BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021D13

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801783.1|  PREDICTED: probable calcium-binding protein ...    296   2e-97   Nicotiana sylvestris
ref|XP_009619227.1|  PREDICTED: probable calcium-binding protein ...    293   2e-96   
ref|XP_009619221.1|  PREDICTED: probable calcium-binding protein ...    293   2e-96   Nicotiana tomentosiformis
ref|XP_009619226.1|  PREDICTED: probable calcium-binding protein ...    293   2e-96   
ref|XP_009619224.1|  PREDICTED: probable calcium-binding protein ...    293   3e-96   
ref|XP_009619225.1|  PREDICTED: probable calcium-binding protein ...    285   5e-93   
ref|XP_010326837.1|  PREDICTED: probable calcium-binding protein ...    266   5e-86   
ref|XP_004247862.1|  PREDICTED: probable calcium-binding protein ...    266   1e-85   Solanum lycopersicum
ref|XP_009374596.1|  PREDICTED: probable calcium-binding protein ...    266   2e-85   Pyrus x bretschneideri [bai li]
ref|XP_009374597.1|  PREDICTED: probable calcium-binding protein ...    265   2e-85   Pyrus x bretschneideri [bai li]
ref|XP_008380562.1|  PREDICTED: probable calcium-binding protein ...    263   2e-84   Malus domestica [apple tree]
ref|XP_008380563.1|  PREDICTED: probable calcium-binding protein ...    262   3e-84   Malus domestica [apple tree]
ref|XP_006366840.1|  PREDICTED: probable calcium-binding protein ...    263   4e-84   Solanum tuberosum [potatoes]
ref|XP_007034372.1|  Calcium-binding EF-hand family protein isofo...    258   8e-83   
ref|XP_008224499.1|  PREDICTED: probable calcium-binding protein ...    258   1e-82   Prunus mume [ume]
ref|XP_007223706.1|  hypothetical protein PRUPE_ppa010393mg             258   2e-82   Prunus persica
ref|XP_002266666.1|  PREDICTED: probable calcium-binding protein ...    253   9e-81   Vitis vinifera
ref|XP_010650356.1|  PREDICTED: probable calcium-binding protein ...    253   1e-80   Vitis vinifera
ref|XP_008438356.1|  PREDICTED: probable calcium-binding protein ...    249   1e-79   Cucumis melo [Oriental melon]
gb|KJB72094.1|  hypothetical protein B456_011G158400                    249   3e-79   Gossypium raimondii
ref|XP_004133997.1|  PREDICTED: probable calcium-binding protein ...    249   3e-79   
ref|XP_004299109.1|  PREDICTED: probable calcium-binding protein ...    249   5e-79   Fragaria vesca subsp. vesca
gb|KDP39372.1|  hypothetical protein JCGZ_01129                         248   5e-79   Jatropha curcas
gb|KHG12326.1|  putative calcium-binding CML22 -like protein            248   9e-79   Gossypium arboreum [tree cotton]
ref|XP_011045652.1|  PREDICTED: probable calcium-binding protein ...    248   2e-78   Populus euphratica
ref|XP_002300172.2|  hypothetical protein POPTR_0001s32210g             246   5e-78   
ref|XP_006493813.1|  PREDICTED: probable calcium-binding protein ...    244   1e-77   
ref|XP_006493812.1|  PREDICTED: probable calcium-binding protein ...    244   2e-77   Citrus sinensis [apfelsine]
gb|KDO61178.1|  hypothetical protein CISIN_1g0262681mg                  244   2e-77   Citrus sinensis [apfelsine]
ref|XP_006420904.1|  hypothetical protein CICLE_v10005743mg             243   9e-77   Citrus clementina [clementine]
emb|CDO99460.1|  unnamed protein product                                241   2e-76   Coffea canephora [robusta coffee]
ref|XP_010241365.1|  PREDICTED: probable calcium-binding protein ...    241   6e-76   Nelumbo nucifera [Indian lotus]
ref|XP_010650355.1|  PREDICTED: probable calcium-binding protein ...    240   2e-75   Vitis vinifera
gb|KJB72093.1|  hypothetical protein B456_011G158400                    234   2e-73   Gossypium raimondii
ref|XP_002518103.1|  conserved hypothetical protein                     232   2e-72   
gb|EYU32662.1|  hypothetical protein MIMGU_mgv1a012635mg                231   4e-72   Erythranthe guttata [common monkey flower]
gb|KCW60054.1|  hypothetical protein EUGRSUZ_H02783                     214   1e-65   Eucalyptus grandis [rose gum]
ref|XP_007034374.1|  Calcium-binding EF-hand family protein isofo...    213   2e-65   
ref|XP_010513185.1|  PREDICTED: probable calcium-binding protein ...    213   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010023705.1|  PREDICTED: probable calcium-binding protein ...    214   4e-65   Eucalyptus grandis [rose gum]
gb|KFK39709.1|  hypothetical protein AALP_AA3G278300                    210   6e-64   Arabis alpina [alpine rockcress]
ref|XP_007034373.1|  Calcium-binding EF-hand family protein isofo...    209   9e-64   
ref|XP_010466782.1|  PREDICTED: probable calcium-binding protein ...    209   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_008778084.1|  PREDICTED: probable calcium-binding protein ...    209   2e-63   Phoenix dactylifera
ref|XP_010532790.1|  PREDICTED: probable calcium-binding protein ...    208   3e-63   Tarenaya hassleriana [spider flower]
ref|NP_189053.1|  putative calcium-binding protein CML22                208   4e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010107777.1|  putative calcium-binding protein CML22             207   7e-63   
ref|XP_010909319.1|  PREDICTED: probable calcium-binding protein ...    207   1e-62   Elaeis guineensis
ref|XP_010532789.1|  PREDICTED: probable calcium-binding protein ...    207   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_010488497.1|  PREDICTED: probable calcium-binding protein ...    205   5e-62   Camelina sativa [gold-of-pleasure]
gb|KHN01846.1|  Putative calcium-binding protein CML22                  203   9e-62   Glycine soja [wild soybean]
ref|XP_006418801.1|  hypothetical protein EUTSA_v10002654mg             203   2e-61   
ref|XP_003530839.1|  PREDICTED: probable calcium-binding protein ...    202   3e-61   Glycine max [soybeans]
ref|XP_007140756.1|  hypothetical protein PHAVU_008G139100g             199   1e-59   Phaseolus vulgaris [French bean]
gb|AFK36647.1|  unknown                                                 198   2e-59   Lotus japonicus
emb|CDY18071.1|  BnaA01g23320D                                          198   2e-59   Brassica napus [oilseed rape]
ref|XP_009106153.1|  PREDICTED: probable calcium-binding protein ...    198   2e-59   Brassica rapa
emb|CDY46335.1|  BnaC01g30350D                                          198   3e-59   Brassica napus [oilseed rape]
ref|XP_003563635.1|  PREDICTED: probable calcium-binding protein ...    197   7e-59   Brachypodium distachyon [annual false brome]
ref|XP_009406355.1|  PREDICTED: probable calcium-binding protein ...    198   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004509621.1|  PREDICTED: probable calcium-binding protein ...    196   1e-58   Cicer arietinum [garbanzo]
gb|EMT01046.1|  Putative calcium-binding protein CML21                  196   2e-58   
ref|XP_009409857.1|  PREDICTED: probable calcium-binding protein ...    195   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX85172.1|  BnaC07g07340D                                          203   4e-58   
gb|KEH22469.1|  calcium-binding EF-hand protein                         194   4e-58   Medicago truncatula
gb|KEH22470.1|  calcium-binding EF-hand protein                         195   6e-58   Medicago truncatula
emb|CDX77458.1|  BnaA07g05960D                                          194   6e-58   
ref|XP_009102545.1|  PREDICTED: probable calcium-binding protein ...    194   7e-58   Brassica rapa
gb|KHG01864.1|  putative calcium-binding CML21 -like protein            194   7e-58   Gossypium arboreum [tree cotton]
ref|XP_009102544.1|  PREDICTED: probable calcium-binding protein ...    195   7e-58   
gb|KJB11853.1|  hypothetical protein B456_002G104000                    194   8e-58   Gossypium raimondii
ref|XP_010691275.1|  PREDICTED: probable calcium-binding protein ...    194   1e-57   
ref|XP_010691270.1|  PREDICTED: probable calcium-binding protein ...    194   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008794706.1|  PREDICTED: probable calcium-binding protein ...    193   2e-57   Phoenix dactylifera
gb|KHG00196.1|  putative calcium-binding CML21 -like protein            191   7e-57   Gossypium arboreum [tree cotton]
ref|XP_008782977.1|  PREDICTED: probable calcium-binding protein ...    191   7e-57   Phoenix dactylifera
ref|XP_003628953.1|  hypothetical protein MTR_8g070510                  190   1e-56   
gb|EMS55923.1|  putative calcium-binding protein CML21                  191   2e-56   Triticum urartu
gb|AFJ15127.1|  putative calcium-binding protein CML21                  190   2e-56   Camellia sinensis [black tea]
gb|ACN85246.1|  calcium ion binding protein                             190   2e-56   Oryza officinalis
gb|AET03429.2|  EF hand calcium-binding family protein                  190   3e-56   Medicago truncatula
gb|ACN85218.1|  calcium ion binding protein                             190   3e-56   Oryza punctata
ref|XP_003628952.1|  hypothetical protein MTR_8g070510                  190   3e-56   
gb|ACN85259.1|  calcium ion binding protein                             190   3e-56   Oryza alta
ref|XP_006584629.1|  PREDICTED: uncharacterized protein LOC100820...    190   3e-56   Glycine max [soybeans]
ref|XP_010913274.1|  PREDICTED: probable calcium-binding protein ...    190   4e-56   
ref|XP_006857595.1|  hypothetical protein AMTR_s00061p00095500          189   4e-56   Amborella trichopoda
ref|XP_010928993.1|  PREDICTED: probable calcium-binding protein ...    189   4e-56   Elaeis guineensis
ref|XP_002883485.1|  calcium-binding EF hand family protein             188   1e-55   
ref|XP_006656237.1|  PREDICTED: probable calcium-binding protein ...    188   1e-55   Oryza brachyantha
ref|XP_003547815.1|  PREDICTED: probable calcium-binding protein ...    188   2e-55   Glycine max [soybeans]
gb|ACN85272.1|  calcium ion binding protein                             187   2e-55   Oryza alta
ref|XP_006370792.1|  hypothetical protein POPTR_0001s47510g             187   3e-55   Populus trichocarpa [western balsam poplar]
gb|ACN85168.1|  calcium ion binding protein                             187   3e-55   Oryza sativa f. spontanea
ref|NP_001058046.1|  Os06g0609600                                       187   4e-55   
gb|ACN85201.1|  calcium ion binding protein                             186   6e-55   Oryza glaberrima
gb|ACN85332.1|  calcium ion binding protein                             186   9e-55   Oryza meyeriana var. granulata
ref|XP_002438663.1|  hypothetical protein SORBIDRAFT_10g023890          186   1e-54   Sorghum bicolor [broomcorn]
ref|XP_010244812.1|  PREDICTED: probable calcium-binding protein ...    185   2e-54   Nelumbo nucifera [Indian lotus]
ref|NP_001242483.1|  uncharacterized protein LOC100820628               185   4e-54   Glycine max [soybeans]
ref|XP_004965909.1|  PREDICTED: probable calcium-binding protein ...    184   4e-54   Setaria italica
ref|XP_007156300.1|  hypothetical protein PHAVU_003G275000g             184   4e-54   Phaseolus vulgaris [French bean]
ref|XP_008449066.1|  PREDICTED: probable calcium-binding protein ...    184   8e-54   Cucumis melo [Oriental melon]
emb|CDP13649.1|  unnamed protein product                                184   8e-54   Coffea canephora [robusta coffee]
gb|EEC78513.1|  hypothetical protein OsI_18448                          184   9e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_011039863.1|  PREDICTED: probable calcium-binding protein ...    184   9e-54   Populus euphratica
ref|XP_002268527.1|  PREDICTED: probable calcium-binding protein ...    183   1e-53   Vitis vinifera
gb|KDP36321.1|  hypothetical protein JCGZ_09536                         182   2e-53   Jatropha curcas
emb|CAN71481.1|  hypothetical protein VITISV_006244                     183   3e-53   Vitis vinifera
ref|XP_007020327.1|  Calcium-binding EF-hand family protein             182   3e-53   
ref|XP_002532937.1|  Troponin C, skeletal muscle, putative              182   4e-53   Ricinus communis
ref|XP_010644632.1|  PREDICTED: probable calcium-binding protein ...    182   5e-53   Vitis vinifera
ref|NP_001132390.1|  uncharacterized protein LOC100193836               180   2e-52   Zea mays [maize]
ref|XP_010676135.1|  PREDICTED: probable calcium-binding protein ...    180   2e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010092394.1|  putative calcium-binding protein CML21             180   3e-52   Morus notabilis
