    257   4e-76    
ref|XP_010915546.1|  PREDICTED: uncharacterized protein LOC105040...    257   4e-76    
gb|AET01488.2|  casein kinase I-like protein                            254   6e-76    
gb|KJB07477.1|  hypothetical protein B456_001G026300                    254   8e-76    
ref|XP_004309533.2|  PREDICTED: casein kinase I isoform delta-A-like    252   1e-75    
ref|XP_003627012.1|  Casein kinase-like protein                         254   1e-74    
gb|KDD76924.1|  hypothetical protein H632_c65p1                         249   3e-74    
tpg|DAA56574.1|  TPA: hypothetical protein ZEAMMB73_926529              243   6e-74    
emb|CAN74986.1|  hypothetical protein VITISV_008771                     256   1e-73    
ref|XP_002443446.1|  hypothetical protein SORBIDRAFT_08g019600          248   2e-73    
ref|XP_010229461.1|  PREDICTED: casein kinase I isoform alpha-like      244   9e-73    
gb|KFK37829.1|  hypothetical protein AALP_AA3G034600                    238   1e-72    
gb|AFW85111.1|  hypothetical protein ZEAMMB73_338907                    236   3e-72    
gb|KJB54177.1|  hypothetical protein B456_009G024100                    241   5e-71    
gb|EPS62497.1|  hypothetical protein M569_12290                         239   8e-71    
ref|XP_005850945.1|  hypothetical protein CHLNCDRAFT_140695             233   2e-70    
ref|XP_011400089.1|  Casein kinase I-like protein 2                     228   6e-67    
ref|XP_002958584.1|  histone kinase                                     228   8e-66    
ref|XP_001695320.1|  serine/threonine protein kinase, transcripti...    227   1e-65    
ref|XP_004245392.1|  PREDICTED: uncharacterized protein LOC101249392    226   2e-65    
gb|EMT07061.1|  Casein kinase I-2-like protein                          226   4e-64    
tpg|DAA35739.1|  TPA: putative homeodomain-like transcription fac...    223   2e-63    
ref|XP_006574072.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    217   1e-62    
ref|XP_008452134.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    206   2e-62    
gb|AAP80674.1|  casein kinase-like protein                              202   4e-62    
gb|EMS61861.1|  Casein kinase I isoform delta-like protein              217   2e-61    
gb|AEO89321.1|  serine/threonine protein kinase                         214   1e-60    
gb|EMT25758.1|  Casein kinase I isoform delta-like protein              212   2e-59    
gb|EMT21083.1|  Casein kinase I-2-like protein                          207   2e-58    
gb|AIS72786.1|  casein kinase-like protein                              192   3e-58    
ref|XP_010103948.1|  hypothetical protein L484_020200                   192   2e-56    
ref|XP_002458472.1|  hypothetical protein SORBIDRAFT_03g034330          184   4e-55    
ref|XP_010090279.1|  hypothetical protein L484_001310                   190   3e-53    
ref|XP_005648473.1|  kinase-like protein                                193   5e-53    
ref|XP_010109262.1|  hypothetical protein L484_014856                   183   3e-51    
gb|EYU34156.1|  hypothetical protein MIMGU_mgv1a003255mg                186   4e-51    
gb|KIY93350.1|  hypothetical protein MNEG_14612                         170   8e-50    
ref|XP_010090282.1|  hypothetical protein L484_001313                   176   8e-50    
gb|AEW08952.1|  hypothetical protein CL2426Contig1_01                   167   9e-49    



>gb|AAM91528.1| putative casein kinase [Arabidopsis thaliana]
Length=303

 Score =   328 bits (842),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFK
Sbjct  127  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFK  186

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  187  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  246

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  247  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  303



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score =   339 bits (869),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 171/177 (97%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVYDLS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  532  QVYDLSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  592  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  652  MAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV +L  ++  +  I 
Sbjct  488  YNVADSRLQQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLHKDWIM  547

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  548  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  604

Query  257  SI  252
            S+
Sbjct  605  SM  606



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score =   339 bits (869),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 172/177 (97%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  529  QVYELSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  588

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  589  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  648

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  649  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score =   339 bits (869),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 171/177 (97%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  528  QVYELSAVFLHKDWIMEQWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  588  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAF+LSIPRRKMMDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  648  MAATADQAAFVLSIPRRKMMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  704



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   339 bits (869),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 172/177 (97%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  533  QVYELSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  592

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  593  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  652

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  653  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  489  YNVADSRLRQHVDKGNEDGLYISCVASATNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  548

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  549  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  605

Query  257  SI  252
            S+
Sbjct  606  SM  607



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score =   339 bits (869),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 171/177 (97%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVYDLS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  532  QVYDLSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  592  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  652  MAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV +L  ++  +  I 
Sbjct  488  YNVADSRLQQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLHKDWIM  547

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  548  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  604

Query  257  SI  252
            S+
Sbjct  605  SM  606



>gb|KDO55049.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=537

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS++FLHKDWIM QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  361  QVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFK  420

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  421  WINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  480

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  481  MAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  537



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  538  QVYELSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  597

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  598  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  657

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  658  MAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  494  YNVADSRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  553

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  554  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  610

Query  257  SI  252
            S+
Sbjct  611  SM  612



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  538  QVYELSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  597

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  598  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  657

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  658  MAATADQAAFILSVPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  494  YNVADSRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  553

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  554  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  610

Query  257  SI  252
            S+
Sbjct  611  SM  612



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score =   336 bits (861),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  532  QVYELSSVFLHKDWIMEQWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT 
Sbjct  592  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITC  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  652  MAATADQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score =   336 bits (861),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  532  QVYELSSVFLHKDWIMEQWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT 
Sbjct  592  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITC  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  652  MAATADQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score =   336 bits (861),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKNFYISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  529  QVYELSAVFLHKDWIMEQWEKNFYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFK  588

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG+RWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  589  WINKKWKEGFHVTSMTTAGNRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITS  648

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  649  MAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score =   336 bits (862),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  566  QVYELSSVFLHKDWIMEQWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  625

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT 
Sbjct  626  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITC  685

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  686  MAATADQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  742


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  522  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLHKDWIM  581

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  582  EQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  638

Query  257  SI  252
            S+
Sbjct  639  SM  640



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  529  QVYELSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  588

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  589  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITS  648

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  649  MAATGDQAAFILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>gb|AAO41895.1| putative casein kinase [Arabidopsis thaliana]
Length=307

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAG+ NG+SLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  131  QVYELSTVFLHKDWIMEQWEKNYYISSIAGSDNGNSLVVMSKGTSYTQQSYKVSDSFPFK  190

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  191  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITS  250

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  251  MAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  307



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score =   335 bits (858),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS++FLHKDWIM QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  528  QVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  588  WINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  648  MAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  704



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score =   335 bits (858),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGAANGSSLV+MSKGTPYTQQSYKVSESFPFK
Sbjct  530  QVYELSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVIMSKGTPYTQQSYKVSESFPFK  589

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRIT+
Sbjct  590  WINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITA  649

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQ AFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  650  MAATADQGAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  706


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  486  YNVADSRLRQHVEKGNEDGLYISCVASASNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  545

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  546  EQWEKNYYISSIAGAANGSSLVI---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  602

Query  257  SI  252
            S+
Sbjct  603  SM  604



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score =   335 bits (858),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS++FLHKDWIM QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  532  QVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  592  WINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+PRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  652  MAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score =   335 bits (858),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  544  QVYELSTVFLHKDWIMEQWEKNYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFK  603

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG+RITS
Sbjct  604  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGFRITS  663

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  664  MAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  720



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score =   334 bits (856),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+ FLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  533  QVYELSAAFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  592

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGY+EQVVELDFLYPSEGIHRRWE G+RITS
Sbjct  593  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGGFRITS  652

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  653  MAATADQAAFILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAFLH-KDWI  547

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  260  ASI  252
             S+
Sbjct  605  TSM  607



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score =   333 bits (855),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVYDLS+VFLHKDWIM QWEKN+YISSIAGA N SSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  529  QVYDLSTVFLHKDWIMEQWEKNYYISSIAGANNASSLVVMSKGTPYTQQSYKVSESFPFK  588

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  589  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITS  648

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKMMDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  649  MAATADQAAFILSIPKRKMMDETQETLRTSAFPSAHVKEKWAKNLYIASICYGRTVC  705



>gb|AAF00624.1|AC009540_1 unknown protein, 5' partial [Arabidopsis thaliana]
Length=494

 Score =   327 bits (838),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFK
Sbjct  318  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFK  377

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  378  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  437

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  438  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  494



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA+NGSSLVVMSKGTP+TQQSYKVSESFPFK
Sbjct  529  QVYELSAVFLHKDWIMEQWEKNYYISSIAGASNGSSLVVMSKGTPFTQQSYKVSESFPFK  588

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  589  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITS  648

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  649  MAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+ FLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  533  QVYELSAAFLHKDWIMEQWEKNYYISSIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFK  592

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG+RWGVVMSRNAGY+EQVVELDFLYPSEGIHRRWE G+RITS
Sbjct  593  WINKKWKEGFHVTSMTTAGNRWGVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGGFRITS  652

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIPRRKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  653  MAATADQAAFILSIPRRKMIDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAFLH-KDWI  547

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  260  ASI  252
             S+
Sbjct  605  TSM  607



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  531  QVYELSTVFLHKDWIMEQWEKNFYISSIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG RWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  591  WINKKWKEGFHVTSMTTAGIRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  651  MAATTDQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+++   + ++K  ++G  ++S+ +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  487  YNVADTRLSQHVDKGNEDGLFISSVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  546

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  547  EQWEKNFYISSIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  603

Query  257  SI  252
            S+
Sbjct  604  SM  605



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+ FLHKDWIM QWEKN+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  531  QVYELSAFFLHKDWIMEQWEKNYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG+RITS
Sbjct  591  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGFRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKM+DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  651  MAATADQAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  707



>emb|CBI29940.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   329 bits (843),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  417  QVYELSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  476

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GY++QVVELDFLYPSEGIHRRWE GYRITS
Sbjct  477  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYTDQVVELDFLYPSEGIHRRWECGYRITS  536

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIP+RKMMDETQETLRTSAFPSTHVKEKWSKNLYIA+ICYGRTVC
Sbjct  537  MAATNDQAAFILSIPKRKMMDETQETLRTSAFPSTHVKEKWSKNLYIAAICYGRTVC  593


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G H++ + ++ + W ++M    GYS QV EL  ++  +  I 
Sbjct  373  YNVADSRLPQHVEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLHKDWIM  432

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  433  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  489

Query  257  SI  252
            S+
Sbjct  490  SM  491



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score =   332 bits (850),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+ FLHKDWIM QWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  530  QVYELSTFFLHKDWIMEQWEKNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  589

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGY+EQVVELDFLYPSEGIH+RWE+GYRITS
Sbjct  590  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYAEQVVELDFLYPSEGIHKRWENGYRITS  649

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  650  MAATADQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  706



>gb|ADE75678.1| unknown [Picea sitchensis]
Length=260

 Score =   317 bits (812),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVYDLS+VFLHKDWIM QWEKNFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  84   QVYDLSAVFLHKDWIMEQWEKNFYISAIAGATNGSSLVVMSKGTPYTQQSYKVSDSFPFK  143

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WI+KKWKEGF+VTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWE+GYRIT+
Sbjct  144  WISKKWKEGFYVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENGYRITA  203

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILS+P+RK+ DETQETLRTSAFPSTHVKEKWSKNLYIA++CYGRTV
Sbjct  204  TAATCDQAAFILSVPKRKLTDETQETLRTSAFPSTHVKEKWSKNLYIAAVCYGRTV  259



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score =   331 bits (848),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  531  QVYELSTVFLHKDWIMEQWEKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG RWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  591  WINKKWKEGFHVTSMTTAGIRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  651  MAATTDQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICHGRTVC  707



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWE NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  531  QVYELSTVFLHKDWIMEQWENNFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG+RWGVVMSRNAG+S+QVVELDF+YPSEGIHRRWESGYRITS
Sbjct  591  WINKKWKEGFHVTSMTTAGNRWGVVMSRNAGFSDQVVELDFVYPSEGIHRRWESGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  651  MAATADQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWE+N+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSE+FPFK
Sbjct  526  QVYELSAVFLHKDWIMEQWERNYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSEAFPFK  585

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  586  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITS  645

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  646  MAATADQAAFILSIPKRKVMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  702



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/176 (95%), Positives = 173/176 (98%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVYDLS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  538  QVYDLSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  597

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  598  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  657

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV
Sbjct  658  TAATHDQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  713



>ref|NP_187044.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana]
 gb|AEE74014.1| protein kinase family protein [Arabidopsis thaliana]
Length=701

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFK
Sbjct  525  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFK  584

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  585  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  644

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  645  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701



>ref|XP_006297091.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
 gb|EOA29989.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
Length=701

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFK
Sbjct  525  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFK  584

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  585  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  644

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  645  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  532  QVYELSAVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GY++QVVELDFLYPSEGIHRRWE GYRITS
Sbjct  592  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYTDQVVELDFLYPSEGIHRRWECGYRITS  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIP+RKMMDETQETLRTSAFPSTHVKEKWSKNLYIA+ICYGRTVC
Sbjct  652  MAATNDQAAFILSIPKRKMMDETQETLRTSAFPSTHVKEKWSKNLYIAAICYGRTVC  708


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G H++ + ++ + W ++M    GYS QV EL  ++  +  I 
Sbjct  488  YNVADSRLPQHVEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLHKDWIM  547

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  548  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  604

Query  257  SI  252
            S+
Sbjct  605  SM  606



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  527  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFK  586

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE GYRITS
Sbjct  587  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWEGGYRITS  646