ref|XP_004149571.1|  PREDICTED: probable calcium-binding protein ...    179   3e-52   Cucumis sativus [cucumbers]
ref|XP_009346680.1|  PREDICTED: probable calcium-binding protein ...    179   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_008805537.1|  PREDICTED: probable calcium-binding protein ...    179   3e-52   
ref|XP_011097697.1|  PREDICTED: probable calcium-binding protein ...    179   5e-52   Sesamum indicum [beniseed]
ref|XP_008384627.1|  PREDICTED: probable calcium-binding protein ...    179   6e-52   Malus domestica [apple tree]
ref|XP_011095629.1|  PREDICTED: probable calcium-binding protein ...    178   9e-52   Sesamum indicum [beniseed]
ref|XP_008353863.1|  PREDICTED: probable calcium-binding protein ...    178   1e-51   Malus domestica [apple tree]
ref|XP_006654041.1|  PREDICTED: probable calcium-binding protein ...    178   1e-51   Oryza brachyantha
ref|XP_006647028.1|  PREDICTED: probable calcium-binding protein ...    178   1e-51   Oryza brachyantha
ref|XP_010063214.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    178   2e-51   Eucalyptus grandis [rose gum]
ref|NP_001046205.1|  Os02g0198200                                       178   2e-51   
gb|EEC72684.1|  hypothetical protein OsI_06250                          178   2e-51   Oryza sativa Indica Group [Indian rice]
ref|NP_001148425.1|  calcium ion binding protein                        177   2e-51   Zea mays [maize]
ref|XP_004951561.1|  PREDICTED: probable calcium-binding protein ...    177   2e-51   Setaria italica
gb|AFW66169.1|  calcium ion binding protein                             177   3e-51   
ref|XP_010327214.1|  PREDICTED: probable calcium-binding protein ...    177   3e-51   Solanum lycopersicum
ref|XP_002451725.1|  hypothetical protein SORBIDRAFT_04g006670          177   4e-51   Sorghum bicolor [broomcorn]
ref|XP_008219144.1|  PREDICTED: probable calcium-binding protein ...    177   4e-51   Prunus mume [ume]
ref|XP_006352556.1|  PREDICTED: probable calcium-binding protein ...    177   4e-51   Solanum tuberosum [potatoes]
gb|ABK22178.1|  unknown                                                 177   4e-51   Picea sitchensis
ref|XP_007205832.1|  hypothetical protein PRUPE_ppa010999mg             177   5e-51   Prunus persica
ref|XP_010231716.1|  PREDICTED: probable calcium-binding protein ...    176   5e-51   Brachypodium distachyon [annual false brome]
ref|XP_008358900.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    176   6e-51   
ref|XP_004294881.1|  PREDICTED: probable calcium-binding protein ...    176   7e-51   Fragaria vesca subsp. vesca
ref|XP_003568950.2|  PREDICTED: probable calcium-binding protein ...    177   8e-51   Brachypodium distachyon [annual false brome]
ref|XP_010233984.1|  PREDICTED: probable calcium-binding protein ...    176   1e-50   Brachypodium distachyon [annual false brome]
gb|EYU33744.1|  hypothetical protein MIMGU_mgv1a013136mg                175   2e-50   Erythranthe guttata [common monkey flower]
ref|NP_001131792.1|  calcium ion binding protein                        175   2e-50   Zea mays [maize]
gb|EMT21140.1|  Putative calcium-binding protein CML21                  175   2e-50   
ref|XP_003571276.1|  PREDICTED: probable calcium-binding protein ...    176   3e-50   Brachypodium distachyon [annual false brome]
ref|XP_009608207.1|  PREDICTED: probable calcium-binding protein ...    174   3e-50   Nicotiana tomentosiformis
ref|XP_009379121.1|  PREDICTED: probable calcium-binding protein ...    174   3e-50   Pyrus x bretschneideri [bai li]
ref|XP_004960294.1|  PREDICTED: probable calcium-binding protein ...    174   9e-50   Setaria italica
ref|XP_002300587.1|  calcium-binding EF hand family protein             174   1e-49   
ref|XP_002447440.1|  hypothetical protein SORBIDRAFT_06g001080          173   1e-49   
ref|XP_009776689.1|  PREDICTED: probable calcium-binding protein ...    172   4e-49   Nicotiana sylvestris
dbj|BAK07400.1|  predicted protein                                      170   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010545296.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    169   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_006474771.1|  PREDICTED: probable calcium-binding protein ...    169   3e-48   Citrus sinensis [apfelsine]
ref|XP_006452756.1|  hypothetical protein CICLE_v10009385mg             169   3e-48   Citrus clementina [clementine]
ref|XP_004516273.1|  PREDICTED: probable calcium-binding protein ...    169   4e-48   
ref|XP_002869609.1|  calcium ion binding protein                        168   1e-47   
ref|NP_194377.2|  putative calcium-binding protein CML21                168   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285834.1|  hypothetical protein CARUB_v10007314mg             167   2e-47   Capsella rubella
ref|NP_001148758.1|  calcium ion binding protein                        167   2e-47   Zea mays [maize]
ref|XP_006413177.1|  hypothetical protein EUTSA_v10026168mg             167   3e-47   Eutrema salsugineum [saltwater cress]
ref|XP_009142368.1|  PREDICTED: probable calcium-binding protein ...    167   3e-47   Brassica rapa
gb|KJB63079.1|  hypothetical protein B456_009G454500                    165   2e-46   Gossypium raimondii
tpg|DAA38718.1|  TPA: calcium ion binding protein                       164   3e-46   
ref|XP_010438747.1|  PREDICTED: probable calcium-binding protein ...    164   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010448264.1|  PREDICTED: probable calcium-binding protein ...    164   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010433497.1|  PREDICTED: probable calcium-binding protein ...    163   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_001784911.1|  predicted protein                                  162   2e-45   
gb|EMS52340.1|  putative calcium-binding protein CML22                  164   2e-45   Triticum urartu
ref|XP_010691273.1|  PREDICTED: probable calcium-binding protein ...    162   2e-45   
ref|XP_001775820.1|  predicted protein                                  161   3e-45   
ref|XP_010691274.1|  PREDICTED: probable calcium-binding protein ...    161   6e-45   
gb|KDO73987.1|  hypothetical protein CISIN_1g026998mg                   159   3e-44   Citrus sinensis [apfelsine]
gb|KCW70421.1|  hypothetical protein EUGRSUZ_F03649                     156   3e-43   Eucalyptus grandis [rose gum]
ref|XP_004509620.1|  PREDICTED: probable calcium-binding protein ...    156   3e-43   
emb|CAA18223.1|  putative protein                                       157   4e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92818.1|  BnaC07g40760D                                          155   7e-43   
ref|XP_009137599.1|  PREDICTED: probable calcium-binding protein ...    154   2e-42   Brassica rapa
emb|CDY42732.1|  BnaA03g48070D                                          154   3e-42   Brassica napus [oilseed rape]
gb|AFK48479.1|  unknown                                                 147   8e-41   Medicago truncatula
gb|KEH22472.1|  calcium-binding EF-hand protein                         149   1e-40   Medicago truncatula
gb|KEH22471.1|  calcium-binding EF-hand protein                         149   2e-40   Medicago truncatula
ref|XP_010421964.1|  PREDICTED: probable calcium-binding protein ...    145   9e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008667961.1|  PREDICTED: calcium ion binding protein isofo...    148   1e-39   Zea mays [maize]
ref|XP_002990940.1|  hypothetical protein SELMODRAFT_132549             146   2e-39   
ref|XP_006840146.1|  hypothetical protein AMTR_s00089p00059230          144   2e-38   
emb|CDX94327.1|  BnaC01g18570D                                          142   6e-38   
ref|XP_002982786.1|  hypothetical protein SELMODRAFT_422194             141   3e-37   
ref|XP_002990719.1|  hypothetical protein SELMODRAFT_429138             138   5e-36   
ref|XP_002986712.1|  hypothetical protein SELMODRAFT_425580             137   1e-35   
ref|XP_002323775.2|  hypothetical protein POPTR_0017s08200g             134   1e-35   
ref|NP_001078450.1|  putative calcium-binding protein CML21             129   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691276.1|  PREDICTED: probable calcium-binding protein ...    129   6e-33   
gb|EMS67685.1|  putative calcium-binding protein CML21                  129   5e-32   Triticum urartu
ref|XP_003062470.1|  predicted protein                                  103   4e-23   Micromonas pusilla CCMP1545
gb|AFW87515.1|  hypothetical protein ZEAMMB73_336887                    100   2e-22   
emb|CDY70736.1|  BnaCnng69600D                                        96.7    7e-22   Brassica napus [oilseed rape]
ref|XP_002862334.1|  predicted protein                                97.1    2e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_008619093.1|  hypothetical protein SDRG_14719                  94.7    1e-19   Saprolegnia diclina VS20
ref|XP_010468449.1|  PREDICTED: probable calcium-binding protein ...  92.8    2e-19   Camelina sativa [gold-of-pleasure]
gb|ACR34117.1|  unknown                                               90.9    5e-19   Zea mays [maize]
gb|EAZ22107.1|  hypothetical protein OsJ_05766                        86.3    6e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009840757.1|  hypothetical protein H257_14590                  87.0    8e-17   Aphanomyces astaci
gb|KJB63080.1|  hypothetical protein B456_009G454500                  83.2    1e-16   Gossypium raimondii
gb|KJB63081.1|  hypothetical protein B456_009G454500                  84.0    2e-16   Gossypium raimondii
ref|XP_008878820.1|  hypothetical protein H310_13196                  85.5    3e-16   Aphanomyces invadans
gb|KDO27543.1|  hypothetical protein SPRG_06811                       84.7    3e-16   Saprolegnia parasitica CBS 223.65
emb|CBN76140.1|  calcium ion binding                                  85.1    5e-16   Ectocarpus siliculosus
ref|XP_007224348.1|  hypothetical protein PRUPE_ppa020720mg           81.3    2e-15   
ref|XP_009526471.1|  hypothetical protein PHYSODRAFT_502537           82.0    2e-15   Phytophthora sojae
gb|ETL87187.1|  hypothetical protein L917_13535                       79.0    4e-14   Phytophthora parasitica
ref|XP_008909760.1|  hypothetical protein PPTG_14587                  79.0    4e-14   Phytophthora parasitica INRA-310
ref|XP_002896992.1|  conserved hypothetical protein                   76.6    1e-13   Phytophthora infestans T30-4
gb|ETI45580.1|  hypothetical protein F443_09884                       77.4    2e-13   Phytophthora parasitica P1569
gb|ETK85532.1|  hypothetical protein L915_09682                       77.4    2e-13   Phytophthora parasitica
ref|XP_008892917.1|  hypothetical protein PPTG_01392                  77.0    2e-13   Phytophthora parasitica INRA-310
ref|XP_002907045.1|  conserved hypothetical protein                   76.6    3e-13   Phytophthora infestans T30-4
emb|CCI44687.1|  unnamed protein product                              73.9    2e-12   Albugo candida
ref|XP_009519854.1|  hypothetical protein PHYSODRAFT_325675           73.9    2e-12   Phytophthora sojae
ref|XP_006823620.1|  PREDICTED: calmodulin-like                       71.6    5e-12   Saccoglossus kowalevskii
ref|XP_008863480.1|  hypothetical protein H310_01913                  72.4    7e-12   Aphanomyces invadans
emb|CCA15835.1|  conserved hypothetical protein                       70.5    3e-11   Albugo laibachii Nc14
emb|CCK71480.1|  hypothetical protein KNAG_0H00640                    66.2    2e-10   Kazachstania naganishii CBS 8797
ref|XP_008620055.1|  hypothetical protein SDRG_15654                  66.6    8e-10   Saprolegnia diclina VS20
ref|XP_009825682.1|  hypothetical protein H257_03354                  65.9    1e-09   Aphanomyces astaci
gb|KJB17909.1|  hypothetical protein B456_003G023300                  63.9    2e-09   Gossypium raimondii
gb|ELU06160.1|  hypothetical protein CAPTEDRAFT_227531                63.5    2e-09   Capitella teleta
gb|KJB17910.1|  hypothetical protein B456_003G023300                  63.9    2e-09   Gossypium raimondii
gb|EPB82214.1|  calmodulin                                            63.5    2e-09   Mucor circinelloides f. circinelloides 1006PhL
emb|CBY17793.1|  unnamed protein product                              63.2    2e-09   Oikopleura dioica
ref|XP_005850665.1|  hypothetical protein CHLNCDRAFT_140699           64.7    4e-09   Chlorella variabilis
dbj|GAN06811.1|  calmodulin                                           62.8    4e-09   Mucor ambiguus
ref|XP_011397401.1|  Palmitoyl-monogalactosyldiacylglycerol delta...  65.5    5e-09   Auxenochlorella protothecoides
ref|XP_011402686.1|  PREDICTED: LOW QUALITY PROTEIN: calmodulin-l...  65.1    6e-09   
ref|XP_010269961.1|  PREDICTED: caltractin-like                       62.4    6e-09   Nelumbo nucifera [Indian lotus]
gb|ABR16212.1|  unknown                                               62.8    6e-09   Picea sitchensis
ref|XP_009040569.1|  hypothetical protein AURANDRAFT_66979            64.7    6e-09   Aureococcus anophagefferens
ref|XP_002507740.1|  predicted protein                                63.9    6e-09   Micromonas commoda
gb|ERG82025.1|  calcyphosin-like protein                              63.5    7e-09   
gb|EKC43016.1|  Low-density lipoprotein receptor-related protein 6    65.1    7e-09   Crassostrea gigas
ref|XP_009025821.1|  hypothetical protein HELRODRAFT_156044           62.4    7e-09   Helobdella robusta
ref|XP_008619594.1|  hypothetical protein SDRG_15205                  65.1    8e-09   Saprolegnia diclina VS20
emb|CDS09630.1|  hypothetical protein LRAMOSA10990                    61.6    9e-09   Lichtheimia ramosa
ref|XP_010923302.1|  PREDICTED: calcium-dependent protein kinase ...  64.7    9e-09   Elaeis guineensis
ref|XP_008619593.1|  hypothetical protein, variant                    64.7    1e-08   Saprolegnia diclina VS20
sp|P41210.1|CATR_ATRNU  RecName: Full=Caltractin; AltName: Full=C...  61.6    1e-08   Atriplex nummularia
ref|XP_005099702.1|  PREDICTED: uncharacterized protein LOC101861733  63.9    1e-08   
gb|KJB71091.1|  hypothetical protein B456_011G105500                  61.2    1e-08   Gossypium raimondii
ref|XP_010674374.1|  PREDICTED: caltractin isoform X2                 61.2    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674373.1|  PREDICTED: caltractin isoform X1                 61.2    1e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|EYB86371.1|  hypothetical protein Y032_0280g1224                   62.8    1e-08   Ancylostoma ceylanicum
ref|XP_004288038.2|  PREDICTED: caltractin                            62.0    2e-08   Fragaria vesca subsp. vesca
ref|XP_007202670.1|  hypothetical protein PRUPE_ppa012454mg           61.2    2e-08   Prunus persica
gb|EYB86370.1|  hypothetical protein Y032_0280g1224                   61.6    2e-08   Ancylostoma ceylanicum
ref|XP_007047245.1|  Centrin2 isoform 1                               60.8    2e-08   
gb|KFK40707.1|  hypothetical protein AALP_AA2G030900                  60.8    2e-08   Arabis alpina [alpine rockcress]
gb|KDO31373.1|  hypothetical protein SPRG_03990                       63.5    2e-08   Saprolegnia parasitica CBS 223.65
ref|XP_002876026.1|  predicted protein                                60.8    2e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_006891943.1|  PREDICTED: calmodulin-like protein 5             60.5    3e-08   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_190605.1|  centrin2                                            60.5    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006339902.1|  PREDICTED: caltractin-like                       60.5    3e-08   Solanum tuberosum [potatoes]
ref|XP_004232035.1|  PREDICTED: caltractin                            60.1    3e-08   Solanum lycopersicum
ref|XP_002523573.1|  Caltractin, putative                             60.5    4e-08   Ricinus communis
ref|XP_009589844.1|  PREDICTED: caltractin-like                       60.1    4e-08   Nicotiana tomentosiformis
ref|XP_008241453.1|  PREDICTED: caltractin                            60.1    4e-08   Prunus mume [ume]
ref|XP_008805271.1|  PREDICTED: caltractin-like isoform X2            60.1    4e-08   Phoenix dactylifera
gb|KIH66928.1|  EF hand                                               60.5    4e-08   Ancylostoma duodenale
ref|XP_009797840.1|  PREDICTED: caltractin                            60.1    4e-08   Nicotiana sylvestris
ref|XP_006415032.1|  hypothetical protein EUTSA_v10008929mg           60.1    5e-08   Eutrema salsugineum [saltwater cress]
ref|XP_005099701.1|  PREDICTED: calmodulin-like protein 12-like       62.0    5e-08   
ref|XP_010050053.1|  PREDICTED: calmodulin-like protein 7             60.8    5e-08   Eucalyptus grandis [rose gum]
ref|XP_006338886.1|  PREDICTED: probable calcium-binding protein ...  59.7    6e-08   Solanum tuberosum [potatoes]
gb|AGQ20410.1|  calcium dependent protein kinase 1                    62.0    6e-08   Zingiber officinale [ginger]
gb|EKC42677.1|  Calmodulin                                            62.0    6e-08   Crassostrea gigas
ref|XP_011441730.1|  PREDICTED: neo-calmodulin-like isoform X3        58.9    7e-08   
ref|XP_002287177.1|  predicted protein                                61.6    7e-08   Thalassiosira pseudonana CCMP1335
ref|XP_002307263.1|  caltractin family protein                        59.3    8e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011441729.1|  PREDICTED: neo-calmodulin-like isoform X2        58.9    8e-08   
ref|XP_011441728.1|  PREDICTED: neo-calmodulin-like isoform X1        58.9    9e-08   
ref|XP_004237269.1|  PREDICTED: caltractin-like                       58.9    1e-07   
emb|CEF60717.1|  Calmodulin-like protein 3                            58.5    1e-07   
gb|EEC75972.1|  hypothetical protein OsI_13081                        60.8    1e-07   
ref|XP_002016665.1|  GL11704                                          58.5    1e-07   
ref|XP_009032408.1|  hypothetical protein AURANDRAFT_16285            58.5    1e-07   
ref|XP_010916613.1|  PREDICTED: probable calcium-binding protein ...  58.9    1e-07   
gb|EEE59725.1|  hypothetical protein OsJ_12163                        60.8    1e-07   
gb|AHA51331.1|  EF-hand_1 domain-containing protein                   60.1    1e-07   
gb|AIU98506.1|  calcium-dependent protein kinase                      61.2    1e-07   
ref|NP_001050944.1|  Os03g0688300                                     61.2    1e-07   
ref|XP_005835328.1|  hypothetical protein GUITHDRAFT_151865           59.7    1e-07   
ref|XP_009396383.1|  PREDICTED: calcium-dependent protein kinase ...  61.2    1e-07   
ref|XP_009101784.1|  PREDICTED: probable calcium-binding protein ...  58.5    1e-07   
ref|XP_006291947.1|  hypothetical protein CARUB_v10018135mg           58.5    1e-07   
dbj|BAF48780.1|  hypothetical protein                                 59.7    1e-07   
gb|AHA51329.1|  EF-hand_1 domain-containing protein                   59.3    2e-07   
gb|AHA51330.1|  EF-hand_1 domain-containing protein                   59.7    2e-07   
ref|XP_008796650.1|  PREDICTED: calcium-dependent protein kinase ...  60.5    2e-07   
ref|XP_007047248.1|  ARM repeat protein interacting with ABF2 iso...  58.2    2e-07   
ref|XP_008796649.1|  PREDICTED: calcium-dependent protein kinase ...  60.8    2e-07   
gb|KHJ97775.1|  EF hand                                               58.9    2e-07   
ref|XP_001637998.1|  predicted protein                                58.2    2e-07   
ref|XP_009388458.1|  PREDICTED: calcium-dependent protein kinase ...  60.5    2e-07   
ref|XP_010477091.1|  PREDICTED: calcium-dependent protein kinase ...  60.5    2e-07   
ref|XP_002645274.1|  Hypothetical protein CBG00175                    59.3    2e-07   
ref|NP_001131342.1|  uncharacterized protein LOC100192661             58.5    2e-07   
gb|KHG23483.1|  Caltractin                                            60.5    2e-07   
ref|XP_003674056.1|  hypothetical protein NCAS_0A11170                57.8    2e-07   
ref|XP_006651702.1|  PREDICTED: calcium-dependent protein kinase ...  60.5    2e-07   
ref|XP_010426580.1|  PREDICTED: probable calcium-binding protein ...  58.2    2e-07   
gb|KJB43707.1|  hypothetical protein B456_007G212700                  60.5    2e-07   
emb|CDX83123.1|  BnaA01g21230D                                        58.5    2e-07   
ref|XP_002601220.1|  hypothetical protein BRAFLDRAFT_187874           57.4    2e-07   
ref|XP_009404018.1|  PREDICTED: caltractin                            58.2    2e-07   
emb|CDH59824.1|  calmodulin                                           57.8    2e-07   
ref|XP_006396673.1|  hypothetical protein EUTSA_v10028617mg           60.1    2e-07   
gb|ELT88403.1|  hypothetical protein CAPTEDRAFT_107528                57.8    2e-07   
ref|XP_010916612.1|  PREDICTED: caltractin isoform X1                 58.2    3e-07   
ref|XP_004367608.1|  EF hand domain containing protein                57.0    3e-07   
ref|XP_002973044.1|  hypothetical protein SELMODRAFT_413463           57.8    3e-07   
gb|AHA51333.1|  EF-hand_1 domain-containing protein                   59.7    3e-07   
ref|XP_003101114.1|  hypothetical protein CRE_14767                   58.9    3e-07   
ref|XP_008559867.1|  PREDICTED: calcyphosin-like protein              58.5    3e-07   
gb|AAC68892.1|  VU91D calmodulin                                      57.4    3e-07   
ref|XP_001743025.1|  hypothetical protein                             57.8    3e-07   
gb|KFK30981.1|  hypothetical protein AALP_AA6G053300                  59.7    3e-07   
ref|XP_002946821.1|  hypothetical protein VOLCADRAFT_87187            58.9    3e-07   
ref|XP_010042872.1|  PREDICTED: probable calcium-binding protein ...  59.7    3e-07   
ref|XP_009375705.1|  PREDICTED: probable calcium-binding protein ...  57.4    3e-07   
ref|XP_007047246.1|  ARM repeat protein interacting with ABF2 iso...  57.8    3e-07   
ref|NP_509544.1|  Protein B0563.7                                     58.5    3e-07   
ref|XP_003678123.1|  hypothetical protein NCAS_0I01100                57.0    3e-07   
ref|XP_003688167.1|  hypothetical protein TPHA_0M01580                57.0    4e-07   
emb|CDY62753.1|  BnaC01g42220D                                        58.2    4e-07   
ref|XP_003957053.1|  hypothetical protein KAFR_0D02700                57.0    4e-07   
gb|ACH72985.1|  calmodulin 2                                          57.0    4e-07   
gb|AHA51332.1|  EF-hand_1 domain-containing protein                   59.3    4e-07   
ref|XP_010931028.1|  PREDICTED: calcium-dependent protein kinase 32   59.7    4e-07   
ref|XP_010098464.1|  putative calcium-binding protein CML20           57.8    4e-07   
gb|ELU09134.1|  hypothetical protein CAPTEDRAFT_228814                59.7    4e-07   
gb|EKC39257.1|  Calcium-dependent protein kinase isoform 2            58.5    4e-07   
gb|AFW76342.1|  hypothetical protein ZEAMMB73_373728                  55.1    4e-07   
ref|XP_002138728.1|  GA24240                                          57.0    4e-07   
ref|XP_010515395.1|  PREDICTED: probable calcium-binding protein ...  57.4    5e-07   
ref|XP_008361400.1|  PREDICTED: probable calcium-binding protein ...  57.4    5e-07   
gb|ADN07535.1|  calmodulin 4                                          57.0    5e-07   
ref|XP_005354981.1|  PREDICTED: calmodulin-4-like                     57.0    5e-07   
gb|ADN07528.1|  calmodulin 4                                          56.6    5e-07   
emb|CDP14599.1|  unnamed protein product                              58.2    5e-07   
ref|XP_008835071.1|  PREDICTED: calmodulin-like protein 5             56.6    5e-07   
ref|XP_011005867.1|  PREDICTED: caltractin                            57.0    5e-07   
gb|AAC68890.1|  VU91B calmodulin                                      56.6    5e-07   
ref|XP_010503705.1|  PREDICTED: probable calcium-binding protein ...  57.0    5e-07   
ref|XP_010070343.1|  PREDICTED: caltractin                            57.0    5e-07   
ref|XP_002593379.1|  hypothetical protein BRAFLDRAFT_57687            56.6    5e-07   
ref|XP_009367049.1|  PREDICTED: probable calcium-binding protein ...  57.0    6e-07   
pdb|2LHH|A  Chain A, Solution Structure Of Ca2+-Bound Ycam            56.2    6e-07   
pdb|2LHI|A  Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound...  57.0    6e-07   
ref|XP_010540753.1|  PREDICTED: probable calcium-binding protein ...  56.6    6e-07   
ref|XP_011312409.1|  PREDICTED: calcyphosin-like protein isoform X2   57.4    6e-07   