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  647  MAATADQAAFILSIPKRKMLDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  703



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  528  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE GYRITS
Sbjct  588  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWEGGYRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  648  MAATADQAAFILSIPKRKMLDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  704



>ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=702

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFK
Sbjct  526  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFK  585

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  586  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  645

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  646  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  702


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  482  YNVADSRLAQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLHKDWIM  541

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  542  EQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  598

Query  257  SI  252
            S+
Sbjct  599  SM  600



>ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca 
subsp. vesca]
Length=692

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 175/177 (99%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QW+KNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  516  QVYELSAVFLHKDWIMEQWDKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  575

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  576  WINKKWKEGFHVTSMTTAGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITS  635

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT+DQAAFILSIP+RK+MDETQETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  636  MAATSDQAAFILSIPKRKLMDETQETLRTSAFPSSHVKEKWSKNLYIASICFGRTVC  692


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++S+ +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  472  YNVADSRLRQHVDKGNEDGLYISSVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  531

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +W+  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  532  EQWDKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  588

Query  257  SI  252
            S+
Sbjct  589  SM  590



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWE+N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  530  QVYELSAVFLHKDWIMEQWERNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  589

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  590  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITS  649

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  650  MAATVDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706



>emb|CDY29971.1| BnaC01g40370D [Brassica napus]
Length=703

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  527  QVYELSTVFLHKDWIMEQWEKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFK  586

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITS
Sbjct  587  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITS  646

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  647  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  703


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  483  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  542

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  543  EQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  599

Query  257  SI  252
            S+
Sbjct  600  SM  601



>ref|XP_010463863.1| PREDICTED: uncharacterized protein LOC104744499 [Camelina sativa]
Length=701

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFK
Sbjct  525  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFK  584

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  585  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITS  644

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  645  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>ref|XP_010516062.1| PREDICTED: uncharacterized protein LOC104791759 isoform X1 [Camelina 
sativa]
Length=700

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFK
Sbjct  524  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFK  583

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  584  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITS  643

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  644  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  700


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  480  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  538

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  539  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  595

Query  260  ASI  252
             S+
Sbjct  596  TSM  598



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  533  QVYELSPAFLHKDWIMEQWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFK  592

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  593  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENGYRITS  652

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  653  MAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  709


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGIEDGLYISCVASAANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  547

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  260  ASI  252
             S+
Sbjct  605  TSM  607



>ref|XP_010485760.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485761.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485762.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
Length=701

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFK
Sbjct  525  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFK  584

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  585  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITS  644

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  645  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLHKDWIM  540

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  541  EQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  597

Query  257  SI  252
            S+
Sbjct  598  SM  599



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score =   328 bits (842),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  525  QVYELSTVFLHKDWIMEQWEKNYYISSIAGSNNGSSLVVMSKGTPYTQQSYKVSDSFPFK  584

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS
Sbjct  585  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITS  644

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  645  MAATADQAALILSIPKRKISDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC  701


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y VS++   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  481  YNVSDTRLHQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  540

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  541  EQWEKNYYISSIAGSNNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  597

Query  257  SI  252
            S+
Sbjct  598  SM  599



>emb|CDY21155.1| BnaA01g33860D [Brassica napus]
Length=704

 Score =   328 bits (841),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKNFYISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  528  QVYELSTVFLHKDWIMEQWEKNFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITS
Sbjct  588  WINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  648  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  484  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  543

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  544  EQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  600

Query  257  SI  252
            S+
Sbjct  601  SM  602



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS++FLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  530  QVYELSTIFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  589

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTT+GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  590  WINKKWKEGFHVTSMTTSGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITS  649

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  650  MAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score =   328 bits (840),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  532  QVYELSPAFLHKDWIMEQWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+ YRITS
Sbjct  592  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENNYRITS  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  652  MAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADNRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>emb|CDY42890.1| BnaC05g47610D [Brassica napus]
Length=700

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  524  QVYELSTVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFK  583

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITS
Sbjct  584  WINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITS  643

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTH+KEKW+KNLYIASICYGRTVC
Sbjct  644  MAATADQAALILSIPKRKLTDETQETLRTSAFPSTHIKEKWAKNLYIASICYGRTVC  700


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  480  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  539

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  540  EQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  596

Query  257  SI  252
            S+
Sbjct  597  SM  598



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFK
Sbjct  530  QVYELSTVFLHKDWIMEQWEKNYYISSIAGATNGSSLVVMSKGTPYTQQSYKLSESFPFK  589

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGS WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  590  WINKKWKEGFHVTSMTTAGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITS  649

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAF+LSIP+RKMMDETQETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTVC
Sbjct  650  MAATADQAAFVLSIPKRKMMDETQETLRTSAFPSTHVKEKWAKNLYLASVCYGRTVC  706


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 68/130 (52%), Gaps = 10/130 (8%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  486  YNVADSRLRQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  545

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  546  EQWEKNYYISSIAGATNGSSLVV---MSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVT  602

Query  257  SI-----CYG  243
            S+     C+G
Sbjct  603  SMTTAGSCWG  612



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFK
Sbjct  531  QVYELSTVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKLSESFPFK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGS WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  591  WINKKWKEGFHVTSMTTAGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKMMDETQETLRTSAFPSTHVK+KW+KNLY+ASICYGRTVC
Sbjct  651  MAATADQAAFILSIPKRKMMDETQETLRTSAFPSTHVKDKWAKNLYLASICYGRTVC  707



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFK
Sbjct  530  QVYELSTVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKLSESFPFK  589

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGS WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  590  WINKKWKEGFHVTSMTTAGSCWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITS  649

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKMMDETQETLRTSAFPSTHVK+KW+KNLY+ASICYGRTVC
Sbjct  650  MAATADQAAFILSIPKRKMMDETQETLRTSAFPSTHVKDKWAKNLYLASICYGRTVC  706



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWE+N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  530  QVYELSAVFLHKDWIMEQWERNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  589

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTA SRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  590  WINKKWKEGFHVTSMTTAASRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITS  649

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  650  MAATVDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  486  YNVADSRLHQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  545

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  546  EQWERNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  602

Query  257  SI  252
            S+
Sbjct  603  SM  604



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  532  QVYELSPAFLHKDWIMEQWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+ YRITS
Sbjct  592  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENNYRITS  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  652  MAATNDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADNRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score =   327 bits (838),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  531  QVYELSTVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTT+GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  591  WINKKWKEGFHVTSMTTSGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWENGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  651  MAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTVC  707



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score =   327 bits (838),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  530  QVYELSTVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  589

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTT+GSRWGVVMSRN+G+S+QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  590  WINKKWKEGFHVTSMTTSGSRWGVVMSRNSGFSDQVVELDFLYPSEGIHRRWENGYRITS  649

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAFILSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  650  MAATGDQAAFILSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTVC  706



>ref|XP_009130401.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130402.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130403.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
Length=695

 Score =   326 bits (836),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  519  QVYELSTVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFK  578

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITS
Sbjct  579  WINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITS  638

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  639  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC  695


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  475  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  534

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  535  EQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  591

Query  257  SI  252
            S+
Sbjct  592  SM  593



>ref|XP_009102089.1| PREDICTED: uncharacterized protein LOC103828226 [Brassica rapa]
Length=704

 Score =   326 bits (836),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKNFYISSIAGA NGSS VVMSKGTPYTQQSYKVS+SFPFK
Sbjct  528  QVYELSTVFLHKDWIMEQWEKNFYISSIAGANNGSSFVVMSKGTPYTQQSYKVSDSFPFK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITS
Sbjct  588  WINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  648  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  484  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  543

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  + I+S+A   + ++F++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  544  EQWEKNFYISSIAGANNGSSFVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  600

Query  257  SI  252
            S+
Sbjct  601  SM  602



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score =   326 bits (835),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  532  QVYELSLAFLHKDWIMEQWEKNYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYS+QVVE+DFLYPSEGIHRRWE+GYRITS
Sbjct  592  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSDQVVEIDFLYPSEGIHRRWENGYRITS  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT+DQAAFILSIP+RK++DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  652  MAATSDQAAFILSIPKRKLLDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  708


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/122 (23%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   +  +  I 
Sbjct  488  YNVADTRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSLAFLHKDWIM  547

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  548  EQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  604

Query  257  SI  252
            S+
Sbjct  605  SM  606



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score =   326 bits (835),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 164/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVYDLS+VFLHKDWIM QWEKN+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  532  QVYDLSTVFLHKDWIMEQWEKNYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS+QVVELDFLYPSEGIH+RWESGYRITS
Sbjct  592  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSDQVVELDFLYPSEGIHKRWESGYRITS  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV
Sbjct  652  TAATVDQAAFILSIPKRKLMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  707



>ref|XP_009413883.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413884.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWEKN+YIS+IAG  NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  538  QVYELSPIFLHKDWIMEQWEKNYYISAIAGTTNGSSLVVMSKGTPYTQQSYKVSESFPFK  597

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG RWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  598  WINKKWKEGFHVTSMTTAGGRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITS  657

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  658  TAATPDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  714



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score =   323 bits (829),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QV++LS+VFLHKDWIM QWEKNFYISSIAGA NG+SLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  537  QVWELSNVFLHKDWIMEQWEKNFYISSIAGATNGASLVVMSKGTPYTQQSYKVSDSFPFK  596

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTA SRWGVVMSRNAG+++QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  597  WINKKWKEGFHVTSMTTAASRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWESGYRITS  656

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAF+LSIP+RK MDETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  657  MAATPDQAAFVLSIPKRKTMDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  713



>ref|XP_006400366.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
 gb|ESQ41819.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
Length=695

 Score =   323 bits (828),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  519  QVYELSTVFLHKDWIMEQWEKNYYISSIAGADNGSSLVVMSKGTSYTQQSYKVSDSFPFK  578

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+G+SEQVVELDFLYPS+GIHRRWESGYRITS
Sbjct  579  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSEQVVELDFLYPSDGIHRRWESGYRITS  638

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  639  MAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  695



>gb|ABF99312.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=522

 Score =   318 bits (814),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  346  QVYELSQVFLHKDWIMEQWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYK  405

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  406  WINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITS  465

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  466  TAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  522



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score =   323 bits (828),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWEKN+YIS+IAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  542  QVYELSPMFLHKDWIMEQWEKNYYISAIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFK  601

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVT MTTAGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  602  WINKKWKEGFHVTCMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWENGYRITS  661

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  662  TAATPDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  718



>ref|XP_010516137.1| PREDICTED: uncharacterized protein LOC104791759 isoform X2 [Camelina 
sativa]
 ref|XP_010516215.1| PREDICTED: uncharacterized protein LOC104791759 isoform X3 [Camelina 
sativa]
Length=699

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 172/177 (97%), Gaps = 1/177 (1%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFK
Sbjct  524  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFK  583

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  584  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITS  643

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK KW+KNLYIASICYGRTVC
Sbjct  644  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVK-KWAKNLYIASICYGRTVC  699


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  480  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  538

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  539  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  595

Query  260  ASI  252
             S+
Sbjct  596  TSM  598



>ref|NP_197320.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AED92517.1| protein kinase [Arabidopsis thaliana]
Length=691

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAG+ NG+SLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  515  QVYELSTVFLHKDWIMEQWEKNYYISSIAGSDNGNSLVVMSKGTSYTQQSYKVSDSFPFK  574

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  575  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITS  634

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  635  MAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  691



>ref|XP_010485763.1| PREDICTED: uncharacterized protein LOC104764028 isoform X2 [Camelina 
sativa]
Length=700

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 172/177 (97%), Gaps = 1/177 (1%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSSVFLHKDWIM QWEKN+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFK
Sbjct  525  QVYELSSVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFK  584

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  585  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITS  644

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK KW+KNLYIASICYGRTVC
Sbjct  645  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVK-KWAKNLYIASICYGRTVC  700


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLHKDWIM  540

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  541  EQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  597

Query  257  SI  252
            S+
Sbjct  598  SM  599



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score =   323 bits (827),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWEKN+YIS+IAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  542  QVYELSPMFLHKDWIMEQWEKNYYISAIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  601

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVT MTTAGSRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  602  WINKKWKEGFHVTCMTTAGSRWGVVMSRNSGYSDQVVELDFLYPSEGIHRRWENGYRITS  661

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  662  TAATPDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  718



>ref|XP_010424160.1| PREDICTED: uncharacterized protein LOC104709208 [Camelina sativa]
Length=647

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFK
Sbjct  471  QVYELSTVFLHKDWIMEQWEKNYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFK  530

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  531  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITS  590

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  591  MAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  647



>ref|XP_010492820.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
 ref|XP_010492821.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
Length=692

 Score =   322 bits (824),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFK
Sbjct  516  QVYELSTVFLHKDWIMEQWEKNYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFK  575

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  576  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITS  635

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  636  MAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>ref|XP_009418951.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418952.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=716

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWEKN+YIS++AGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  540  QVYELSPMFLHKDWIMEQWEKNYYISAVAGATNGSSLVVMSKGTPYTQQSYKVSESFPFK  599

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYS+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  600  WINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITS  659

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILS+P+RK+MDETQETLRTS FPS HVK+KW+KNLYIASICYGRTVC
Sbjct  660  TAATPDQAAFILSVPKRKLMDETQETLRTSTFPSNHVKDKWAKNLYIASICYGRTVC  716



>emb|CDY38493.1| BnaA10g16650D [Brassica napus]
Length=690

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  514  QVYELSKVFLHKDWIMEQWEKNYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFK  573

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  574  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITS  633

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  634  MAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  690



>emb|CDY25451.1| BnaC09g39660D [Brassica napus]
Length=690

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  514  QVYELSKVFLHKDWIMEQWEKNYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFK  573

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  574  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITS  633

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  634  MAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  690



>gb|EEC71557.1| hypothetical protein OsI_03913 [Oryza sativa Indica Group]
Length=647

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  471  QVYELSPIFLHKDWIMEQWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFK  530

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  531  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITS  590

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  591  TAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  646



>ref|XP_009418950.1| PREDICTED: uncharacterized protein LOC103999040 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=751

 Score =   322 bits (825),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWEKN+YIS++AGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  575  QVYELSPMFLHKDWIMEQWEKNYYISAVAGATNGSSLVVMSKGTPYTQQSYKVSESFPFK  634

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYS+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  635  WINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITS  694

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILS+P+RK+MDETQETLRTS FPS HVK+KW+KNLYIASICYGRTVC
Sbjct  695  TAATPDQAAFILSVPKRKLMDETQETLRTSTFPSNHVKDKWAKNLYIASICYGRTVC  751



>ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa]
Length=691

 Score =   320 bits (821),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  515  QVYELSKVFLHKDWIMEQWEKNYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFK  574

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FH+TSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  575  WINKKWKEDFHLTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITS  634

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  635  MAATADQAAFILSIPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  691



>ref|XP_010454044.1| PREDICTED: uncharacterized protein LOC104735873 [Camelina sativa]
Length=692

 Score =   320 bits (821),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFK
Sbjct  516  QVYELSTVFLHKDWIMEQWEKNYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFK  575

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  576  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITS  635

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  636  MAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>ref|NP_001044393.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAB89852.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06307.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAH00219.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55461.1| hypothetical protein OsJ_03624 [Oryza sativa Japonica Group]
Length=698

 Score =   320 bits (821),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  522  QVYELSPIFLHKDWIMEQWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFK  581

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  582  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITS  641

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  642  TAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  697



>dbj|BAJ90552.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   320 bits (821),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  518  QVYELSPIFLHKDWIMEQWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFK  577

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  578  WINKKWKEGFHVTSMTTAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITS  637

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  638  TAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  693



>dbj|BAN15568.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  531  QVYELSQVFLHKDWIMEQWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  591  WINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  651  TAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>ref|NP_001051531.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|AAO37965.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|ABF99311.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13445.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|EAZ28883.1| hypothetical protein OsJ_12923 [Oryza sativa Japonica Group]
 dbj|BAH00578.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAN15567.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  531  QVYELSQVFLHKDWIMEQWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  591  WINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  651  TAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>gb|EAY92152.1| hypothetical protein OsI_13865 [Oryza sativa Indica Group]
Length=707

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  531  QVYELSQVFLHKDWIMEQWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  591  WINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  651  TAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>ref|XP_002873876.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50135.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=691

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFP+K
Sbjct  515  QVYELSAVFLHKDWIMEQWEKNYYISSIAGADNGSSLVVMSKGTSYTQQSYKVSDSFPYK  574

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  575  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITS  634

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  635  MAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  691



>emb|CDY50866.1| BnaA05g37270D [Brassica napus]
Length=798

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  523  QVYELSTVFLHKDWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFK  582

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITS
Sbjct  583  WINKKWKEGFHVTSMTTAGSRWGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITS  642

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            MAATADQAA ILSIP+RK+ DETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTV
Sbjct  643  MAATADQAALILSIPKRKITDETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTV  698


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  479  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  538

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  539  EQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVT  595

Query  257  SI  252
            S+
Sbjct  596  SM  597



>ref|XP_006287189.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
 gb|EOA20087.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
Length=692

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YISSIAG+ NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  516  QVYELSMVFLHKDWIMEQWEKNYYISSIAGSDNGSSLVVMSKGTSYTQQSYKVSDSFPFK  575

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  576  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITS  635

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILS+P+RKMMDETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  636  MAATADQAAFILSVPKRKMMDETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>ref|XP_003569928.1| PREDICTED: uncharacterized protein LOC100845295 [Brachypodium 
distachyon]
Length=698

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWE ++YIS+IAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  522  QVYELSPIFLHKDWIMEQWENSYYISAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFK  581

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  582  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITS  641

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  642  TAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  697



>ref|XP_006644782.1| PREDICTED: uncharacterized protein LOC102714869 [Oryza brachyantha]
Length=701

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  525  QVYELSPIFLHKDWIMEQWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFK  584

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  585  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITS  644

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  645  TAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  700



>gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=711

 Score =   319 bits (818),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YI+S+AGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  535  QVYELSTVFLHKDWIMEQWEKNYYITSVAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  594

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VTSMTTAG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  595  WINKKWKEGFYVTSMTTAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITS  654

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            MAAT DQAAFILSIP+RK  D+TQETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  655  MAATVDQAAFILSIPKRKTTDDTQETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  710


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++    + ++K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  491  YNVADLRLSQHVSKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLHKDWIM  550

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y ITS+A   + ++ ++     K    TQ++ + S +FP   + +KW +  Y+ 
Sbjct  551  EQWEKNYYITSVAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVT  607

Query  257  SI  252
            S+
Sbjct  608  SM  609



>dbj|BAJ93086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWEKNFYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  531  QVYELSQIFLHKDWIMEQWEKNFYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS+QVVELDFLYPSEG+HRRWESGYRITS
Sbjct  591  WINKKWKEGFHVTSMGTAGNRWGVVMSRNAGYSDQVVELDFLYPSEGLHRRWESGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             A T DQAAFILSIP+RK +DETQETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  651  SAGTPDQAAFILSIPKRKPLDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  707



>ref|XP_010228600.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
 ref|XP_010228605.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
Length=709

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWEKNFYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  533  QVYELSQIFLHKDWIMEQWEKNFYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYK  592

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS+QVVELDFLYPSEG+HRRWE+GYRITS
Sbjct  593  WINKKWKEGFHVTSMGTAGNRWGVVMSRNAGYSDQVVELDFLYPSEGLHRRWETGYRITS  652

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             A T DQAAFILSIP+RK MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  653  SAGTPDQAAFILSIPKRKPMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  709



>ref|XP_004970128.1| PREDICTED: uncharacterized protein LOC101772174 [Setaria italica]
Length=697

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  521  QVYELSPIFLHKDWIMEQWENNYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYK  580

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITS  640

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASIC+GRTV
Sbjct  641  TAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICFGRTV  696



>ref|NP_001058996.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAC83610.1| putative casein kinase 1, delta isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20910.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAG89932.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81591.1| hypothetical protein OsI_25061 [Oryza sativa Indica Group]
 gb|EEE66647.1| hypothetical protein OsJ_23261 [Oryza sativa Japonica Group]
Length=699

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QV++LS VFLHKDWIM QWEKNFYI++IAG+ANGSSLVVMSKGTPY+QQSYKVSESFPFK
Sbjct  523  QVHELSPVFLHKDWIMDQWEKNFYITAIAGSANGSSLVVMSKGTPYSQQSYKVSESFPFK  582

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  583  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWETGYRITS  642

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            +AAT DQAAFILSIP+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  643  IAATNDQAAFILSIPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  699



>ref|XP_006657490.1| PREDICTED: uncharacterized protein LOC102719500 [Oryza brachyantha]
Length=702

 Score =   318 bits (816),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QV++LS VFLHKDWIM QWEKNFYI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  526  QVHELSPVFLHKDWIMDQWEKNFYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFK  585

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  586  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWETGYRITS  645

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILSIP+RK +DETQETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  646  TAATNDQAAFILSIPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  702



>ref|XP_008655390.1| PREDICTED: uncharacterized protein LOC100502202 isoform X1 [Zea 
mays]
 gb|AFW84937.1| hypothetical protein ZEAMMB73_351651 [Zea mays]
Length=812

 Score =   321 bits (822),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  636  QVYELSPIFLHKDWIMEQWENNYYISAIAGAMNGSSLVVMSKGTPYTQQSYKVSESFPYK  695

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  696  WINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITS  755

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIP+RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  756  TAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  811



>ref|XP_009132256.1| PREDICTED: uncharacterized protein LOC103856881 [Brassica rapa]
Length=676

 Score =   317 bits (813),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFK
Sbjct  500  QVYELSPVFLHKDWIMEQWEKNYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFK  559

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITS
Sbjct  560  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITS  619

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  620  MAATADQAAFILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  676



>emb|CDY51243.1| BnaA03g06950D [Brassica napus]
Length=684

 Score =   317 bits (812),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFK
Sbjct  508  QVYELSPVFLHKDWIMEQWEKNYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFK  567

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITS
Sbjct  568  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITS  627

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  628  MAATADQAAFILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>emb|CDX70801.1| BnaC03g08850D [Brassica napus]
Length=684

 Score =   317 bits (812),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEKN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFK
Sbjct  508  QVYELSPVFLHKDWIMEQWEKNYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFK  567

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITS
Sbjct  568  WINKKWKEDFHVTSMTTAGNRWGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITS  627

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RKM+DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  628  MAATADQAAFILSIPKRKMVDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>ref|XP_004955583.1| PREDICTED: uncharacterized protein LOC101773166 isoform X4 [Setaria 
italica]
Length=707

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  531  QVYELSPVFLHKDWIMEQWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  591  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSNQVVELDFLYPSEGIHRRWETGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILS+P+RK MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  651  TAATNDQAAFILSMPKRKPMDETQETLRTSAFPSGHVKEKWAKNLYIASICYGRTVC  707



>ref|XP_008651588.1| PREDICTED: ATP binding protein isoform X1 [Zea mays]
 gb|ACR36803.1| unknown [Zea mays]
 tpg|DAA59714.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA59715.1| TPA: ATP binding protein isoform 2 [Zea mays]
Length=704

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  528  QVYELSPVFLHKDWIMEQWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  588  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASICYGRTVC
Sbjct  648  TAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICYGRTVC  704



>ref|NP_001152463.1| ATP binding protein [Zea mays]
 gb|ACG47741.1| ATP binding protein [Zea mays]
Length=704

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  528  QVYELSPVFLHKDWIMEQWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  588  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASICYGRTVC
Sbjct  648  TAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICYGRTVC  704



>ref|XP_004955580.1| PREDICTED: uncharacterized protein LOC101773166 isoform X1 [Setaria 
italica]
 ref|XP_004955581.1| PREDICTED: uncharacterized protein LOC101773166 isoform X2 [Setaria 
italica]
 ref|XP_004955582.1| PREDICTED: uncharacterized protein LOC101773166 isoform X3 [Setaria 
italica]
Length=732

 Score =   316 bits (810),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEK++YI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  556  QVYELSPVFLHKDWIMEQWEKSYYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPYK  615

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  616  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSNQVVELDFLYPSEGIHRRWETGYRITS  675

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILS+P+RK MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  676  TAATNDQAAFILSMPKRKPMDETQETLRTSAFPSGHVKEKWAKNLYIASICYGRTVC  732



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score =   315 bits (808),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 170/177 (96%), Gaps = 2/177 (1%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QV++LS+VFLHKDWIM QWEKNFYISSIAGA NG+SLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  537  QVWELSNVFLHKDWIMEQWEKNFYISSIAGATNGASLVVMSKGTPYTQQSYKVSDSFPFK  596

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSMTTA SRWGVVMSRNAG+++QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  597  WINKKWKEGFHVTSMTTAASRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWESGYRITS  656

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQAAF+LSIP+RK MDETQETLRTSAFPSTH  EKW+KNLYIASICYGRTVC
Sbjct  657  MAATPDQAAFVLSIPKRKTMDETQETLRTSAFPSTH--EKWAKNLYIASICYGRTVC  711



>ref|NP_001152101.1| LOC100285738 [Zea mays]
 ref|XP_008668149.1| PREDICTED: LOC100285738 isoform X1 [Zea mays]
 gb|ACG45775.1| ATP binding protein [Zea mays]
 tpg|DAA42572.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA42573.1| TPA: ATP binding protein isoform 2 [Zea mays]
 tpg|DAA42574.1| TPA: ATP binding protein isoform 3 [Zea mays]
Length=704

 Score =   315 bits (807),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEK++YI++IAG++NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  528  QVYELSPVFLHKDWIMEQWEKSYYITAIAGSSNGSSLVVMSKGTPYTQQSYKVSESFPYK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  588  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASIC+GRTVC
Sbjct  648  TAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICFGRTVC  704



>gb|ACN36158.1| unknown [Zea mays]
Length=704

 Score =   315 bits (807),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEK++YI++IAG++NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  528  QVYELSPVFLHKDWIMEQWEKSYYITAIAGSSNGSSLVVMSKGTPYTQQSYKVSESFPYK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  588  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILS+P+RK MDETQETLRTSAFPS+HVKEKW+KNLYIASIC+GRTVC
Sbjct  648  TAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSHVKEKWAKNLYIASICFGRTVC  704



>ref|XP_003557523.1| PREDICTED: uncharacterized protein LOC100821235 [Brachypodium 
distachyon]
Length=702

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHKDWIM QWEK+FYI++IAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  526  QVYELSPAFLHKDWIMDQWEKSFYITAIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFK  585

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE GYRITS
Sbjct  586  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWEQGYRITS  645

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  646  SAATIDQAAFILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  702



>gb|ADE77861.1| unknown [Picea sitchensis]
Length=186

 Score =   297 bits (760),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  10   QVYELSQCFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTNYTQQSYKVSDSFPFK  69

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM +AGSRWGVVMSRNAG+++QVVELDFLYPSEGIHRRW+ GYRIT+
Sbjct  70   WINKKWREGFYVTSMASAGSRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDHGYRITA  129

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  130  TAATWDQAAFVLSVPRRKPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  185



>ref|XP_006842223.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
 gb|ERN03898.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
Length=705