dbj|GAN11009.1|  calmodulin-like isoform 1                            56.6    6e-07   
ref|XP_011312408.1|  PREDICTED: calcyphosin-like protein isoform X1   57.4    7e-07   
emb|CCK68596.1|  hypothetical protein KNAG_0B01480                    56.2    7e-07   
ref|XP_011045425.1|  PREDICTED: calcium-dependent protein kinase ...  58.9    7e-07   
emb|CAB40133.1|  calmodulin-like protein                              56.2    7e-07   
dbj|GAA21657.1|  K7_Cmd1p                                             56.2    7e-07   
gb|ETO23432.1|  calcium-dependent protein kinase                      58.2    7e-07   
ref|XP_010548415.1|  PREDICTED: calcium-binding protein CML19         56.6    7e-07   
ref|XP_008654305.1|  PREDICTED: uncharacterized protein LOC100192...  58.9    8e-07   
gb|KFK30323.1|  hypothetical protein AALP_AA7G246900                  56.6    8e-07   
pdb|1LKJ|A  Chain A, Nmr Structure Of Apo Calmodulin From Yeast S...  56.2    8e-07   
ref|NP_009667.1|  calmodulin                                          56.2    8e-07   
ref|XP_011061020.1|  PREDICTED: calcyphosin-like protein isoform X1   57.8    8e-07   
gb|ABY59013.1|  calcium-dependent protein kinase                      58.5    9e-07   
ref|XP_010278963.1|  PREDICTED: calcium-dependent protein kinase ...  58.5    9e-07   
ref|NP_001149916.1|  calcium-dependent protein kinase, isoform AK1    58.5    9e-07   
ref|NP_177612.2|  calcium-dependent protein kinase 30                 58.5    9e-07   
dbj|BAJ85309.1|  predicted protein                                    58.2    9e-07   
gb|AJQ11574.1|  Cmd1p                                                 55.8    9e-07   
ref|XP_008654304.1|  PREDICTED: uncharacterized protein LOC100192...  58.5    1e-06   
ref|XP_002496350.1|  ZYRO0C16346p                                     55.8    1e-06   
ref|XP_445478.1|  hypothetical protein                                55.8    1e-06   
ref|XP_008644596.1|  PREDICTED: calcium-dependent protein kinase ...  58.5    1e-06   
ref|XP_003958635.1|  hypothetical protein KAFR_0H00900                55.8    1e-06   
ref|XP_002299904.1|  calcium-dependent protein kinase 1               58.5    1e-06   
gb|EJT41753.1|  CMD1-like protein                                     55.8    1e-06   
ref|XP_001693482.1|  predicted protein                                58.2    1e-06   
ref|XP_004336073.1|  Calmodulin, putative                             55.8    1e-06   
ref|XP_005872658.1|  PREDICTED: calcyphosin-like protein isoform X1   56.6    1e-06   
emb|CDF89641.1|  ZYBA0S04-09142g1_1                                   55.8    1e-06   
ref|XP_002554663.1|  KLTH0F10626p                                     55.8    1e-06   
ref|XP_003680602.1|  hypothetical protein TDEL_0C05020                55.5    1e-06   
ref|XP_011155602.1|  PREDICTED: calcyphosin-like protein isoform X2   56.6    1e-06   
ref|XP_002977282.1|  hypothetical protein SELMODRAFT_106606           55.8    1e-06   
ref|XP_006761824.1|  PREDICTED: calcyphosin-like protein isoform X1   56.6    1e-06   
ref|XP_008340035.1|  PREDICTED: probable calcium-binding protein ...  55.8    1e-06   
ref|XP_011061021.1|  PREDICTED: calcyphosin-like protein isoform X2   56.6    1e-06   
ref|XP_002992169.1|  hypothetical protein SELMODRAFT_134862           55.5    1e-06   
gb|AFW67956.1|  putative calcium-dependent protein kinase family ...  57.8    1e-06   
dbj|GAN06810.1|  calmodulin                                           55.5    1e-06   
ref|XP_010923438.1|  PREDICTED: calcium-dependent protein kinase ...  58.2    1e-06   
ref|WP_028832989.1|  hypothetical protein                             58.2    1e-06   
gb|AHG06452.1|  calcium-dependent protein kinase 30                   58.2    1e-06   
gb|KFK41910.1|  hypothetical protein AALP_AA2G188200                  58.2    1e-06   
ref|XP_009106132.1|  PREDICTED: calcium-dependent protein kinase 30   58.2    1e-06   
gb|KFB42224.1|  AGAP006622-PA-like protein                            55.5    2e-06   
ref|XP_006390395.1|  hypothetical protein EUTSA_v10018366mg           57.8    2e-06   
ref|XP_010923436.1|  PREDICTED: calcium-dependent protein kinase ...  57.8    2e-06   
ref|XP_004970457.1|  PREDICTED: calcium-dependent protein kinase ...  57.8    2e-06   
ref|XP_008805269.1|  PREDICTED: caltractin-like isoform X1            56.2    2e-06   
gb|AHA51357.1|  EF-hand_1 domain-containing protein                   56.2    2e-06   
emb|CDX73108.1|  BnaC06g35560D                                        57.8    2e-06   
ref|XP_009615900.1|  PREDICTED: caltractin-like isoform X2            55.8    2e-06   
gb|ETO05528.1|  Protein kinase domain containing protein              57.8    2e-06   
ref|XP_004986274.1|  PREDICTED: calmodulin-like                       55.5    2e-06   
ref|XP_009024422.1|  hypothetical protein HELRODRAFT_157558           55.1    2e-06   
ref|XP_002185837.1|  predicted protein                                57.8    2e-06   
ref|XP_011155601.1|  PREDICTED: calcyphosin-like protein isoform X1   56.6    2e-06   
ref|XP_004367650.1|  EF hand domain containing protein                56.2    2e-06   
emb|CEP61531.1|  LALA0S03e04940g1_1                                   55.1    2e-06   
ref|XP_011426071.1|  PREDICTED: calmodulin-like                       55.1    2e-06   
ref|XP_006302109.1|  hypothetical protein CARUB_v10020106mg           57.8    2e-06   
gb|ESL05277.1|  hypothetical protein TRSC58_07082                     57.0    2e-06   
ref|XP_003056424.1|  flagellar outer dynein arm light chain 5         55.1    2e-06   
ref|XP_009020545.1|  hypothetical protein HELRODRAFT_185708           55.1    2e-06   
ref|XP_010459535.1|  PREDICTED: calcium-dependent protein kinase 10   57.8    2e-06   
ref|XP_010428465.1|  PREDICTED: calcium-dependent protein kinase ...  57.8    2e-06   
ref|NP_001256429.1|  Protein CAL-1, isoform a                         55.5    2e-06   
gb|EPQ11677.1|  Calcyphosin-like protein                              56.6    2e-06   
ref|NP_001099887.1|  calcyphosin-like protein                         56.2    2e-06   
gb|ELK31721.1|  Calcyphosin-like protein                              56.6    2e-06   
ref|XP_002888989.1|  calcium-dependent protein kinase 30              57.4    2e-06   
gb|AHA51306.1|  EF-hand_1 domain-containing protein                   55.1    2e-06   
gb|AHA51307.1|  EF-hand_1 domain-containing protein                   55.1    2e-06   
ref|XP_010416328.1|  PREDICTED: calcium-dependent protein kinase ...  57.4    2e-06   
ref|XP_008758985.1|  PREDICTED: calcyphosin-like protein isoform X1   56.2    2e-06   
ref|XP_010852102.1|  PREDICTED: calcyphosin-like protein isoform X2   55.8    2e-06   
gb|EGT38909.1|  hypothetical protein CAEBREN_30810                    55.5    2e-06   
gb|AGI21023.1|  calcium-dependent protein kinase 3                    57.4    2e-06   
ref|XP_011414765.1|  PREDICTED: calmodulin-beta-like isoform X1       55.5    2e-06   
ref|XP_011414766.1|  PREDICTED: calmodulin-beta-like isoform X2       55.5    2e-06   
gb|KFK37028.1|  hypothetical protein AALP_AA4G202800                  57.4    2e-06   
ref|XP_003114118.1|  CRE-CAL-1 protein                                55.8    2e-06   
ref|XP_009395591.1|  PREDICTED: calcium-dependent protein kinase ...  57.4    2e-06   
ref|XP_003408023.1|  PREDICTED: calcyphosin-like protein              55.8    2e-06   
ref|NP_001256428.1|  Protein CAL-1, isoform b                         55.5    2e-06   
gb|ETO30623.1|  hypothetical protein RFI_06494                        55.5    3e-06   
sp|P14533.1|CABO_DORPE  RecName: Full=Squidulin; AltName: Full=Op...  54.7    3e-06   
gb|ETN74544.1|  EF hand                                               55.1    3e-06   
gb|AAB03218.1|  calmodulin-like myosin-light chain                    54.7    3e-06   
ref|XP_001622774.1|  predicted protein                                55.1    3e-06   
gb|ELT93937.1|  hypothetical protein CAPTEDRAFT_147994                55.1    3e-06   
gb|EUC61805.1|  calmodulin                                            55.1    3e-06   
emb|CBJ49201.1|  conserved unknown protein                            57.4    3e-06   
ref|XP_002949115.1|  hypothetical protein VOLCADRAFT_80507            57.0    3e-06   
ref|XP_006646451.1|  PREDICTED: calcium-dependent protein kinase ...  57.0    3e-06   
ref|XP_006661729.1|  PREDICTED: probable calcium-binding protein ...  55.1    3e-06   
ref|XP_009121835.1|  PREDICTED: calcium-dependent protein kinase 7    57.0    3e-06   
dbj|BAK06483.1|  predicted protein                                    55.1    3e-06   
gb|AHN16204.1|  CPK10-2.1                                             57.0    3e-06   
ref|XP_009149374.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...  57.0    3e-06   
ref|XP_004662458.1|  PREDICTED: calmodulin-4-like                     54.7    3e-06   
gb|ABF38946.2|  calmodulin                                            54.7    3e-06   
emb|CDJ97215.1|  EF hand domain containing protein                    54.7    3e-06   
emb|CDY26714.1|  BnaA06g13080D                                        57.0    3e-06   
ref|XP_004691277.1|  PREDICTED: calmodulin-like protein 3             54.7    3e-06   
ref|XP_007148393.1|  hypothetical protein PHAVU_006G204800g           54.7    3e-06   
gb|ACN39928.1|  unknown                                               57.0    4e-06   
gb|EMS67426.1|  Calcium-dependent protein kinase 32                   56.6    4e-06   
gb|EKC24243.1|  Calmodulin                                            56.6    4e-06   
ref|XP_002630726.1|  Hypothetical protein CBG02410                    54.3    4e-06   
gb|EJY72659.1|  Protein kinase domain containing protein              56.6    4e-06   
gb|EYC01138.1|  hypothetical protein Y032_0110g186                    55.1    4e-06   
ref|XP_001326577.1|  centrin                                          54.7    4e-06   
ref|XP_010550366.1|  PREDICTED: probable calcium-binding protein ...  54.7    4e-06   
ref|XP_010918135.1|  PREDICTED: calcium-dependent protein kinase 29   56.6    4e-06   
gb|EGT53025.1|  hypothetical protein CAEBREN_26130                    54.3    4e-06   
gb|EYC01137.1|  hypothetical protein Y032_0110g186                    54.7    4e-06   
ref|XP_009022608.1|  hypothetical protein HELRODRAFT_138077           52.8    4e-06   
ref|NP_495043.1|  Protein CAL-8                                       54.3    4e-06   
ref|XP_004148035.1|  PREDICTED: probable calcium-binding protein ...  54.7    4e-06   
emb|CBI21432.3|  unnamed protein product                              54.7    4e-06   
ref|XP_007951416.1|  PREDICTED: calcyphosin-like protein              55.1    4e-06   
emb|CDJ96123.1|  EF hand domain containing protein                    54.3    4e-06   
ref|XP_009141613.1|  PREDICTED: calcium-dependent protein kinase ...  56.6    4e-06   
gb|ELU15623.1|  hypothetical protein CAPTEDRAFT_154562                54.3    5e-06   
gb|AGG35965.1|  calcium-dependent protein kinase 12                   56.6    5e-06   
ref|XP_002593377.1|  hypothetical protein BRAFLDRAFT_277100           53.9    5e-06   
ref|XP_004181962.1|  hypothetical protein TBLA_0H01560                53.9    5e-06   
emb|CEP09792.1|  hypothetical protein                                 53.9    5e-06   
emb|CDX87164.1|  BnaC09g04790D                                        56.2    5e-06   
gb|ESW97557.1|  calmodulin                                            53.9    5e-06   
ref|XP_003108906.1|  hypothetical protein CRE_11951                   53.9    5e-06   
ref|XP_002456584.1|  hypothetical protein SORBIDRAFT_03g038870        56.2    5e-06   
gb|KEH23303.1|  EF hand calcium-binding family protein                54.3    5e-06   
gb|AFK46745.1|  unknown                                               54.3    5e-06   
ref|XP_005617262.1|  PREDICTED: calmodulin-like protein 3             53.5    5e-06   
ref|XP_008457834.1|  PREDICTED: probable calcium-binding protein ...  54.3    5e-06   
gb|EMT08656.1|  Calcium-dependent protein kinase 32                   56.2    5e-06   
ref|XP_011434023.1|  PREDICTED: calmodulin-A-like isoform X2          53.9    6e-06   
dbj|GAN02697.1|  calmodulin                                           53.9    6e-06   