 Score =   313 bits (801),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS++FLHKDWIM QWEKN+YISSIAGA NG SLVVMSKGTPY+QQSYKVS+SFPFK
Sbjct  529  QVYELSAIFLHKDWIMEQWEKNYYISSIAGANNGGSLVVMSKGTPYSQQSYKVSDSFPFK  588

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSMTT+G+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWE+G+RITS
Sbjct  589  WINKKWREGFYVTSMTTSGNRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENGFRITS  648

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILS+P+RKM DETQETLRTSAFPSTHVKEKWSKNLYIAS+CYGRTV
Sbjct  649  TAATVDQAAFILSVPKRKMSDETQETLRTSAFPSTHVKEKWSKNLYIASVCYGRTV  704



>gb|EMS51431.1| Casein kinase I isoform beta [Triticum urartu]
Length=695

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHKDWIM QWEK+FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  519  QVYELSPVFLHKDWIMDQWEKSFYITAIAGALNGSSLVVMSKGTPYTQQSYKVSESFPFK  578

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+GYSEQ+VELDFLYPSEGIHRRWE GYRITS
Sbjct  579  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSEQIVELDFLYPSEGIHRRWEHGYRITS  638

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  639  SAATGDQAAFILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  694



>emb|CDY02641.1| BnaC02g07940D [Brassica napus]
Length=686

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHK+WIM QW+KN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+K
Sbjct  510  QVYELSTVFLHKEWIMEQWDKNYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYK  569

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  570  WINKKWKEDFHVTSMTTAGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITS  629

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  630  MAATADQAAFILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  686



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 171/178 (96%), Gaps = 1/178 (1%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHKDWIM QWEKN+YIS IAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  510  QVYELSAVFLHKDWIMEQWEKNYYISCIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFK  569

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WI+KKWKEGFHVTSMT+AGSRWGVVMSRN+GYSEQVVE+DF+YPSEGIHRRWESGYRITS
Sbjct  570  WISKKWKEGFHVTSMTSAGSRWGVVMSRNSGYSEQVVEVDFVYPSEGIHRRWESGYRITS  629

Query  401  MAATADQAAFILSIPRRK-MMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQ+AF+LSIPRRK MMDE QETLRTSAFPS+HVK KWS+NLYIAS+C+G TVC
Sbjct  630  MAATTDQSAFVLSIPRRKLMMDEAQETLRTSAFPSSHVKAKWSRNLYIASMCHGPTVC  687



>ref|XP_002466312.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
 gb|EER93310.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
Length=707

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVYDLS VFLHK+WI  QWEKN+YI++IAGA NGSSL+VMSKGTPYTQQSYKVSESFP+K
Sbjct  531  QVYDLSQVFLHKEWITEQWEKNYYITAIAGATNGSSLIVMSKGTPYTQQSYKVSESFPYK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGV++SRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  591  WINKKWKEGFHVTSMATAGNRWGVIVSRNAGYSTQVVELDFLYPSEGIHRRWETGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            +AAT DQAAFILSIP+RK MDETQE LRTSAFPS+HVKEKW KNLYI+S+CYGRTVC
Sbjct  651  IAATPDQAAFILSIPKRKPMDETQEILRTSAFPSSHVKEKWVKNLYISSVCYGRTVC  707



>ref|XP_009126244.1| PREDICTED: uncharacterized protein LOC103851164 [Brassica rapa]
Length=684

 Score =   310 bits (795),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHK+WIM QW+KN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+K
Sbjct  508  QVYELSTVFLHKEWIMEQWDKNYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYK  567

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITS
Sbjct  568  WINKKWKEDFHVTSMTTAGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITS  627

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  628  MAATADQAAFILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>ref|XP_010552201.1| PREDICTED: serine/threonine-protein kinase ste20-like [Tarenaya 
hassleriana]
Length=702

 Score =   310 bits (793),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAG+ NGSSLVVMSKGT +TQQSYKVS+SFPFK
Sbjct  526  QVYELSPVFLHKEWIMEQWEKNYYISSIAGSNNGSSLVVMSKGTQFTQQSYKVSDSFPFK  585

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRW SGYRITS
Sbjct  586  WINKKWKEGFHVTSMATAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWNSGYRITS  645

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AATADQ A +LSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+ASICYGRTV
Sbjct  646  TAATADQTALVLSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASICYGRTV  701



>emb|CDY53253.1| BnaA02g04010D [Brassica napus]
Length=762

 Score =   311 bits (797),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHK+WIM QW+KN+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+K
Sbjct  586  QVYELSTVFLHKEWIMEQWDKNYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYK  645

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKE FHVTSMTTAG+RWGV+MSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITS
Sbjct  646  WINKKWKEDFHVTSMTTAGNRWGVIMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITS  705

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAATADQAAFILSIP+RK+ DETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  706  MAATADQAAFILSIPKRKLNDETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  762



>ref|NP_001183608.1| uncharacterized protein LOC100502202 [Zea mays]
 gb|ACR37739.1| unknown [Zea mays]
Length=162

 Score =   292 bits (747),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/161 (91%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -3

Query  716  MXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM  537
            M QWE N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM
Sbjct  1    MEQWENNYYISAIAGAMNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSM  60

Query  536  TTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP  357
            TTAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP
Sbjct  61   TTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIP  120

Query  356  RRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +RK+MDETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  121  KRKLMDETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  161



>ref|XP_010500967.1| PREDICTED: uncharacterized protein LOC104778257 isoform X2 [Camelina 
sativa]
Length=390

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  214  QVYELSPVFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  273

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  274  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  333

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  334  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  389



>ref|XP_004981469.1| PREDICTED: uncharacterized protein LOC101783890 isoform X1 [Setaria 
italica]
 ref|XP_004981470.1| PREDICTED: uncharacterized protein LOC101783890 isoform X2 [Setaria 
italica]
 ref|XP_004981471.1| PREDICTED: uncharacterized protein LOC101783890 isoform X3 [Setaria 
italica]
 ref|XP_004981472.1| PREDICTED: uncharacterized protein LOC101783890 isoform X4 [Setaria 
italica]
 ref|XP_004981473.1| PREDICTED: uncharacterized protein LOC101783890 isoform X5 [Setaria 
italica]
Length=706

 Score =   308 bits (789),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHK+WI  QWEKN+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+K
Sbjct  530  QVYELSQMFLHKEWITEQWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYK  589

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+GY+ QVVELDFLYPSEGIH RWE+GYRITS
Sbjct  590  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGYATQVVELDFLYPSEGIHHRWETGYRITS  649

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFILSIP+RK MDETQETLRTSAFPS HVKEKW KNLYI+SICYGRTVC
Sbjct  650  TAATPDQAAFILSIPKRKPMDETQETLRTSAFPSNHVKEKWVKNLYISSICYGRTVC  706



>ref|XP_010936995.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X1 [Elaeis 
guineensis]
Length=601

 Score =   305 bits (780),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  425  QVYELSPLFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  484

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  485  WINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  544

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            MAAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+AS+CYGRTV
Sbjct  545  MAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASVCYGRTV  600



>ref|XP_010936996.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X2 [Elaeis 
guineensis]
Length=600

 Score =   305 bits (780),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  424  QVYELSPLFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  483

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  484  WINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  543

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            MAAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+AS+CYGRTV
Sbjct  544  MAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASVCYGRTV  599



>ref|XP_010542444.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT +TQQSYKVS+SFPFK
Sbjct  527  QVYELSPVFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQFTQQSYKVSDSFPFK  586

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIH+RW+SG+RITS
Sbjct  587  WINKKWREGFHVTSMATAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHKRWDSGFRITS  646

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+CYGRTV
Sbjct  647  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLCYGRTV  702



>ref|XP_010534909.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   306 bits (784),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT +TQQSYKVS+SFPFK
Sbjct  527  QVYELSPVFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQFTQQSYKVSDSFPFK  586

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  587  WINKKWREGFHVTSMATAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWDGGFRITS  646

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+CYGRTV
Sbjct  647  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLCYGRTV  702



>ref|XP_008797930.1| PREDICTED: uncharacterized protein LOC103712966 isoform X3 [Phoenix 
dactylifera]
Length=728

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS+FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  552  QVYELSSLFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  611

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  612  WINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  671

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            MAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  672  MAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  727



>ref|XP_008797939.1| PREDICTED: uncharacterized protein LOC103712966 isoform X4 [Phoenix 
dactylifera]
Length=727

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS+FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  551  QVYELSSLFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  610

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  611  WINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  670

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            MAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  671  MAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  726



>ref|XP_008797922.1| PREDICTED: uncharacterized protein LOC103712966 isoform X2 [Phoenix 
dactylifera]
Length=731

 Score =   306 bits (784),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS+FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  555  QVYELSSLFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  614

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  615  WINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  674

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            MAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  675  MAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  730



>ref|XP_008797915.1| PREDICTED: uncharacterized protein LOC103712966 isoform X1 [Phoenix 
dactylifera]
Length=732

 Score =   306 bits (784),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS+FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  556  QVYELSSLFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  615

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  616  WINKKWKEGFHVTSMATSGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  675

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            MAAT DQAA ILS+P+R+  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  676  MAATWDQAALILSVPKRRPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  731



>ref|XP_006651899.1| PREDICTED: uncharacterized protein LOC102717146 [Oryza brachyantha]
Length=726

 Score =   306 bits (783),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWE+N+YI++IAGA NGSSLVVMSK T YTQQSYKVSESFP+K
Sbjct  550  QVYELSQVFLHKNWIMDQWEQNYYITAIAGANNGSSLVVMSKETSYTQQSYKVSESFPYK  609

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN GYS QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  610  WINKKWKEGFHVTSMATAGNRWGVVMSRNTGYSHQVVELDFLYPSEGIHRRWETGYRITS  669

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAAFIL++P+RK +DETQETLRTS+FPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  670  TAATPDQAAFILTMPKRKPVDETQETLRTSSFPSTHVKEKWSKNLYIASICYGRTVC  726



>gb|EMT21659.1| Casein kinase I-RAG8-like protein [Aegilops tauschii]
Length=640

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QV++LS VFLHKDWIM QWEK+FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  464  QVHELSPVFLHKDWIMDQWEKSFYITAIAGALNGSSLVVMSKGTPYTQQSYKVSESFPFK  523

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS Q+VELDFLYPSEGIH RWE GYRITS
Sbjct  524  WINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSGQIVELDFLYPSEGIHWRWEHGYRITS  583

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILS P+RK +DETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  584  SAATGDQAAFILSKPKRKPVDETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  639



>ref|XP_010472589.1| PREDICTED: uncharacterized protein LOC104752210 [Camelina sativa]
Length=257

 Score =   290 bits (743),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+++AGA+NGSS VVMSKGT Y QQSYKVS+SFPFK
Sbjct  81   QVYQLSPSFLHKEWIMEQWEKNYYITAVAGASNGSSFVVMSKGTQYLQQSYKVSDSFPFK  140

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  141  WINKKWREGFYVTSMATAGSKWGIVMSRGACFSDQVVELDFLYPSEGIHRRWENGYRITS  200

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  201  VAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  256



>ref|XP_002960894.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii]
 gb|EFJ38433.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii]
Length=596

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHK+WIM QWEKNFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  420  QVYELSNVFLHKEWIMEQWEKNFYISAIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFK  479

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAG+RWGVVMSRNAG+++QVVELDFLYPSEGIHRRW+ GYRIT+
Sbjct  480  WINKKWREGFYVTSMATAGTRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDCGYRITA  539

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  540  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  595



>ref|XP_002967119.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii]
 gb|EFJ31718.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii]
Length=596

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+VFLHK+WIM QWEKNFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  420  QVYELSNVFLHKEWIMEQWEKNFYISAIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFK  479

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAG+RWGVVMSRNAG+++QVVELDFLYPSEGIHRRW+ GYRIT+
Sbjct  480  WINKKWREGFYVTSMATAGTRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDCGYRITA  539

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  540  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  595



>ref|XP_001770883.1| predicted protein [Physcomitrella patens]
 gb|EDQ64213.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKNFYIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  427  QVYELSHVFLHKEWIMEQWEKNFYISAIAGANNGSSLVVMSKGTSYTQQSYKVSDSFPFK  486

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  487  WINKKWREGFYVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  546

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  547  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  602



>ref|XP_001764211.1| predicted protein [Physcomitrella patens]
 gb|EDQ71052.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKNFYIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  427  QVYELSHVFLHKEWIMEQWEKNFYISAIAGANNGSSLVVMSKGTSYTQQSYKVSDSFPFK  486

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  487  WINKKWREGFYVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  546

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  547  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  602



>gb|AAC42254.1| unknown protein [Arabidopsis thaliana]
Length=282

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+++AGA +G+S VVMSKGT Y QQSYKVS+SFPFK
Sbjct  106  QVYQLSPSFLHKEWIMEQWEKNYYITAVAGANSGNSFVVMSKGTQYLQQSYKVSDSFPFK  165

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QV+ELDFLYPSEGIHRRWE+GYRITS
Sbjct  166  WINKKWREGFYVTSMATAGSKWGIVMSRGASFSDQVIELDFLYPSEGIHRRWENGYRITS  225

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +AAT DQAAF+LS+PRRK+ DETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  226  VAATWDQAAFVLSVPRRKLTDETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  281



>gb|KHN37292.1| Casein kinase I [Glycine soja]
Length=590

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS+ FLHK+WIM QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFK
Sbjct  414  QVYKLSTFFLHKEWIMEQWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFK  473

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+
Sbjct  474  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITA  533

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQ+A ILSIPRRK+ DETQETLRTS FPSTHVK+KWSKNLY+A +CYGRTVC
Sbjct  534  TAATLDQSALILSIPRRKLSDETQETLRTSQFPSTHVKDKWSKNLYLACLCYGRTVC  590