>ref|XP_009801783.1| PREDICTED: probable calcium-binding protein CML22 [Nicotiana 
sylvestris]
Length=247

 Score =   296 bits (757),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEID+LF SCDVD+ E 
Sbjct  69   PQFKEGLKEIKGVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEIDDLFHSCDVDEKEG  128

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL D+ SS +TSKIGSP +E+TFNTIVEAFLFLDKNGDGKLHKK+V
Sbjct  129  IQFNEFIVLLCLIYLLTDSSSSRNTSKIGSPELEATFNTIVEAFLFLDKNGDGKLHKKEV  188

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            VKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDWVG++ DDE+H  E
Sbjct  189  VKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWVGVNTDDENHATE  246



>ref|XP_009619227.1| PREDICTED: probable calcium-binding protein CML22 isoform X5 
[Nicotiana tomentosiformis]
Length=243

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF SCDVD+NE 
Sbjct  64   PQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHSCDVDENEG  123

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLL D+ SS  +T KIGSP +E+TFNTIVEAFLFLDKNGDGKLHKK+
Sbjct  124  IQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSPELEATFNTIVEAFLFLDKNGDGKLHKKE  183

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDW+G++ DDE+H  E
Sbjct  184  VVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWIGVNTDDENHATE  242



>ref|XP_009619221.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009619222.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Nicotiana tomentosiformis]
Length=248

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF SCDVD+NE 
Sbjct  69   PQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHSCDVDENEG  128

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLL D+ SS  +T KIGSP +E+TFNTIVEAFLFLDKNGDGKLHKK+
Sbjct  129  IQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSPELEATFNTIVEAFLFLDKNGDGKLHKKE  188

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDW+G++ DDE+H  E
Sbjct  189  VVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWIGVNTDDENHATE  247



>ref|XP_009619226.1| PREDICTED: probable calcium-binding protein CML22 isoform X4 
[Nicotiana tomentosiformis]
Length=245

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF SCDVD+NE 
Sbjct  66   PQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHSCDVDENEG  125

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLL D+ SS  +T KIGSP +E+TFNTIVEAFLFLDKNGDGKLHKK+
Sbjct  126  IQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSPELEATFNTIVEAFLFLDKNGDGKLHKKE  185

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDW+G++ DDE+H  E
Sbjct  186  VVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWIGVNTDDENHATE  244



>ref|XP_009619224.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Nicotiana tomentosiformis]
Length=246

 Score =   293 bits (750),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FREGLKEI+ VFEQFDEDSNG IDREELKKC++KLQFHV EEEI++LF SCDVD+NE 
Sbjct  67   PQFREGLKEIKAVFEQFDEDSNGTIDREELKKCVKKLQFHVKEEEINDLFHSCDVDENEG  126

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLL D+ SS  +T KIGSP +E+TFNTIVEAFLFLDKNGDGKLHKK+
Sbjct  127  IQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSPELEATFNTIVEAFLFLDKNGDGKLHKKE  186

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDW+G++ DDE+H  E
Sbjct  187  VVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWIGVNTDDENHATE  245



>ref|XP_009619225.1| PREDICTED: probable calcium-binding protein CML22 isoform X3 
[Nicotiana tomentosiformis]
Length=246

 Score =   285 bits (728),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 157/179 (88%), Gaps = 3/179 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FREGLKEI+ VFEQFD  SNG IDREELKKC++KLQFHV EEEI++LF SCDVD+NE 
Sbjct  69   PQFREGLKEIKAVFEQFD--SNGTIDREELKKCVKKLQFHVKEEEINDLFHSCDVDENEG  126

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLL D+ SS  +T KIGSP +E+TFNTIVEAFLFLDKNGDGKLHKK+
Sbjct  127  IQFNEFIVLLCLIYLLTDSSSSSRNTPKIGSPELEATFNTIVEAFLFLDKNGDGKLHKKE  186

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            VVKA ND  P EKSPSHVTR RFKEMDWDRSGK+SFR+FLFAFLDW+G++ DDE+H  E
Sbjct  187  VVKALNDDCPSEKSPSHVTRIRFKEMDWDRSGKVSFRQFLFAFLDWIGVNTDDENHATE  245



>ref|XP_010326837.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Solanum lycopersicum]
Length=213

 Score =   266 bits (679),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 159/174 (91%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            PHF+EGLKEI+ VFEQFDEDSNG IDR+ELKKC++KL FH  +EE+++LF SCDVD+NE 
Sbjct  27   PHFKEGLKEIKDVFEQFDEDSNGTIDRDELKKCVKKLHFHAKDEEVNDLFDSCDVDENEG  86

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCL+YLL+D+ SS G+T+KIGSP +E+TFNTIVEAFLFLDKNGDGKLHKKD
Sbjct  87   IQFNEFIVLLCLLYLLIDSSSSSGNTTKIGSPELEATFNTIVEAFLFLDKNGDGKLHKKD  146

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            V+KA ND  P EKSPSHVTRTRF+EMDW+RSGK+SFR+FLFAFLDWVGID DDE
Sbjct  147  VLKALNDECPCEKSPSHVTRTRFREMDWNRSGKVSFRQFLFAFLDWVGIDTDDE  200



>ref|XP_004247862.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Solanum lycopersicum]
Length=252

 Score =   266 bits (680),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 159/174 (91%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            PHF+EGLKEI+ VFEQFDEDSNG IDR+ELKKC++KL FH  +EE+++LF SCDVD+NE 
Sbjct  66   PHFKEGLKEIKDVFEQFDEDSNGTIDRDELKKCVKKLHFHAKDEEVNDLFDSCDVDENEG  125

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCL+YLL+D+ SS G+T+KIGSP +E+TFNTIVEAFLFLDKNGDGKLHKKD
Sbjct  126  IQFNEFIVLLCLLYLLIDSSSSSGNTTKIGSPELEATFNTIVEAFLFLDKNGDGKLHKKD  185

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            V+KA ND  P EKSPSHVTRTRF+EMDW+RSGK+SFR+FLFAFLDWVGID DDE
Sbjct  186  VLKALNDECPCEKSPSHVTRTRFREMDWNRSGKVSFRQFLFAFLDWVGIDTDDE  239



>ref|XP_009374596.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Pyrus x bretschneideri]
Length=253

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FRE LK+IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++LF SCD+D +E 
Sbjct  72   PQFREELKKIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHSCDMDGSEG  131

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL +  SS + SKI SP +E+TF+T+VE F FLDKNGDGKL+K D+
Sbjct  132  IQFNEFIVLLCLIYLLKEPSSSHTISKINSPQLEATFDTVVEVFSFLDKNGDGKLNKTDM  191

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VKA N+A PLEKSP+HVTRTRFKEMDWD++GK++FR+FLFAF+DWVGID D+E
Sbjct  192  VKALNEASPLEKSPAHVTRTRFKEMDWDKNGKVTFREFLFAFIDWVGIDTDEE  244



>ref|XP_009374597.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Pyrus x bretschneideri]
Length=234

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FRE LK+IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++LF SCD+D +E 
Sbjct  53   PQFREELKKIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHSCDMDGSEG  112

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL +  SS + SKI SP +E+TF+T+VE F FLDKNGDGKL+K D+
Sbjct  113  IQFNEFIVLLCLIYLLKEPSSSHTISKINSPQLEATFDTVVEVFSFLDKNGDGKLNKTDM  172

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VKA N+A PLEKSP+HVTRTRFKEMDWD++GK++FR+FLFAF+DWVGID D+E
Sbjct  173  VKALNEASPLEKSPAHVTRTRFKEMDWDKNGKVTFREFLFAFIDWVGIDTDEE  225



>ref|XP_008380562.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Malus domestica]
Length=253

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FRE LK+IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++LF SCD+D +E 
Sbjct  72   PQFREELKKIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHSCDMDGSEG  131

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL +  SS + SKI SP +E+TF+T+VE F FLDKNGDGKL+K DV
Sbjct  132  IQFNEFIVLLCLIYLLKEPSSSHTISKINSPQLEATFDTVVEVFSFLDKNGDGKLNKTDV  191

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VKA N+A PLEKSP+ VTRTRFKEMDWD++GK++FR+FLFAF+DWVGID D E
Sbjct  192  VKALNEASPLEKSPARVTRTRFKEMDWDKNGKVTFREFLFAFIDWVGIDTDGE  244



>ref|XP_008380563.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Malus domestica]
Length=234

 Score =   262 bits (669),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FRE LK+IR VFEQ+DEDSNG IDREELKKCLQKLQ H+  EEI++LF SCD+D +E 
Sbjct  53   PQFREELKKIRDVFEQYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHSCDMDGSEG  112

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL +  SS + SKI SP +E+TF+T+VE F FLDKNGDGKL+K DV
Sbjct  113  IQFNEFIVLLCLIYLLKEPSSSHTISKINSPQLEATFDTVVEVFSFLDKNGDGKLNKTDV  172

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VKA N+A PLEKSP+ VTRTRFKEMDWD++GK++FR+FLFAF+DWVGID D E
Sbjct  173  VKALNEASPLEKSPARVTRTRFKEMDWDKNGKVTFREFLFAFIDWVGIDTDGE  225



>ref|XP_006366840.1| PREDICTED: probable calcium-binding protein CML22-like [Solanum 
tuberosum]
Length=262

 Score =   263 bits (671),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            PHF+EGLKEI+ VFEQFDEDSNG IDR+ELKKC++KL FHV +EE+++LF SCDVD+ E 
Sbjct  66   PHFKEGLKEIKGVFEQFDEDSNGTIDRDELKKCVKKLHFHVKDEEVNDLFDSCDVDEKEG  125

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCL+YLL+D+ SS  +TSKIGSP +E+TFNTIVEAFLFLDKNGDGKLHKKD
Sbjct  126  IQFNEFIVLLCLLYLLIDSSSSSENTSKIGSPELEATFNTIVEAFLFLDKNGDGKLHKKD  185

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            V+KA ND  P EKSPSHVTRTRF+EMDW+RSGK+SFR+FLFAFLDWVGID DDE+H  +
Sbjct  186  VLKALNDECPCEKSPSHVTRTRFREMDWNRSGKVSFRQFLFAFLDWVGIDTDDENHTTK  244



>ref|XP_007034372.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
 gb|EOY05298.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao]
Length=244

 Score =   258 bits (660),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 155/177 (88%), Gaps = 4/177 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FR+GLK +R VFEQ+DEDSNG IDREEL KCL+KLQFH+ +EE+++LF SCD+D +E 
Sbjct  65   PQFRDGLKNLRGVFEQYDEDSNGTIDREELNKCLEKLQFHLTKEEVEDLFHSCDIDGSEG  124

Query  493  IKFNEFIVLLCLIYLLMD---APSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
            I+FNEFIVLLCLIYLLM    +P + ST+ KI SP +E+TF+TIVEAFLFLDKNGDGKL+
Sbjct  125  IQFNEFIVLLCLIYLLMKPSPSPDTVSTTLKIDSPQLEATFDTIVEAFLFLDKNGDGKLN  184

Query  325  KKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            KKD++KA N+A P E+SP+HVTRTRFKEMDWD++GK+SFR+FLFAF++WVGI+ D+E
Sbjct  185  KKDMIKALNEASPWERSPAHVTRTRFKEMDWDKNGKVSFREFLFAFINWVGIESDEE  241



>ref|XP_008224499.1| PREDICTED: probable calcium-binding protein CML22 [Prunus mume]
 ref|XP_008224500.1| PREDICTED: probable calcium-binding protein CML22 [Prunus mume]
Length=251

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FRE LK+IR VFEQ+DEDSNG ID EELKKCLQKL+ H+  EEI++LF SCD+D +E 
Sbjct  70   PQFREELKKIRDVFEQYDEDSNGTIDLEELKKCLQKLELHLTAEEIEDLFHSCDMDGSEG  129

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL +  SS +TSKI SP +E+TF+T++E F FLDKNGDGKL+K D+
Sbjct  130  IQFNEFIVLLCLIYLLKEPSSSHNTSKIDSPQLEATFDTVIEVFSFLDKNGDGKLNKTDM  189

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VKA N+A PLEKSP+HVTRTRFKEMDW + GK+SFR+FLFAF+DWVGID ++E
Sbjct  190  VKALNEASPLEKSPAHVTRTRFKEMDWSKRGKVSFREFLFAFIDWVGIDTNEE  242



>ref|XP_007223706.1| hypothetical protein PRUPE_ppa010393mg [Prunus persica]
 gb|EMJ24905.1| hypothetical protein PRUPE_ppa010393mg [Prunus persica]
Length=251

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FRE LK+IR VFEQ+DEDSNG ID EELKKCLQKL+ H+  EEI++LF SCD+D +E 
Sbjct  70   PQFREELKKIRDVFEQYDEDSNGTIDLEELKKCLQKLELHLTAEEIEDLFHSCDMDGSEG  129

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL +  SS +TSKI SP +E+TF+T++E F FLDKNGDGKL+K D+
Sbjct  130  IQFNEFIVLLCLIYLLKEPSSSHNTSKIDSPQLEATFDTVIEVFSFLDKNGDGKLNKTDM  189

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VKA N+A PLEKSP+HVTRTRFKEMDW + GK+SFR+FLFAF+DWVGID ++E
Sbjct  190  VKALNEASPLEKSPAHVTRTRFKEMDWSKRGKVSFREFLFAFIDWVGIDTNEE  242



>ref|XP_002266666.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Vitis vinifera]
 emb|CBI17320.3| unnamed protein product [Vitis vinifera]
Length=248

 Score =   253 bits (647),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGLK IR VF Q+DEDSNG ID EELKKCLQKLQ H+ E+EID+LF SCD D ++ 
Sbjct  69   PQFKEGLKNIRGVFAQYDEDSNGIIDHEELKKCLQKLQLHLTEQEIDDLFCSCDADGSQG  128

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIV+LCLIYLLM+ + S+  TSK+GSP +E+TF+TIVEAFLFLD NGDGKL+K+D
Sbjct  129  IQFNEFIVILCLIYLLMEPSTSTHPTSKMGSPQLEATFDTIVEAFLFLDNNGDGKLNKRD  188

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +VKA N+A P EKS +H+TRTRFKEMD +RSGK  FR FLFA  DWVG+DGD+E
Sbjct  189  MVKALNEASPCEKSSAHITRTRFKEMDGNRSGKAGFRDFLFALTDWVGLDGDEE  242



>ref|XP_010650356.1| PREDICTED: probable calcium-binding protein CML22 isoform X3 
[Vitis vinifera]
Length=225

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGLK IR VF Q+DEDSNG ID EELKKCLQKLQ H+ E+EID+LF SCD D ++ 
Sbjct  46   PQFKEGLKNIRGVFAQYDEDSNGIIDHEELKKCLQKLQLHLTEQEIDDLFCSCDADGSQG  105

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIV+LCLIYLLM+ + S+  TSK+GSP +E+TF+TIVEAFLFLD NGDGKL+K+D
Sbjct  106  IQFNEFIVILCLIYLLMEPSTSTHPTSKMGSPQLEATFDTIVEAFLFLDNNGDGKLNKRD  165

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +VKA N+A P EKS +H+TRTRFKEMD +RSGK  FR FLFA  DWVG+DGD+E
Sbjct  166  MVKALNEASPCEKSSAHITRTRFKEMDGNRSGKAGFRDFLFALTDWVGLDGDEE  219



>ref|XP_008438356.1| PREDICTED: probable calcium-binding protein CML22 [Cucumis melo]
 ref|XP_008438357.1| PREDICTED: probable calcium-binding protein CML22 [Cucumis melo]
Length=227

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGL+ IR VFEQ+DEDSNG+IDREELKKCLQKLQ H+ EEE+++LF SCD+D +  
Sbjct  52   PQFKEGLQNIRGVFEQYDEDSNGSIDREELKKCLQKLQMHMTEEEVEDLFHSCDIDGSAG  111

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL D  S  + SK+GSP +E+TF+TI++AF+FLDKNGDGKL++K++
Sbjct  112  IQFNEFIVLLCLIYLLKDEHSL-TKSKLGSPQLEATFDTIIQAFIFLDKNGDGKLNRKEM  170

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VKA N+A P E+SP+ +T+TRFKEMDW+ SGK++FR+FLF F++WVG+D DD+
Sbjct  171  VKALNEASPYERSPARITKTRFKEMDWNNSGKVNFREFLFGFINWVGVDTDDD  223



>gb|KJB72094.1| hypothetical protein B456_011G158400 [Gossypium raimondii]
Length=244

 Score =   249 bits (637),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FREGL+ +R VFEQ+DEDSNG IDREEL +CL+KLQ H  +EE+++LF SCD+D +E 
Sbjct  65   PQFREGLRNLRGVFEQYDEDSNGTIDREELNRCLEKLQLHFTKEEVEDLFHSCDIDGSEG  124

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLLM   SS  +T K+ S  +E+TF+TIVEAFLFLDKNGDGKL+KKD
Sbjct  125  IQFNEFIVLLCLIYLLMKPSSSPDNTLKMHSLQLEATFDTIVEAFLFLDKNGDGKLNKKD  184

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +VKA N+A P E+SP+ VTRTRFKEMDWD++GK+SFR+FLFAF++WVGI+ D+E
Sbjct  185  MVKALNEASPWERSPARVTRTRFKEMDWDKNGKVSFREFLFAFINWVGIESDEE  238



>ref|XP_004133997.1| PREDICTED: probable calcium-binding protein CML22-like [Cucumis 
sativus]
 ref|XP_004157676.1| PREDICTED: probable calcium-binding protein CML22-like [Cucumis 
sativus]
 gb|KGN56734.1| hypothetical protein Csa_3G130890 [Cucumis sativus]
Length=227

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGL+ IR VFEQ+DEDSNG+IDREELKKCLQ+LQ H+ EEE+++LF SCD+D +  
Sbjct  52   PQFKEGLQNIRGVFEQYDEDSNGSIDREELKKCLQQLQMHMTEEEVEDLFHSCDIDGSAG  111

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL D  S  + SK+GSP +E+TF+TI++AF+FLDKNGDGKL++K++
Sbjct  112  IQFNEFIVLLCLIYLLKDEHSL-TKSKLGSPQLEATFDTIIQAFIFLDKNGDGKLNRKEM  170

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VKA N+A P E+SP+ +T+TRFKEMDW+ SGK++FR+FLF F++WVG+D DD+
Sbjct  171  VKALNEASPYERSPARITKTRFKEMDWNNSGKVNFREFLFGFINWVGVDTDDD  223



>ref|XP_004299109.1| PREDICTED: probable calcium-binding protein CML22 [Fragaria vesca 
subsp. vesca]
Length=243