>emb|CDY23629.1| BnaC05g39650D [Brassica napus]
Length=525

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT Y+QQSYKVS+SFPFK
Sbjct  349  QVYELSPVFLHKEWIMEQWEKNYYISSIAGATNGSSLVVMSKGTQYSQQSYKVSDSFPFK  408

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ GYRITS
Sbjct  409  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITS  468

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  469  TAATTDQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  524



>ref|XP_006407187.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
 gb|ESQ48640.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
Length=703

 Score =   303 bits (776),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  527  QVYELSPVFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  586

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  587  WINKKWKEGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  646

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  647  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702



>ref|XP_008787870.1| PREDICTED: uncharacterized protein LOC103705792 [Phoenix dactylifera]
Length=730

 Score =   304 bits (778),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWEKN++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  554  QVYELSPLFLHKDWIMEQWEKNYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  613

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  614  WINKKWKEGFHVTSMATSGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  673

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +AAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  674  VAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  729



>gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum]
Length=668

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  758  VYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKW  579
            + D  + F  +DWIM QWEKN+YI+S+AGA N SSLVVMSKGTPYTQQSYKVSESFPFKW
Sbjct  493  IMDAGTGFSSQDWIMEQWEKNYYITSVAGANNESSLVVMSKGTPYTQQSYKVSESFPFKW  552

Query  578  INKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSM  399
            INKKWKEGF+VTSMTTAG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSM
Sbjct  553  INKKWKEGFYVTSMTTAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSM  612

Query  398  AATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            AAT DQAAFILSIP+RK  D+TQETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  613  AATVDQAAFILSIPKRKTTDDTQETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  667



>ref|XP_010939945.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939946.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
Length=729

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWEKN++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  553  QVYELSPLFLHKDWIMEQWEKNYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  612

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  613  WINKKWKEGFHVTSMATSGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  672

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +AAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  673  VAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  728



>ref|XP_010939947.1| PREDICTED: uncharacterized protein LOC105058653 isoform X2 [Elaeis 
guineensis]
Length=725

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHKDWIM QWEKN++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  549  QVYELSPLFLHKDWIMEQWEKNYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFK  608

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  609  WINKKWKEGFHVTSMATSGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  668

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +AAT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  669  VAATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  724



>emb|CDY55141.1| BnaC01g44810D [Brassica napus]
Length=632

 Score =   300 bits (769),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  456  QVYELSPVFLHKEWIMEQWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFK  515

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS
Sbjct  516  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITS  575

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  576  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  631



>emb|CBI28086.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   300 bits (769),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS++FLHK+WIM QW+KNFYI+S+AGA+NG++LVVMSKGTPY QQSYKVS+ FPFK
Sbjct  453  QVYELSTIFLHKEWIMEQWDKNFYITSVAGASNGNALVVMSKGTPYNQQSYKVSDVFPFK  512

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF VTSMTTAGSRWG+VMSRNAG+S QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  513  WINKKWKEGFFVTSMTTAGSRWGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITS  572

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AATADQAAFILS  +R+  D TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  573  TAATADQAAFILSTSKRRTQDVTQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  628



>tpg|DAA54811.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=186

 Score =   286 bits (732),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS FLHK+WIM QW+K+FYISS+AG+ NGSS+VVMSKGTPYTQQSYKVS+SFPFK
Sbjct  10   QVYELSSHFLHKEWIMEQWDKSFYISSVAGSNNGSSIVVMSKGTPYTQQSYKVSDSFPFK  69

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVT+M T+G+RW +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G+RIT+
Sbjct  70   WINKKWKEGFHVTAMATSGNRWAIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITA  129

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQ+A ILS PRR+  DETQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  130  MAATMDQSALILSKPRRRPRDETQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTVA  186



>ref|XP_002882838.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59097.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   302 bits (774),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  527  QVYELSPVFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  586

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  587  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  646

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  647  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702



>ref|XP_006297084.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
 gb|EOA29982.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
Length=704

 Score =   302 bits (774),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  528  QVYELSPVFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  588  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  648  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  703



>ref|XP_003536792.1| PREDICTED: uncharacterized protein LOC100783819 [Glycine max]
Length=672

 Score =   301 bits (772),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS+ FLHK+WIM QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFK
Sbjct  496  QVYKLSTFFLHKEWIMEQWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFK  555

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+
Sbjct  556  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITA  615

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQ+A ILSIPRRK+ DETQETLRTS FPSTHVK+KWSKNLY+A +CYGRTVC
Sbjct  616  TAATLDQSALILSIPRRKLSDETQETLRTSQFPSTHVKDKWSKNLYLACLCYGRTVC  672



>ref|XP_009382978.1| PREDICTED: uncharacterized protein LOC103970784 [Musa acuminata 
subsp. malaccensis]
Length=721

 Score =   303 bits (775),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YI+S+AG+ NGSSLVVMSKGT YTQQSYKVSESFPFK
Sbjct  545  QVYELSPFFLHKEWIMEQWEKNYYITSLAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFK  604

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  605  WINKKWKEGFHVTSMATAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  664

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            M AT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+ASICYGRTV
Sbjct  665  MGATWDQAALILSVPKRKPGDETQETLRTSAFPSAHVKDKWAKNLYLASICYGRTV  720



>gb|KFK38714.1| hypothetical protein AALP_AA3G150500 [Arabis alpina]
Length=700

 Score =   302 bits (773),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  524  QVYELSPVFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  583

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  584  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  643

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  644  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  699



>gb|KHN27094.1| Casein kinase I [Glycine soja]
Length=657

 Score =   301 bits (770),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS+ FLHK+WIM QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFK
Sbjct  481  QVYKLSTFFLHKEWIMEQWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFK  540

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+
Sbjct  541  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITA  600

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQ+A ILSIPRRK+ DETQETLRTS FP THVKEKWSKNLY+A +CYGRTVC
Sbjct  601  TAATLDQSALILSIPRRKLSDETQETLRTSQFPGTHVKEKWSKNLYLACLCYGRTVC  657



>ref|XP_003556554.1| PREDICTED: uncharacterized protein LOC100807373 [Glycine max]
Length=669

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS+ FLHK+WIM QW+KNFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFK
Sbjct  493  QVYKLSTFFLHKEWIMEQWDKNFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFK  552

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+
Sbjct  553  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITA  612

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQ+A ILSIPRRK+ DETQETLRTS FP THVKEKWSKNLY+A +CYGRTVC
Sbjct  613  TAATLDQSALILSIPRRKLSDETQETLRTSQFPGTHVKEKWSKNLYLACLCYGRTVC  669



>emb|CDY51730.1| BnaA01g37130D [Brassica napus]
Length=684

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  508  QVYELSPVFLHKEWIMEQWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFK  567

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS
Sbjct  568  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITS  627

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  628  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  683



>gb|KDP33655.1| hypothetical protein JCGZ_07226 [Jatropha curcas]
Length=664

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QV++LS +FLHK+WIM QW+KN+YI+S+AG ANGS+LVVMSKGTPYTQQSYKVS+ FPFK
Sbjct  488  QVHELSPIFLHKEWIMEQWDKNYYITSVAGTANGSALVVMSKGTPYTQQSYKVSDVFPFK  547

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF VTSMTTAGS+WG+VMSRNAGY  QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  548  WINKKWKEGFSVTSMTTAGSKWGIVMSRNAGYPNQVVELDFLYPSEGIHRRWESGYRITS  607

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AATADQAAFILS P+RK  D  QETLRTSAFPSTHVK+KWSKNLYIASICYGRTV
Sbjct  608  TAATADQAAFILSAPKRKSSDVAQETLRTSAFPSTHVKDKWSKNLYIASICYGRTV  663



>ref|XP_006445886.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 ref|XP_006492686.1| PREDICTED: uncharacterized protein LOC102618306 [Citrus sinensis]
 gb|ESR59126.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 gb|KDO62936.1| hypothetical protein CISIN_1g048600mg [Citrus sinensis]
Length=707

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  531  QVYELSPFFLHKEWIMEQWEKNYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+SEQVVELDFLYPSEGIHRRW+ GYRITS
Sbjct  591  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSEQVVELDFLYPSEGIHRRWDGGYRITS  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  651  TAATCDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  706



>emb|CDX97505.1| BnaA05g25740D [Brassica napus]
Length=653

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT Y+QQSYKVS+SFPFK
Sbjct  477  QVYELSPVFLHKEWIMEQWEKNYYISSIAGATNGSSLVVMSKGTQYSQQSYKVSDSFPFK  536

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ GYRITS
Sbjct  537  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITS  596

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  597  TAATTDQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  652



>ref|XP_010465212.1| PREDICTED: uncharacterized protein LOC104745616 [Camelina sativa]
Length=714

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  538  QVYELSPVFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  597

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  598  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  657

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  658  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  713



>ref|XP_010500960.1| PREDICTED: uncharacterized protein LOC104778257 isoform X1 [Camelina 
sativa]
Length=711

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  535  QVYELSPVFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  594

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  595  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  654

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  655  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  710



>ref|XP_010487127.1| PREDICTED: serine/threonine-protein kinase STE20-like [Camelina 
sativa]
Length=717

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  541  QVYELSPVFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  600

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  601  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  660

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  661  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  716



>ref|XP_009146466.1| PREDICTED: uncharacterized protein LOC103870106 [Brassica rapa]
Length=689

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGAANGSSLVVMSKGT Y+QQSYKVS+SFPFK
Sbjct  513  QVYELSPVFLHKEWIMEQWEKNYYISSIAGAANGSSLVVMSKGTQYSQQSYKVSDSFPFK  572

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ GYRITS
Sbjct  573  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITS  632

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR++ DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  633  TAATTDQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  688



>ref|XP_010656334.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656335.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656336.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
Length=700

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS++FLHK+WIM QW+KNFYI+S+AGA+NG++LVVMSKGTPY QQSYKVS+ FPFK
Sbjct  524  QVYELSTIFLHKEWIMEQWDKNFYITSVAGASNGNALVVMSKGTPYNQQSYKVSDVFPFK  583

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF VTSMTTAGSRWG+VMSRNAG+S QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  584  WINKKWKEGFFVTSMTTAGSRWGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITS  643

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AATADQAAFILS  +R+  D TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  644  TAATADQAAFILSTSKRRTQDVTQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  699



>ref|XP_008367866.1| PREDICTED: casein kinase I [Malus domestica]
Length=540

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS FLHK+WIM QW+KN+YIS IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  364  QVYELSSYFLHKEWIMEQWDKNYYISXIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFK  423

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  424  WINKKWREGFHVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  483

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK+ DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  484  TAATWDQAAFVLSVPRRKLADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  539



>ref|NP_187977.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB01914.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AAL85021.1| putative casein kinase [Arabidopsis thaliana]
 gb|AAM51279.1| putative casein kinase [Arabidopsis thaliana]
 gb|AEE75390.1| protein kinase family protein [Arabidopsis thaliana]
Length=703

 Score =   301 bits (770),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGA+NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  527  QVYELSPVFLHKEWIMEQWEKNYYISSIAGASNGSSLVVMSKGTQYTQQSYKVSDSFPFK  586

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  587  WINKKWREGFHVTSMATAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  646

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  647  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702



>emb|CDX75726.1| BnaC03g38090D [Brassica napus]
Length=652

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WI+ QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  476  QVYELSPVFLHKEWILEQWEKNYYISSIAGATNGSSLVVMSKGTAYTQQSYKVSDSFPFK  535

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  536  WINKKWREGFHVTSMATAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  595

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  596  TAATTDQAALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  651



>ref|XP_008351086.1| PREDICTED: uncharacterized protein LOC103414488 [Malus domestica]
Length=486

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  310  QVYELSPFFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  369

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS
Sbjct  370  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITS  429

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  430  TAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  485



>emb|CDX82524.1| BnaA03g32970D [Brassica napus]
Length=654

 Score =   299 bits (765),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  478  QVYELSPVFLHKEWIMEQWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFK  537

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  538  WINKKWREGFHVTSMATAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  597

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQ A ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  598  TAATTDQTALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  653



>ref|XP_009117581.1| PREDICTED: uncharacterized protein LOC103842673 [Brassica rapa]
Length=683

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  507  QVYELSPVFLHKEWIMEQWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFK  566

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS
Sbjct  567  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITS  626

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIPRR+++D+TQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  627  TAATTDQAALILSIPRRRLVDKTQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  682



>ref|XP_009135319.1| PREDICTED: uncharacterized protein LOC103859531 [Brassica rapa]
Length=676

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS VFLHK+WIM QWEKN+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  500  QVYELSPVFLHKEWIMEQWEKNYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFK  559

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAG+RWGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  560  WINKKWREGFHVTSMATAGTRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITS  619

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQ A ILSIPRR+++DETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  620  TAATTDQTALILSIPRRRLVDETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  675



>ref|XP_009404157.1| PREDICTED: uncharacterized protein LOC103987553 [Musa acuminata 
subsp. malaccensis]
Length=725

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YI+S+AGA NGSSLVVMSKGT YTQQSYKVSESFPFK
Sbjct  549  QVYELSPFFLHKEWIMDQWEKNYYITSLAGANNGSSLVVMSKGTQYTQQSYKVSESFPFK  608

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRITS
Sbjct  609  WINKKWKEGFHVTSMATAGTRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITS  668

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            MAAT DQAA ILS+P+RK  DETQETLRTS+FPS HVK+KW+KNLY+ASICYGRTV
Sbjct  669  MAATWDQAALILSVPKRKPGDETQETLRTSSFPSAHVKDKWAKNLYLASICYGRTV  724



>ref|XP_007024284.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY26906.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=727

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NG SLVVMS+GT Y+QQSYKVSESFPFK
Sbjct  551  QVYELSPHFLHKEWIMEQWEKNYYISAIAGATNGFSLVVMSRGTQYSQQSYKVSESFPFK  610

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW+ GYRIT+
Sbjct  611  WINKKWKEGFHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDCGYRITA  670

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK MDETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  671  TAATWDQAAFVLSVPRRKPMDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  726



>gb|ADE76410.1| unknown [Picea sitchensis]
Length=444

 Score =   292 bits (748),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEK++YI++IAGA +GSSLVVMSKGTPYTQQSYKVS+ FPFK
Sbjct  268  QVYELSQSFLHKEWIMEQWEKSYYITAIAGANSGSSLVVMSKGTPYTQQSYKVSDFFPFK  327

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VTSM+TA SRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+RIT+
Sbjct  328  WINKKWKEGFYVTSMSTAASRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITA  387

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILS+P+RK  DETQETLRTSAFPSTHVKEKW+KNLY+A++CYGRTV
Sbjct  388  TAATWDQAAFILSVPKRKPGDETQETLRTSAFPSTHVKEKWAKNLYLAAVCYGRTV  443



>gb|EMS55588.1| Casein kinase I-like protein 2 [Triticum urartu]
Length=597

 Score =   297 bits (760),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHKDWIM QWEKNFYISS+AGA  GSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  421  QVYELSPHFLHKDWIMEQWEKNFYISSVAGANIGSSLVVMSKGTPYTQQSYKVSDSFPFK  480

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRW +VMSRNAG+++QVVELDFLYPSEG+HRRW++GYRIT+
Sbjct  481  WINKKWKEGFHVTSMATSGSRWAIVMSRNAGFTDQVVELDFLYPSEGVHRRWDNGYRITA  540

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQ+A ILS+PRR+  DETQETLRTS FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  541  MAATMDQSALILSMPRRRPRDETQETLRTSQFPSAHVKDKWAKNLYLAGICYGRTVA  597



>ref|XP_003552750.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
 gb|KHN12581.1| Casein kinase I isoform alpha [Glycine soja]
Length=672

 Score =   299 bits (765),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  496  QVYKLSPFFLHKEWIMEQWEKNYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  555

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+
Sbjct  556  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITA  615

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  616  TAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  672



>ref|XP_003532324.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
Length=672

 Score =   299 bits (765),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  496  QVYKLSPFFLHKEWIMEQWEKNYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  555

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+
Sbjct  556  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITA  615

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  616  TAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  672



>dbj|BAJ99119.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   293 bits (751),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHKDWIM QWEKNFYISS+AGA  GSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  304  QVYELSPHFLHKDWIMEQWEKNFYISSVAGANTGSSLVVMSKGTPYTQQSYKVSDSFPFK  363

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VTSM T+GSRW +VMSRNAG+++QVVELDFLYPSEG+HRRW++GYRIT+
Sbjct  364  WINKKWKEGFYVTSMATSGSRWAIVMSRNAGFTDQVVELDFLYPSEGVHRRWDNGYRITA  423

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQ+A ILS+PRR+  DETQETLR S FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  424  MAATMDQSALILSMPRRRPRDETQETLRASQFPSAHVKDKWAKNLYLAGICYGRTVA  480



>ref|XP_010249770.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249771.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249772.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
 ref|XP_010249773.1| PREDICTED: uncharacterized protein LOC104592236 [Nelumbo nucifera]
Length=706

 Score =   300 bits (767),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVYDLS +FLHKDWIM QW+KN+YISS+AGA NGS++VVMSKGTPYTQQSYKVS+ FPFK
Sbjct  530  QVYDLSPIFLHKDWIMEQWDKNYYISSVAGATNGSAVVVMSKGTPYTQQSYKVSDVFPFK  589

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW EGF VT M TAGS+WG+VMSRNAG+S QVVELDFLYPSEGIHRRWESGYRITS
Sbjct  590  WINKKWNEGFFVTCMATAGSKWGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITS  649

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILS P+RK  D TQETLRTSAFPS HVK+KWSKNLYIASICYGRTV
Sbjct  650  AAATTDQAAFILSTPKRKSPDVTQETLRTSAFPSNHVKDKWSKNLYIASICYGRTV  705



>ref|XP_006849555.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
 gb|ERN11136.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
Length=707

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVYDLS  FL+K+WIM QWE+N+YIS+I GA NGSSLVVMSKGT YTQQSYKVS++FPFK
Sbjct  531  QVYDLSPYFLNKEWIMEQWERNYYISAIGGANNGSSLVVMSKGTQYTQQSYKVSDTFPFK  590

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  591  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITA  650

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTSAFPS+HVKEKWSKNLY+ASICYGRTV
Sbjct  651  TAATFDQAALILSVPKRKPGDETQETLRTSAFPSSHVKEKWSKNLYLASICYGRTV  706



>emb|CBI16476.3| unnamed protein product [Vitis vinifera]
Length=603

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWE+NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  427  QVYELSPFFLHKEWIMEQWERNFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  486

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  487  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  546

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQ+A ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  547  TAATWDQSALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  602



>ref|XP_009413490.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413491.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
Length=717

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            Q+Y+LS  FLHK+W+M QWEKN+YI+S+AG+ NGSSLVVMSKGT YTQQSYKVSESFPFK
Sbjct  541  QIYELSPFFLHKEWVMDQWEKNYYITSLAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFK  600

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT 
Sbjct  601  WINKKWKEGFHVTSMATAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITC  660

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            M AT DQAA ILS+P+RK  DETQETLRTSAFPS HVK+KW+KNLY+ASICYGRTV
Sbjct  661  MGATWDQAALILSVPKRKPCDETQETLRTSAFPSAHVKDKWAKNLYLASICYGRTV  716



>ref|XP_007139114.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
 gb|ESW11108.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
Length=675

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKNFYI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  499  QVYKLSPFFLHKEWIMEQWEKNFYITSIAGANNGSSLVVMSKGTHYTQQSYKVSDSFPFK  558

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRN+GY++QV+ELDFLYPSEGIHRRW++GYRIT+
Sbjct  559  WINKKWREGFHVTSMATAGSRWGVVMSRNSGYTDQVIELDFLYPSEGIHRRWDNGYRITA  618

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  619  TAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  675



>ref|XP_003621013.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES77231.1| casein kinase I-like protein [Medicago truncatula]
Length=599

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+SIAG  NGSSLVVMSKGT YTQQSYKVSESFPFK
Sbjct  423  QVYKLSPFFLHKEWIMEQWEKNYYITSIAGVTNGSSLVVMSKGTQYTQQSYKVSESFPFK  482

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+
Sbjct  483  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITA  542

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQ+A ILS PRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  543  TAATWDQSALILSKPRRRPADETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  599



>gb|KHN24964.1| Casein kinase I isoform alpha [Glycine soja]
Length=708

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  532  QVYKLSPFFLHKEWIMEQWEKNYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  591

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+
Sbjct  592  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITA  651

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQ+A ILSIPRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  652  TAATWDQSALILSIPRRRPGDETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  708



>gb|KHN18151.1| Casein kinase I like 2 [Glycine soja]
Length=486

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  310  QVYELSPFFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFK  369

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  370  WINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  429

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  430  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  485



>ref|XP_010915404.1| PREDICTED: uncharacterized protein LOC105040538 [Elaeis guineensis]
Length=683

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  507  QVYELSPCFLHKEWIMEQWEKNYYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFK  566

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VT+M TAGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  567  WINKKWKEGFYVTAMATAGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITA  626

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKWSKNLYIASICYGRTV
Sbjct  627  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSQHVKEKWSKNLYIASICYGRTV  682



>ref|XP_010267167.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267168.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  521  QVYELSSFFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFK  580

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGSRW VVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  581  WINKKWREGFYVTSMATAGSRWAVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITA  640

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  641  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>tpg|DAA54810.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=326

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS FLHK+WIM QW+K+FYISS+AG+ NGSS+VVMSKGTPYTQQSYKVS+SFPFK
Sbjct  150  QVYELSSHFLHKEWIMEQWDKSFYISSVAGSNNGSSIVVMSKGTPYTQQSYKVSDSFPFK  209

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVT+M T+G+RW +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G+RIT+
Sbjct  210  WINKKWKEGFHVTAMATSGNRWAIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITA  269

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQ+A ILS PRR+  DETQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  270  MAATMDQSALILSKPRRRPRDETQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTVA  326



>ref|XP_009395055.1| PREDICTED: uncharacterized protein LOC103980386 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=684

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+ FLHK+WIM QWEKN+YISS+AGA NGSSLVVMSKGTPY QQSYKVSESFPFK
Sbjct  508  QVYELSASFLHKEWIMEQWEKNYYISSLAGADNGSSLVVMSKGTPYAQQSYKVSESFPFK  567

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAG+RW VVMSRNAG+ EQVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  568  WINKKWREGFYVTAMATAGNRWAVVMSRNAGFLEQVVELDFLYPSEGIHRRWDSGYRITA  627

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK +DETQETLRTSAFPS HVKEKW+KNLY+AS+CYGRTV
Sbjct  628  TAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSQHVKEKWAKNLYLASVCYGRTV  683



>ref|XP_009395056.1| PREDICTED: uncharacterized protein LOC103980386 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=680

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+ FLHK+WIM QWEKN+YISS+AGA NGSSLVVMSKGTPY QQSYKVSESFPFK
Sbjct  504  QVYELSASFLHKEWIMEQWEKNYYISSLAGADNGSSLVVMSKGTPYAQQSYKVSESFPFK  563

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAG+RW VVMSRNAG+ EQVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  564  WINKKWREGFYVTAMATAGNRWAVVMSRNAGFLEQVVELDFLYPSEGIHRRWDSGYRITA  623

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK +DETQETLRTSAFPS HVKEKW+KNLY+AS+CYGRTV
Sbjct  624  TAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSQHVKEKWAKNLYLASVCYGRTV  679



>ref|XP_004142151.1| PREDICTED: uncharacterized protein LOC101213194 [Cucumis sativus]
 ref|XP_008449783.1| PREDICTED: uncharacterized protein LOC103491568 [Cucumis melo]
 gb|KGN54092.1| hypothetical protein Csa_4G285680 [Cucumis sativus]
Length=694

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  518  QVYELSPYFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  577

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  578  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  637

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  638  TAATWDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  693



>ref|XP_010047289.1| PREDICTED: uncharacterized protein LOC104436263 [Eucalyptus grandis]
 gb|KCW79164.1| hypothetical protein EUGRSUZ_C00608 [Eucalyptus grandis]
Length=605

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS FLHK+WIM QWEKN+YI+++AGA+NGSSLVVMSKGTPY QQSYKVS+SFPFK
Sbjct  429  QVYELSSYFLHKEWIMEQWEKNYYITAVAGASNGSSLVVMSKGTPYLQQSYKVSDSFPFK  488

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAG+RW V+MSR AG+++QVVELDFLYPSEGIHRRW+ GYRITS
Sbjct  489  WINKKWREGFYVTSMATAGTRWAVIMSRGAGFTDQVVELDFLYPSEGIHRRWDCGYRITS  548

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQ+A ILSIPRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  549  TAATLDQSALILSIPRRKPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  604


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -3

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + I+K  ++G  ++S+ +  + W ++M    G+S+QV EL   FL+  E I
Sbjct  385  YNVADIRLSQHIDKGNEDGLFISSVASCSNLWALIMDAGTGFSDQVYELSSYFLH-KEWI  443

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y IT++A  ++ ++ ++     K     Q++ + S +FP   + +KW +  Y+
Sbjct  444  MEQWEKNYYITAVAGASNGSSLVV---MSKGTPYLQQSYKVSDSFPFKWINKKWREGFYV  500

Query  260  ASI  252
             S+
Sbjct  501  TSM  503



>gb|KDO79864.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=512

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  336  QVYELSPYFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFK  395

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  396  WINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  455

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  456  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  511



>gb|KJB56821.1| hypothetical protein B456_009G137100 [Gossypium raimondii]
Length=719

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NG SLVVMSKGT Y QQSYKVSESFPFK
Sbjct  543  QVYELSPYFLHKEWIMEQWEKNYYISAIAGATNGGSLVVMSKGTSYLQQSYKVSESFPFK  602

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  603  WINKKWREGFHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITA  662

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRR+  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  663  TAATWDQAAFVLSVPRRRPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  718



>ref|XP_010249522.1| PREDICTED: uncharacterized protein LOC104592067 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   298 bits (762),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  517  QVYELSPCFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFK  576

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGSRWGVVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  577  WINKKWREGFYVTSMATAGSRWGVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITA  636

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVK+KW+KNLYIAS+CYGRTV
Sbjct  637  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKDKWAKNLYIASVCYGRTV  692



>ref|XP_010257513.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257516.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257517.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
Length=726

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  550  QVYELSPYFLHKEWIMEQWEKNYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFK  609

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  610  WINKKWREGFHVTSMATAGSRWGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  669

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  670  TAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLASLCYGRTV  725



>gb|KDP44321.1| hypothetical protein JCGZ_19188 [Jatropha curcas]
Length=710

 Score =   298 bits (763),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY++S  FLHK+WIM QWEKN+YISSIAG+ NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  534  QVYEMSPFFLHKEWIMEQWEKNYYISSIAGSNNGSSLVVMSKGTQYTQQSYKVSDSFPFK  593

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS
Sbjct  594  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITS  653

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  654  TAATLDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  709



>ref|XP_004162011.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213194 
[Cucumis sativus]
Length=694

 Score =   298 bits (762),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  518  QVYELSPYFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  577

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  578  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  637

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  638  TAATWDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  693



>ref|XP_008338530.1| PREDICTED: casein kinase I homolog 2-like [Malus domestica]
Length=538

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  362  QVYELSPFFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  421

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  422  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITS  481

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  482  TAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  537



>ref|XP_010249521.1| PREDICTED: uncharacterized protein LOC104592067 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   298 bits (762),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  521  QVYELSPCFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFK  580