 Score =   249 bits (635),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 145/173 (84%), Gaps = 3/173 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FRE LK IR VF+ +DEDSNG IDREELKKCLQKLQ H+  EEI++LF SCD+D +E 
Sbjct  68   PQFREELKNIRNVFDLYDEDSNGTIDREELKKCLQKLQLHLTAEEIEDLFHSCDMDGSEG  127

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL D     +TSKI  P +E+TF+T++E F+FLDKNGDGKL+K +V
Sbjct  128  IQFNEFIVLLCLIYLLKDP---NTTSKIDCPQLEATFDTVIEVFVFLDKNGDGKLNKTEV  184

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VKA N+A P EKSPSHV+R RFKEMDWD++GK++FR+FLFAF+DWVGI+ D+E
Sbjct  185  VKALNEASPREKSPSHVSRNRFKEMDWDKNGKVTFRQFLFAFIDWVGIETDEE  237



>gb|KDP39372.1| hypothetical protein JCGZ_01129 [Jatropha curcas]
Length=225

 Score =   248 bits (633),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 151/174 (87%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F++GLK IR VFE +DED+NG IDR ELK+CLQKLQ ++ E+EI++LF SCD+D ++ 
Sbjct  46   PQFKDGLKNIRGVFELYDEDANGIIDRGELKRCLQKLQLNLKEQEIEDLFHSCDIDGSQG  105

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLL++  SS  STSK+GS  +E+TF+TIVEAFLFLDKNGDGKL+KKD
Sbjct  106  IQFNEFIVLLCLIYLLVEPSSSPHSTSKVGSRELEATFDTIVEAFLFLDKNGDGKLNKKD  165

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            V+KA N+A P EKSP+ VT++RF+EMDWDR+GK+SFR+FLFA ++WVGID D+E
Sbjct  166  VLKALNEASPWEKSPARVTKSRFREMDWDRNGKVSFREFLFALINWVGIDADEE  219



>gb|KHG12326.1| putative calcium-binding CML22 -like protein [Gossypium arboreum]
Length=244

 Score =   248 bits (634),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FREGL+ +R VF+Q+DEDSNG IDREEL +CL+KLQ H  +EE+++LF SCD+D +E 
Sbjct  65   PQFREGLRNLRGVFKQYDEDSNGTIDREELNRCLEKLQLHFTKEEVEDLFHSCDIDGSEG  124

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLLM   SS  +T K+ S  +E+TF+TIVEAFLFLDKNGDGKL+KKD
Sbjct  125  IQFNEFIVLLCLIYLLMKPSSSPDNTLKMHSLQLEATFDTIVEAFLFLDKNGDGKLNKKD  184

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            V+KA N+A P E+SP+ VTRTRFKEMDWD++GK+SFR+FLFAF++WVGI+ D+E
Sbjct  185  VMKALNEASPWERSPARVTRTRFKEMDWDKNGKVSFREFLFAFINWVGIESDEE  238



>ref|XP_011045652.1| PREDICTED: probable calcium-binding protein CML22 [Populus euphratica]
 ref|XP_011045653.1| PREDICTED: probable calcium-binding protein CML22 [Populus euphratica]
Length=248

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E LK IR VFEQ+DED+NG ID +ELKKCLQ LQ ++ EEE+++LF SCD+D +E 
Sbjct  69   PQFKEELKHIRGVFEQYDEDANGNIDMKELKKCLQNLQLNLKEEEVEDLFHSCDIDQSEG  128

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLL++  SS   TSK+GSP +E+TF+TI++AFLFLDKNG GKL+KKD
Sbjct  129  IQFNEFIVLLCLIYLLVEHSSSPLRTSKMGSPELEATFDTIIKAFLFLDKNGAGKLNKKD  188

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            ++KA N+  P EKSP+H+TR+RFKEMDWDR+GK+SFR+FLF+ +DW+GID D+E
Sbjct  189  MIKALNEDSPWEKSPTHITRSRFKEMDWDRNGKVSFREFLFSLIDWIGIDADEE  242



>ref|XP_002300172.2| hypothetical protein POPTR_0001s32210g [Populus trichocarpa]
 gb|EEE84977.2| hypothetical protein POPTR_0001s32210g [Populus trichocarpa]
Length=249

 Score =   246 bits (629),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E LK IR VFEQ+DED+NG ID EELKKCLQ LQ ++ EEE+++LF SCD+D +E 
Sbjct  69   PQFKEELKHIRGVFEQYDEDANGNIDMEELKKCLQNLQLNLKEEEVEDLFHSCDIDQSEG  128

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLL++  SS   TSK+GSP +E+TF+TIV+AFLFLDKNG GKL+KKD
Sbjct  129  IQFNEFIVLLCLIYLLVEHSSSPLRTSKMGSPELEATFDTIVKAFLFLDKNGAGKLNKKD  188

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            ++KA N+  P EKSP+H+TR+RFKEMDWDR+GK+SFR+FLF+ ++W+GID D++
Sbjct  189  MIKALNEDSPWEKSPAHITRSRFKEMDWDRNGKVSFREFLFSLINWIGIDADED  242



>ref|XP_006493813.1| PREDICTED: probable calcium-binding protein CML22-like isoform 
X2 [Citrus sinensis]
Length=222

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F++GLK I++VFEQ+DEDSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D +E 
Sbjct  46   PQFKDGLKNIKSVFEQYDEDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDIDGSEG  105

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL   PSS S SK+GSP +++TF+ IVE FLFLDKNGDG+L+KKD+
Sbjct  106  IQFNEFIVLLCLIYLLT-TPSSSSMSKMGSPQLKATFDAIVEVFLFLDKNGDGRLNKKDM  164

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VK  N+++P EKSP+HVTRTRF+EMDWDR+GK+SFR+FLFA + W+GID D+E
Sbjct  165  VKTLNESYPREKSPAHVTRTRFEEMDWDRNGKVSFREFLFALISWIGIDNDEE  217



>ref|XP_006493812.1| PREDICTED: probable calcium-binding protein CML22-like isoform 
X1 [Citrus sinensis]
Length=241

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F++GLK I++VFEQ+DEDSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D +E 
Sbjct  65   PQFKDGLKNIKSVFEQYDEDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDIDGSEG  124

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL   PSS S SK+GSP +++TF+ IVE FLFLDKNGDG+L+KKD+
Sbjct  125  IQFNEFIVLLCLIYLLT-TPSSSSMSKMGSPQLKATFDAIVEVFLFLDKNGDGRLNKKDM  183

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VK  N+++P EKSP+HVTRTRF+EMDWDR+GK+SFR+FLFA + W+GID D+E
Sbjct  184  VKTLNESYPREKSPAHVTRTRFEEMDWDRNGKVSFREFLFALISWIGIDNDEE  236



>gb|KDO61178.1| hypothetical protein CISIN_1g0262681mg, partial [Citrus sinensis]
Length=239

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F++GLK I++VFEQ+DEDSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D +E 
Sbjct  63   PQFKDGLKNIKSVFEQYDEDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDIDGSEG  122

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL   PSS S SK+GSP +++TF+ IVE FLFLDKNGDG+L+KKD+
Sbjct  123  IQFNEFIVLLCLIYLLT-TPSSSSMSKMGSPQLKATFDAIVEVFLFLDKNGDGRLNKKDM  181

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VK  N+++P EKSP+HVTRTRF+EMDWDR+GK+SFR+FLFA + W+GID D+E
Sbjct  182  VKTLNESYPREKSPAHVTRTRFEEMDWDRNGKVSFREFLFALISWIGIDNDEE  234



>ref|XP_006420904.1| hypothetical protein CICLE_v10005743mg [Citrus clementina]
 gb|ESR34144.1| hypothetical protein CICLE_v10005743mg [Citrus clementina]
Length=241

 Score =   243 bits (620),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 152/173 (88%), Gaps = 1/173 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F++GLK I++VFEQ+D+DSNG IDREELKKCL++LQ H+ EEEI++LF+SCD+D +E 
Sbjct  65   PQFKDGLKNIKSVFEQYDKDSNGTIDREELKKCLEELQLHLKEEEIEDLFKSCDIDGSEG  124

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL   PSS S SK+GSP +++TF+ IVE FLFLDKNGDG+L+KKD+
Sbjct  125  IQFNEFIVLLCLIYLLT-TPSSSSMSKMGSPQLKATFDAIVEVFLFLDKNGDGRLNKKDM  183

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VK  N+++P EKSP+HVTRTRF+EMDWDR+GK+SFR+FLFA + W+GID D+E
Sbjct  184  VKTLNESYPREKSPAHVTRTRFEEMDWDRNGKVSFREFLFALISWIGIDNDEE  236



>emb|CDO99460.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 142/174 (82%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGLKEIR +F+Q+DED+N  I+REELKKC Q+LQ  + EEEID+LF  CD+++NE 
Sbjct  25   PQFKEGLKEIRDIFQQYDEDNNATIEREELKKCSQELQLTIREEEIDDLFYYCDINENEG  84

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+ NEFIVLLCLIY L D +  S + S I SP +++TFN I+EAFLFLDK G GKL++KD
Sbjct  85   IQLNEFIVLLCLIYFLTDYSIPSHTASDILSPQLQATFNIIIEAFLFLDKKGKGKLNRKD  144

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            VV+A N+A  LE+SPSHVT TRFKEMDW+R GK+ FR+FLFAF+DWVG+D DDE
Sbjct  145  VVQALNEASSLERSPSHVTHTRFKEMDWNRKGKVGFREFLFAFIDWVGMDSDDE  198



>ref|XP_010241365.1| PREDICTED: probable calcium-binding protein CML22 [Nelumbo nucifera]
Length=247

 Score =   241 bits (615),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E ++ I+ VFEQ+DEDSNG+IDR+EL+KCL KLQ  + E+E+++LF+SCD+D NE 
Sbjct  72   PQFKEEMRLIKDVFEQYDEDSNGSIDRDELRKCLGKLQVQLTEKEMEDLFQSCDIDKNEG  131

Query  493  IKFNEFIVLLCLIYLLMDAPSSGST-SKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCL+YLLM+  SS +T S++GSP +E+ F+TI++AFLFLDKNGDGKL+KKD
Sbjct  132  IQFNEFIVLLCLVYLLMEPSSSSNTKSQMGSPQLEAVFDTIIQAFLFLDKNGDGKLNKKD  191

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            + KAFN+A   EK P H+T++RFKEMDW+RSGK+SF+ FLFA   WVGID DDE
Sbjct  192  LAKAFNEAPTQEKLPRHITKSRFKEMDWNRSGKVSFKDFLFALTKWVGIDTDDE  245



>ref|XP_010650355.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Vitis vinifera]
Length=242

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 142/174 (82%), Gaps = 7/174 (4%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGLK IR      DEDSNG ID EELKKCLQKLQ H+ E+EID+LF SCD D ++ 
Sbjct  69   PQFKEGLKNIR------DEDSNGIIDHEELKKCLQKLQLHLTEQEIDDLFCSCDADGSQG  122

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIV+LCLIYLLM+ + S+  TSK+GSP +E+TF+TIVEAFLFLD NGDGKL+K+D
Sbjct  123  IQFNEFIVILCLIYLLMEPSTSTHPTSKMGSPQLEATFDTIVEAFLFLDNNGDGKLNKRD  182

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +VKA N+A P EKS +H+TRTRFKEMD +RSGK  FR FLFA  DWVG+DGD+E
Sbjct  183  MVKALNEASPCEKSSAHITRTRFKEMDGNRSGKAGFRDFLFALTDWVGLDGDEE  236



>gb|KJB72093.1| hypothetical protein B456_011G158400 [Gossypium raimondii]
Length=238