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGSRWGVVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  581  WINKKWREGFYVTSMATAGSRWGVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITA  640

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVK+KW+KNLYIAS+CYGRTV
Sbjct  641  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKDKWAKNLYIASVCYGRTV  696



>ref|XP_010267169.1| PREDICTED: uncharacterized protein LOC104604501 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   298 bits (762),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  517  QVYELSSFFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFK  576

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGSRW VVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  577  WINKKWREGFYVTSMATAGSRWAVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITA  636

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  637  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  692



>emb|CBI36074.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  430  QVYELSPYFLHKEWIMEQWEKNFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFK  489

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM T+GSRWGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+
Sbjct  490  WINKKWREGFYVTSMATSGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITA  549

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  550  TAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  605



>emb|CAN69523.1| hypothetical protein VITISV_040873 [Vitis vinifera]
Length=670

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWE+NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  494  QVYELSPFFLHKEWIMEQWERNFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  553

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  554  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  613

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQ+A ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  614  TAATWDQSALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  669



>gb|KJB21848.1| hypothetical protein B456_004G018000 [Gossypium raimondii]
Length=704

 Score =   298 bits (762),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAG+ +G+SLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  528  QVYELSPSFLHKEWIMDQWEKNYYISSIAGSNSGNSLVVMSKGTQYTQQSYKVSDSFPFK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSMTTAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  588  WINKKWREGFYVTSMTTAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILSIP+RK  DETQETLRTS FPS HVKEKW+KNLY+A +CYGRTV
Sbjct  648  TAATLDQAALILSIPKRKPGDETQETLRTSQFPSIHVKEKWAKNLYLACLCYGRTV  703



>emb|CDP13154.1| unnamed protein product [Coffea canephora]
Length=601

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QV+++S  FLHK+WIM QW+KN+YIS +AGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  425  QVFEISPFFLHKEWIMDQWDKNYYISCLAGATNGSSLVVMSKGTMYNQQSYKVSDSFPFK  484

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM TAG+RW VVMSRN+G+S+QVVELDFLYPSEGIH+RW+SGYRIT+
Sbjct  485  WINKKWKEGFHVTSMATAGTRWAVVMSRNSGFSDQVVELDFLYPSEGIHKRWDSGYRITA  544

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQAA ILS+PRRK++DETQETLRTS FPSTHVKEKW+KNLY+AS+CYGRTVC
Sbjct  545  TAATWDQAALILSVPRRKLLDETQETLRTSQFPSTHVKEKWAKNLYLASLCYGRTVC  601



>ref|XP_008655737.1| PREDICTED: uncharacterized protein LOC103634938 [Zea mays]
 gb|AFW80326.1| hypothetical protein ZEAMMB73_054184 [Zea mays]
 gb|AFW80327.1| hypothetical protein ZEAMMB73_054184 [Zea mays]
Length=332

 Score =   286 bits (733),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS+ FLHK+WIM QWE+NFYI+++AGA NGSSLV+MS+GT Y QQSYKVS++FPFK
Sbjct  156  QVYELSNYFLHKEWIMEQWERNFYITALAGANNGSSLVIMSRGTQYAQQSYKVSDTFPFK  215

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VT+M TAGSRW VVMSRNAG++ QVVELDFLYPSEGIH RW++GYRIT+
Sbjct  216  WINKKWKEGFYVTAMATAGSRWAVVMSRNAGFTSQVVELDFLYPSEGIHMRWDNGYRITA  275

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVK+KWSKNLY+ASICYGR+V
Sbjct  276  TAATWDQAAFILSIPRRKPSDETQETLRTSAFPSQHVKDKWSKNLYLASICYGRSV  331



>gb|EMT06030.1| Casein kinase I-2-like protein [Aegilops tauschii]
Length=597

 Score =   295 bits (754),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHKDWIM QWEKNFYISS+AGA  GSSLVVMSKGTPYTQQSYKVS+SFPFK
Sbjct  421  QVYELSPHFLHKDWIMEQWEKNFYISSVAGANIGSSLVVMSKGTPYTQQSYKVSDSFPFK  480

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VTSM T+GSRW +VMSRNAG+++QVVELDFLYPSEG+HRRW++GYRIT+
Sbjct  481  WINKKWKEGFYVTSMATSGSRWAIVMSRNAGFTDQVVELDFLYPSEGVHRRWDNGYRITA  540

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQ+A ILS+PRR+  DETQETLRTS FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  541  MAATMDQSALILSMPRRRPRDETQETLRTSQFPSAHVKDKWAKNLYLAGICYGRTVA  597



>ref|XP_008352012.1| PREDICTED: uncharacterized protein LOC103415457 [Malus domestica]
Length=677

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QW+KN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFK
Sbjct  501  QVYELSPYFLHKEWIMEQWDKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFK  560

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVT+M TAGSRW +VMSR AG+SEQVVELDFLYPSEGIHRRW++GYRITS
Sbjct  561  WINKKWREGFHVTAMATAGSRWAIVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGYRITS  620

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  621  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  676



>ref|XP_002531638.1| casein kinase, putative [Ricinus communis]
 gb|EEF30734.1| casein kinase, putative [Ricinus communis]
Length=703

 Score =   297 bits (761),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  527  QVYELSPFFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  586

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS
Sbjct  587  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITS  646

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+PRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  647  TAATFDQAALILSVPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  702



>tpg|DAA54809.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=346

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS FLHK+WIM QW+K+FYISS+AG+ NGSS+VVMSKGTPYTQQSYKVS+SFPFK
Sbjct  170  QVYELSSHFLHKEWIMEQWDKSFYISSVAGSNNGSSIVVMSKGTPYTQQSYKVSDSFPFK  229

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVT+M T+G+RW +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G+RIT+
Sbjct  230  WINKKWKEGFHVTAMATSGNRWAIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITA  289

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            MAAT DQ+A ILS PRR+  DETQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV
Sbjct  290  MAATMDQSALILSKPRRRPRDETQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTV  345



>gb|ACO87665.1| protein kinase [Brachypodium sylvaticum]
Length=648

 Score =   296 bits (757),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHKDWIM QWEKNFYISS+AG+ NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  472  QVYQLSPHFLHKDWIMEQWEKNFYISSVAGSNNGSSLVVMSKGTPYTQQSYKVSESFPFK  531

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VTSM T+GSRW +VMSRNAG+++QVVELDFLYPSEGIH+RW++GYRIT+
Sbjct  532  WINKKWKEGFYVTSMATSGSRWAIVMSRNAGFTDQVVELDFLYPSEGIHKRWDNGYRITA  591

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQ+A ILS+PRR+  DETQETLRTS FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  592  MAATMDQSALILSMPRRRPRDETQETLRTSQFPSAHVKDKWAKNLYLAGICYGRTVA  648



>gb|KHG14825.1| hypothetical protein F383_08945 [Gossypium arboreum]
Length=719

 Score =   297 bits (761),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NG SLVVMSKGT Y QQSYKVSESFPFK
Sbjct  543  QVYELSPYFLHKEWIMEQWEKNYYISAIAGATNGGSLVVMSKGTSYLQQSYKVSESFPFK  602

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW++GYRIT+
Sbjct  603  WINKKWREGFHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITA  662

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRR+  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  663  TAATWDQAAFVLSVPRRRPTDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  718



>ref|XP_002283346.1| PREDICTED: uncharacterized protein LOC100263956 [Vitis vinifera]
Length=714

 Score =   297 bits (761),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWE+NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  538  QVYELSPFFLHKEWIMEQWERNFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  597

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  598  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  657

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQ+A ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  658  TAATWDQSALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  713



>ref|XP_008791563.1| PREDICTED: uncharacterized protein LOC103708420 [Phoenix dactylifera]
Length=683

 Score =   296 bits (759),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKNFYIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  507  QVYELSPCFLHKEWIMEQWEKNFYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFK  566

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VT+M TAG+RW VVMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRIT+
Sbjct  567  WINKKWKEGFYVTAMATAGTRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITA  626

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  627  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSQHVKEKWAKNLYIASICYGRTV  682



>ref|XP_004491691.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Cicer arietinum]
Length=667

 Score =   296 bits (758),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+SIAG  NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  491  QVYKLSPFFLHKEWIMEQWEKNYYITSIAGVTNGSSLVVMSKGTQYTQQSYKVSDSFPFK  550

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+
Sbjct  551  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITA  610

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
             AAT DQ+A ILS PRR+  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  611  TAATWDQSALILSKPRRRPADETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  667



>ref|XP_002283957.2| PREDICTED: uncharacterized protein LOC100253221 [Vitis vinifera]
Length=704

 Score =   297 bits (760),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  528  QVYELSPYFLHKEWIMEQWEKNFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFK  587

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM T+GSRWGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+
Sbjct  588  WINKKWREGFYVTSMATSGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITA  647

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  648  TAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  703



>emb|CAN77676.1| hypothetical protein VITISV_013722 [Vitis vinifera]
Length=710

 Score =   297 bits (760),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  534  QVYELSPYFLHKEWIMEQWEKNFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFK  593

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM T+GSRWGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+
Sbjct  594  WINKKWREGFYVTSMATSGSRWGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITA  653

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  654  TAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  709



>ref|XP_009406168.1| PREDICTED: uncharacterized protein LOC103989128 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QW+KN+YI+++AGA N SSLVVMSKGT Y QQSYKVSESFPFK
Sbjct  509  QVYELSPNFLHKEWIMDQWDKNYYITALAGANNVSSLVVMSKGTQYVQQSYKVSESFPFK  568

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAG+RWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRIT+
Sbjct  569  WINKKWREGFYVTAMATAGTRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITA  628

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  629  TAATMDQAAFVLSVPRRKPTDETQETLRTSAFPSQHVKEKWAKNLYIASVCYGRTV  684



>ref|XP_002516524.1| casein kinase, putative [Ricinus communis]
 gb|EEF45865.1| casein kinase, putative [Ricinus communis]
Length=671

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKNFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  495  QVYELSPYFLHKEWIMEQWEKNFYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFK  554

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  555  WINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  614

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  615  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  670



>ref|XP_009388687.1| PREDICTED: casein kinase I isoform delta-like [Musa acuminata 
subsp. malaccensis]
Length=601

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS +FLHK+WIM QWEKN+YI+++AGA NGSSLVVMS+GTPY QQSYKVS+SFPFK
Sbjct  425  QVYELSPLFLHKEWIMEQWEKNYYITALAGANNGSSLVVMSRGTPYAQQSYKVSDSFPFK  484

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF VT+M TAG+RW VVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  485  WINKKWKEGFFVTAMATAGTRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITA  544

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LSIP+RK  DETQETLRTSAFPS HVK+KW+KNLYI+SICYGRTV
Sbjct  545  TAATWDQAAFVLSIPKRKPPDETQETLRTSAFPSQHVKDKWAKNLYISSICYGRTV  600



>ref|XP_006853659.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
 gb|ERN15126.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
Length=703

 Score =   296 bits (757),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            Q Y+LS+ FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS++FPFK
Sbjct  527  QAYELSNCFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDTFPFK  586

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF VTSM TAGSRWGVVMSRNAG+++QVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  587  WINKKWREGFFVTSMATAGSRWGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDSGYRITA  646

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PR+K  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  647  TAATWDQAAFVLSVPRKKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  702



>ref|XP_007024285.1| Kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY26907.1| Kinase family protein isoform 2 [Theobroma cacao]
Length=483

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 162/176 (92%), Gaps = 2/176 (1%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NG SLVVMS+GT Y+QQSYKVSESFPFK
Sbjct  309  QVYELSPHFLHKEWIMEQWEKNYYISAIAGATNGFSLVVMSRGTQYSQQSYKVSESFPFK  368

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGFHVTSM T+GSRWGVVMSR AG+S+QVVELDFLYPSEGIHRRW+ GYRIT+
Sbjct  369  WINKKWKEGFHVTSMATSGSRWGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDCGYRITA  428

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK MDETQETLRTSAFPSTHV  KW+KNLYIAS+CYGRTV
Sbjct  429  TAATWDQAAFVLSVPRRKPMDETQETLRTSAFPSTHV--KWAKNLYIASVCYGRTV  482



>ref|XP_003577056.1| PREDICTED: uncharacterized protein LOC100836999 [Brachypodium 
distachyon]
Length=644

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHKDWIM QWEKNFYISS+AG+ NGSSLVVMSKGTPYTQQSYKVSESFPFK
Sbjct  468  QVYQLSPHFLHKDWIMEQWEKNFYISSVAGSNNGSSLVVMSKGTPYTQQSYKVSESFPFK  527

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VTSM T+G RW +VMSRNAG+++QVVELDFLYPSEGIH+RW++GYRIT+
Sbjct  528  WINKKWKEGFYVTSMATSGGRWAIVMSRNAGFTDQVVELDFLYPSEGIHKRWDNGYRITA  587

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            MAAT DQ+A ILS+PRR+  DETQETLRTS FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  588  MAATMDQSALILSMPRRRPRDETQETLRTSQFPSAHVKDKWAKNLYLAGICYGRTVA  644



>ref|XP_007208054.1| hypothetical protein PRUPE_ppa002206mg [Prunus persica]
 gb|EMJ09253.1| hypothetical protein PRUPE_ppa002206mg [Prunus persica]
Length=701

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  525  QVYELSPFFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  584

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS
Sbjct  585  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITS  644

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  645  TAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  700



>ref|XP_008338507.1| PREDICTED: uncharacterized protein LOC103401567 isoform X2 [Malus 
domestica]
Length=699

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  523  QVYELSPFFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  582

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  583  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITS  642

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  643  TAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  698



>ref|XP_008338505.1| PREDICTED: uncharacterized protein LOC103401567 isoform X1 [Malus 
domestica]
Length=699

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  523  QVYELSPFFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  582

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  583  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITS  642

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  643  TAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  698



>ref|XP_008390151.1| PREDICTED: uncharacterized protein LOC103452441 [Malus domestica]
Length=697

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  521  QVYELSPFFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  580

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS
Sbjct  581  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITS  640

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  641  TAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  696



>ref|XP_009375296.1| PREDICTED: uncharacterized protein LOC103964127 [Pyrus x bretschneideri]
Length=697

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  521  QVYELSPFFLHKEWIMEQWEKNYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFK  580

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS
Sbjct  581  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITS  640

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  641  TAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  696



>ref|XP_009364099.1| PREDICTED: uncharacterized protein LOC103954016 [Pyrus x bretschneideri]
Length=699

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  523  QVYELSPFFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  582

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+RITS
Sbjct  583  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITS  642

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  643  TAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  698



>gb|KJB07481.1| hypothetical protein B456_001G026300 [Gossypium raimondii]
Length=485

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  309  QVYELSPYFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFK  368

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAGSRW +VMSR A +S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  369  WINKKWREGFYVTAMATAGSRWAIVMSRGAPFSDQVVELDFLYPSEGIHRRWDSGYRITS  428

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  429  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  484



>emb|CBI20566.3| unnamed protein product [Vitis vinifera]
Length=604

 Score =   293 bits (749),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFK
Sbjct  428  QVYELSPYFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFK  487

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRIT+
Sbjct  488  WINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITA  547

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  548  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  603



>ref|XP_011019588.1| PREDICTED: uncharacterized protein LOC105122267 isoform X2 [Populus 
euphratica]
Length=483

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  307  QVYELSPYFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFK  366

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAGSRW +VMSR  G+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  367  WINKKWREGFYVTTMATAGSRWAIVMSRGTGFSDQVVELDFLYPSEGIHRRWDSGYRITS  426

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK +DETQETLRTSAFPSTHVKEKW+ NLYIAS+CYGRTV
Sbjct  427  TAATWDQAAFVLSVPRRKPVDETQETLRTSAFPSTHVKEKWATNLYIASVCYGRTV  482



>emb|CDY21505.1| BnaC03g26920D [Brassica napus]
Length=615

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFK
Sbjct  439  QVYQLSPSFLHKEWIMEQWEKNYYITAVAGADNGSSFVVMSKGTPYLQQSYKVSDSFPFK  498

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  499  WINKKWREGFYVTSMATAGSKWGIVMSRGAAFSDQVVELDFLYPSEGIHRRWDNGYRITS  558

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +AAT DQAAF+LS+PRRK  DETQETLRTSAFPS HVKEKWSKNLYI+SICYGRTV
Sbjct  559  IAATWDQAAFVLSVPRRKPTDETQETLRTSAFPSNHVKEKWSKNLYISSICYGRTV  614



>ref|XP_008445007.1| PREDICTED: uncharacterized protein LOC103488176 [Cucumis melo]
Length=699

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  523  QVYELSPYFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFK  582

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAG RW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  583  WINKKWREGFYVTAMATAGGRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  642

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  643  TAATLDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  698



>gb|KJB21850.1| hypothetical protein B456_004G018100 [Gossypium raimondii]
Length=690

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAG++ GSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  514  QVYELSPSFLHKEWIMDQWEKNYYISSIAGSSGGSSLVVMSKGTQYTQQSYKVSDSFPFK  573

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM T GSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  574  WINKKWREGFYVTSMATTGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  633

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT+DQAA ILSIP+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  634  TAATSDQAALILSIPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  689



>ref|XP_008378069.1| PREDICTED: uncharacterized protein LOC103441148 [Malus domestica]
Length=683

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QW+KN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFK
Sbjct  507  QVYELSPYFLHKEWIMEQWDKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFK  566

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVT+M TAGSRW +VMSR AG+S QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  567  WINKKWREGFHVTAMATAGSRWAIVMSRGAGFSXQVVELDFLYPSEGIHRRWDNGYRITS  626

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  627  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  682



>ref|XP_004294964.1| PREDICTED: uncharacterized protein LOC101294343 [Fragaria vesca 
subsp. vesca]
Length=731

 Score =   295 bits (756),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  555  QVYELSPFFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFK  614

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS
Sbjct  615  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITS  674

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  675  TAATWDQAALILSVPKRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  730



>gb|KHN10182.1| Casein kinase I like 2 [Glycine soja]
Length=606

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  430  QVYELSPHFLHKEWIMEQWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFK  489

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAGSRW +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS
Sbjct  490  WINKKWREGFYVTAMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITS  549

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK  DETQETLRTSAFP THVKEKW+KNLYIASICYGRTV
Sbjct  550  TAATWDQAAFVLSVPRRKPADETQETLRTSAFPGTHVKEKWAKNLYIASICYGRTV  605



>ref|XP_009367436.1| PREDICTED: uncharacterized protein LOC103957076 [Pyrus x bretschneideri]
Length=677

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS FLHK+WIM QW+KN+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  501  QVYELSSYFLHKEWIMEQWDKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFK  560

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVT+M TA SRW +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  561  WINKKWREGFHVTAMATARSRWAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  620

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRRK+ DETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  621  TAATWDQAAFVLSVPRRKLADETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  676



>ref|XP_004517304.1| PREDICTED: uncharacterized protein LOC101495334 [Cicer arietinum]
Length=599

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LSS FLHK+WIM QW+KN+YIS+IAGA+NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  423  QVYELSSSFLHKEWIMEQWDKNYYISAIAGASNGSSLVVMSKGTQYLQQSYKVSDSFPFK  482

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAG+RW +VMSR AGYS+QVVELDFLYPSEGIHRRW++ YRITS
Sbjct  483  WINKKWREGFYVTAMATAGTRWAIVMSRGAGYSDQVVELDFLYPSEGIHRRWDNNYRITS  542

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILS+PRRK  DETQETLRTS FPSTHVKEKWSKNLYIASICYGRTV
Sbjct  543  TAATCDQAAFILSVPRRKPPDETQETLRTSDFPSTHVKEKWSKNLYIASICYGRTV  598



>emb|CDY11509.1| BnaA09g40750D [Brassica napus]
Length=565

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFK
Sbjct  389  QVYQLSPSFLHKEWIMEQWEKNYYITAVAGANNGSSFVVMSKGTPYLQQSYKVSDSFPFK  448

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  449  WINKKWREGFYVTSMATAGSKWGIVMSRGAAFSDQVVELDFLYPSEGIHRRWENGYRITS  508

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +A T DQ+AF+LS+PRRK  DETQETLRTSAFPS HVKEKW KNLYI+SICYGRTV
Sbjct  509  IAGTCDQSAFVLSVPRRKPSDETQETLRTSAFPSNHVKEKWGKNLYISSICYGRTV  564



>ref|XP_010526089.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526090.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526091.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526092.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526093.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526094.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526095.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
Length=601

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM  WEKN+YI++IAGA NGSSLVVMSKGT Y QQSYKVSESFPFK
Sbjct  425  QVYQLSPCFLHKEWIMENWEKNYYITAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFK  484

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGSRW +VMSR AG+S+QVVELDFLYPSEG+HRRW++GYRITS
Sbjct  485  WINKKWREGFYVTSMATAGSRWAIVMSRGAGFSDQVVELDFLYPSEGVHRRWDNGYRITS  544

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +AAT+DQAA +LS+PRRK  DETQETLRTSAFPSTHVKEKW KNLYIA ICYGRTV
Sbjct  545  IAATSDQAALVLSVPRRKPADETQETLRTSAFPSTHVKEKWGKNLYIACICYGRTV  600



>gb|EEC78673.1| hypothetical protein OsI_18806 [Oryza sativa Indica Group]
Length=607

 Score =   292 bits (748),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWE+NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFK
Sbjct  431  QVYELSQHFLHKEWIMDQWERNFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFK  490

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VT+M TAGSRW VVMSRNAG+++QVVELDFLYPSEGIHRRW++G+RIT+
Sbjct  491  WINKKWKEGFYVTAMATAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITA  550

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  551  TAATWDQAAFILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  606



>dbj|BAG92829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62667.1| hypothetical protein OsJ_17470 [Oryza sativa Japonica Group]
Length=607

 Score =   292 bits (748),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWE+NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFK
Sbjct  431  QVYELSQHFLHKEWIMDQWERNFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFK  490

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VT+M TAGSRW VVMSRNAG+++QVVELDFLYPSEGIHRRW++G+RIT+
Sbjct  491  WINKKWKEGFYVTAMATAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITA  550

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  551  TAATWDQAAFILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  606



>ref|XP_008804603.1| PREDICTED: negative regulator of sexual conjugation and meiosis-like 
isoform X3 [Phoenix dactylifera]
Length=524

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFK
Sbjct  348  QVYELSPNFLHKEWIMEQWEKNYYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFK  407

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VT+M TAGSRW VVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+
Sbjct  408  WINKKWREGFYVTAMATAGSRWAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITA  467

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAF+LS+PRR+  DETQETLRTSAFPS HVK+KW+KNLYIAS+CYGRTV
Sbjct  468  TAATWDQAAFVLSVPRRRPADETQETLRTSAFPSQHVKDKWAKNLYIASVCYGRTV  523



>gb|AAT44311.1| putative casein kinase [Oryza sativa Japonica Group]
 gb|AAV59374.1| putative casein kinase [Oryza sativa Japonica Group]
Length=608

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWE+NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFK
Sbjct  432  QVYELSQHFLHKEWIMDQWERNFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFK  491

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VT+M TAGSRW VVMSRNAG+++QVVELDFLYPSEGIHRRW++G+RIT+
Sbjct  492  WINKKWKEGFYVTAMATAGSRWAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITA  551

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAAFILSIPRRK  DETQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  552  TAATWDQAAFILSIPRRKPADETQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  607



>ref|XP_010243375.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
 ref|XP_010243376.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
 ref|XP_010243377.1| PREDICTED: uncharacterized protein LOC104587456 [Nelumbo nucifera]
Length=728

 Score =   295 bits (755),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAG+ NGSSLVVMSKGT YTQQSYKVS+SFPFK
Sbjct  552  QVYELSPYFLHKEWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTQYTQQSYKVSDSFPFK  611

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+++QVVELDFLYPSEGIHRRW++GYRIT 
Sbjct  612  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFNDQVVELDFLYPSEGIHRRWDNGYRITC  671

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQAA ILS+P+RK  DETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTV
Sbjct  672  AAATWDQAALILSVPKRKPSDETQETLRTSQFPSTHVKEKWSKNLYLACVCYGRTV  727



>emb|CDX76739.1| BnaC08g33250D [Brassica napus]
Length=600

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFK
Sbjct  424  QVYQLSPSFLHKEWIMEQWEKNYYITAVAGANNGSSFVVMSKGTPYLQQSYKVSDSFPFK  483

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  484  WINKKWREGFYVTSMATAGSKWGIVMSRGAAFSDQVVELDFLYPSEGIHRRWENGYRITS  543

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +A T DQ+AF+LS+PRRK  DETQETLRTSAFPS HVKEKW KNLYI+SICYGRTV
Sbjct  544  IAGTCDQSAFVLSVPRRKPSDETQETLRTSAFPSNHVKEKWGKNLYISSICYGRTV  599



>ref|XP_009117039.1| PREDICTED: casein kinase I [Brassica rapa]
Length=600

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  FLHK+WIM QWEKN+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFK
Sbjct  424  QVYQLSPSFLHKEWIMEQWEKNYYITAVAGANNGSSFVVMSKGTPYLQQSYKVSDSFPFK  483

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGF+VTSM TAGS+WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+GYRITS
Sbjct  484  WINKKWREGFYVTSMATAGSKWGIVMSRGAAFSDQVVELDFLYPSEGIHRRWENGYRITS  543

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +A T DQ+AF+LS+PRRK  DETQETLRTSAFPS HVKEKW KNLYI+SICYGRTV
Sbjct  544  IAGTCDQSAFVLSVPRRKPSDETQETLRTSAFPSNHVKEKWGKNLYISSICYGRTV  599



>gb|KFK32550.1| hypothetical protein AALP_AA6G257400 [Arabis alpina]
Length=673

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY LS  F HK+WIM QWEKN+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFK
Sbjct  497  QVYQLSLSFFHKEWIMEQWEKNYYITAVAGANNGSSFVVMSKGTPYLQQSYKVSDSFPFK  556

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKWKEGF+VTSM TAGS+WG+VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS
Sbjct  557  WINKKWKEGFYVTSMATAGSKWGIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITS  616

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +AAT DQAA +LS+PRRK  DETQETLRTSAFPSTHVKEKW+KNLYI+S+CYGRTV
Sbjct  617  VAATCDQAALVLSVPRRKPSDETQETLRTSAFPSTHVKEKWAKNLYISSMCYGRTV  672



>ref|XP_010093160.1| Casein kinase I [Morus notabilis]
 gb|EXB53619.1| Casein kinase I [Morus notabilis]
Length=801

 Score =   296 bits (759),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -3

Query  761  QVYDLSSVFLHKDWIMXQWEKNFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFK  582
            QVY+LS  FLHK+WIM QWEKN+YISSIAGA NGSSLVVMSKGT Y+QQSYKVS+SFPFK
Sbjct  625  QVYELSPFFLHKEWIMEQWEKNYYISSIAGANNGSSLVVMSKGTQYSQQSYKVSDSFPFK  684

Query  581  WINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITS  402
            WINKKW+EGFHVTSM TAGSRWGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+
Sbjct  685  WINKKWREGFHVTSMATAGSRWGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITA  744

Query  401  MAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             AAT DQ+A ILSIPRRK  DETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  745  TAATWDQSALILSIPRRKPGDETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  800



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680