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 144/174 (83%), Gaps = 7/174 (4%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FREGL+ +R      DEDSNG IDREEL +CL+KLQ H  +EE+++LF SCD+D +E 
Sbjct  65   PQFREGLRNLR------DEDSNGTIDREELNRCLEKLQLHFTKEEVEDLFHSCDIDGSEG  118

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLLM   SS  +T K+ S  +E+TF+TIVEAFLFLDKNGDGKL+KKD
Sbjct  119  IQFNEFIVLLCLIYLLMKPSSSPDNTLKMHSLQLEATFDTIVEAFLFLDKNGDGKLNKKD  178

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +VKA N+A P E+SP+ VTRTRFKEMDWD++GK+SFR+FLFAF++WVGI+ D+E
Sbjct  179  MVKALNEASPWERSPARVTRTRFKEMDWDKNGKVSFREFLFAFINWVGIESDEE  232



>ref|XP_002518103.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44236.1| conserved hypothetical protein [Ricinus communis]
Length=240

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 140/173 (81%), Gaps = 18/173 (10%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGLK IR VFEQ+DED+NGAIDREELK+CLQKLQ ++ E+E+++LF SCD+D ++ 
Sbjct  73   PRFKEGLKNIRGVFEQYDEDANGAIDREELKRCLQKLQINLKEQEVEDLFHSCDIDGSQG  132

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLIYLL                  +TF+TIVEAFLFLDKNG GKL KKDV
Sbjct  133  IQFNEFIVLLCLIYLL------------------ATFDTIVEAFLFLDKNGVGKLKKKDV  174

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +KA N+A P EKSP+H+T++RF+E+DWDR+GK+SFR+FLFA ++WVGID D+E
Sbjct  175  LKALNEASPWEKSPAHITKSRFQELDWDRNGKVSFREFLFALVNWVGIDADEE  227



>gb|EYU32662.1| hypothetical protein MIMGU_mgv1a012635mg [Erythranthe guttata]
Length=244

 Score =   231 bits (589),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 148/176 (84%), Gaps = 2/176 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FR+GLKEIR VFE++DEDSNG ID +ELKKCL  L+F V ++EID+LF  CD+D+NE 
Sbjct  67   PQFRDGLKEIRQVFEKYDEDSNGTIDNDELKKCLHALEFSVKDDEIDDLFLYCDMDENEG  126

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS--KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKK  320
            I+F EFIVLLCL YLL D+ +S S +  K+ SP +E+TFNTIVE FLFLDK GDGKL++K
Sbjct  127  IQFKEFIVLLCLNYLLTDSSTSSSHATLKMCSPKIEATFNTIVEVFLFLDKTGDGKLNRK  186

Query  319  DVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            DVVKA N+A P EKSPSH+TRTRFKEMDWD++GK+SF++FLF+F+ WVG+D D+++
Sbjct  187  DVVKALNEASPKEKSPSHITRTRFKEMDWDKNGKVSFKEFLFSFISWVGVDCDEDE  242



>gb|KCW60054.1| hypothetical protein EUGRSUZ_H02783, partial [Eucalyptus grandis]
Length=236

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGLK I  V+ Q+DE+SNG ID+EELKKCL ++Q H+ E+++++LF SCD+D+N++
Sbjct  64   PQFKEGLKNIEAVYHQYDENSNGKIDKEELKKCLDEVQLHLSEKDMEDLFHSCDIDENQE  123

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EFIVLLCLIYLL ++ S+  T K+GSP +++TF+TI+EAFLFLDK+GDGKL KK V
Sbjct  124  IRFTEFIVLLCLIYLLKESSSTNETEKVGSPSIQATFDTIIEAFLFLDKDGDGKLKKKHV  183

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            +KA ND  P EKSP HVT  RFKEMDW R G +SFR+FLF F+DWVG++ +
Sbjct  184  IKALNDTSPREKSPRHVTGKRFKEMDWRRKGNVSFREFLFTFIDWVGVETN  234



>ref|XP_007034374.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao]
 gb|EOY05300.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao]
Length=217

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 125/145 (86%), Gaps = 1/145 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FR+GLK +R VFEQ+DEDSNG IDREEL KCL+KLQFH+ +EE+++LF SCD+D +E 
Sbjct  65   PQFRDGLKNLRGVFEQYDEDSNGTIDREELNKCLEKLQFHLTKEEVEDLFHSCDIDGSEG  124

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+FNEFIVLLCLIYLLM  +PS  +T KI SP +E+TF+TIVEAFLFLDKNGDGKL+KKD
Sbjct  125  IQFNEFIVLLCLIYLLMKPSPSPDTTLKIDSPQLEATFDTIVEAFLFLDKNGDGKLNKKD  184

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKE  242
            ++KA N+A P E+SP+HVTRTRF E
Sbjct  185  MIKALNEASPWERSPAHVTRTRFME  209



>ref|XP_010513185.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=229

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 135/180 (75%), Gaps = 5/180 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  REGL+ IR VFE +D DSNG ID EELKKCL++LQ  + +EE+  L+  CDVD ++ 
Sbjct  49   PKLREGLRNIRNVFESYDNDSNGTIDIEELKKCLEELQLSLSDEEVKGLYGWCDVDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS---KIGSPVVESTFNTIVEAFLFLDKNGDGKLHK  323
            I+FNEFIVLLCLIYLL   PSS S +   ++G  +VES F+ IVE FLFLDK+G GKL+K
Sbjct  109  IQFNEFIVLLCLIYLL-SKPSSESNAESREMGPKLVESIFDPIVEVFLFLDKDGKGKLNK  167

Query  322  KDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHM  146
             DV+K  N+  +PLE+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D+ +M
Sbjct  168  ADVIKTLNNEDYPLERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDDADDYYM  227



>ref|XP_010023705.1| PREDICTED: probable calcium-binding protein CML22 [Eucalyptus 
grandis]
Length=260

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGLK I  V+ Q+DE+SNG ID+EELKKCL ++Q H+ E+++++LF SCD+D+N++
Sbjct  70   PQFKEGLKNIEAVYHQYDENSNGKIDKEELKKCLDEVQLHLSEKDMEDLFHSCDIDENQE  129

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EFIVLLCLIYLL ++ S+  T K+GSP +++TF+TI+EAFLFLDK+GDGKL KK V
Sbjct  130  IRFTEFIVLLCLIYLLKESSSTNETEKVGSPSIQATFDTIIEAFLFLDKDGDGKLKKKHV  189

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            +KA ND  P EKSP HVT  RFKEMDW R G +SFR+FLF F+DWVG++ +
Sbjct  190  IKALNDTSPREKSPRHVTGKRFKEMDWRRKGNVSFREFLFTFIDWVGVETN  240



>gb|KFK39709.1| hypothetical protein AALP_AA3G278300 [Arabis alpina]
Length=228

 Score =   210 bits (534),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 135/180 (75%), Gaps = 4/180 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  REGL+ IR VFE +D+D NG ID EELKKCL++L+  + EEE+  L+  CDVD ++ 
Sbjct  49   PTLREGLRNIRNVFESYDKDRNGTIDMEELKKCLEELKLSLSEEEVKGLYGWCDVDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSK-IGSPVVESTFNTIVEAFLFLDKNGDGKLHKK  320
            I+FNEF+VLLCLIYLL   +P S + S+ +G  +VES F+ I E FLFLDK+G GKL+K 
Sbjct  109  IQFNEFVVLLCLIYLLAKPSPKSSAESREMGPKLVESIFDPIAEVFLFLDKDGKGKLNKA  168

Query  319  DVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
            DV+K  N+  +P E+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D D ED+M+
Sbjct  169  DVIKTLNNEDYPFERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD-DAEDYMS  227



>ref|XP_007034373.1| Calcium-binding EF-hand family protein isoform 2 [Theobroma cacao]
 gb|EOY05299.1| Calcium-binding EF-hand family protein isoform 2 [Theobroma cacao]
Length=220

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FR+GLK +R VFEQ+DEDSNG IDREEL KCL+KLQFH+ +EE+++LF SCD+D +E 
Sbjct  65   PQFRDGLKNLRGVFEQYDEDSNGTIDREELNKCLEKLQFHLTKEEVEDLFHSCDIDGSEG  124

Query  493  IKFNEFIVLLCLIYLLMD---APSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
            I+FNEFIVLLCLIYLLM    +P + ST+ KI SP +E+TF+TIVEAFLFLDKNGDGKL+
Sbjct  125  IQFNEFIVLLCLIYLLMKPSPSPDTVSTTLKIDSPQLEATFDTIVEAFLFLDKNGDGKLN  184

Query  325  KKDVVKAFNDAFPLEKSPSHVTRTRFKE  242
            KKD++KA N+A P E+SP+HVTRTRF E
Sbjct  185  KKDMIKALNEASPWERSPAHVTRTRFME  212



>ref|XP_010466782.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
 ref|XP_010466783.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=229

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 133/181 (73%), Gaps = 5/181 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  REGL+ IR VFE +D D NG ID EELKKCL++LQ  + +EE+  L+  CDVD ++ 
Sbjct  49   PKLREGLRNIRNVFESYDNDKNGTIDIEELKKCLEELQLSLSDEEVKGLYGWCDVDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS---KIGSPVVESTFNTIVEAFLFLDKNGDGKLHK  323
            I+FNEFIVLLCLIYLL   PSS S +   ++G  +VES F+ IVE FLFLDK+G GKL+K
Sbjct  109  IQFNEFIVLLCLIYLL-SKPSSESNAESREMGPKLVESIFDPIVEVFLFLDKDGKGKLNK  167

Query  322  KDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHM  146
             DV    N+  +PLE+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D+ +M
Sbjct  168  ADVTTTLNNEDYPLERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDVADDYYM  227

Query  145  A  143
            +
Sbjct  228  S  228



>ref|XP_008778084.1| PREDICTED: probable calcium-binding protein CML22 [Phoenix dactylifera]
Length=227

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 143/178 (80%), Gaps = 1/178 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            PHF++GL  I+ VFEQ+DEDSNG IDREELKKCL  LQ H+ EEEI+ L+  CDVD NE 
Sbjct  50   PHFKDGLGNIKDVFEQYDEDSNGTIDREELKKCLSTLQVHLTEEEINGLYHYCDVDGNEG  109

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            ++FNEFI+LLCLIYLLM+ A ++ +  +IGSP +E+ F+ IV+AFLFLDKNGDGKL +KD
Sbjct  110  MQFNEFIILLCLIYLLMEPASATDNMPRIGSPQLEAAFDAIVDAFLFLDKNGDGKLKRKD  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
            ++ AFN+    EKSP+H+T  RFKEMDW++ GK++F++FLF+F  W+G+D DD++ + 
Sbjct  170  MMLAFNETTTKEKSPNHITLRRFKEMDWNKDGKVNFKEFLFSFSKWIGMDNDDQESLV  227



>ref|XP_010532790.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Tarenaya hassleriana]
Length=228

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  REGL+ IR VFE +D+D NG ID EELK CL++L  ++ EEE+++L+  CDVD ++ 
Sbjct  46   PRLREGLRNIRGVFESYDKDGNGTIDLEELKNCLEELNLNMSEEEVEDLYGWCDVDGSKG  105

Query  493  IKFNEFIVLLCLIYLLMD--APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKK  320
            I+FNEFIVLLCLIYLL +  +PS+ ++ +IG   + +TF+ I+E FLFLDKNGDG L+K 
Sbjct  106  IQFNEFIVLLCLIYLLAEPSSPSNTTSPEIGERGLGATFDPIIEIFLFLDKNGDGMLNKL  165

Query  319  DVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            DV   +N A+P EKSPSHVT+ RF+EMDW R GK+ FR+F+FAF+ WVG+
Sbjct  166  DVRTTWNGAYPREKSPSHVTKMRFEEMDWGRKGKVGFREFMFAFISWVGL  215



>ref|NP_189053.1| putative calcium-binding protein CML22 [Arabidopsis thaliana]
 sp|Q9LRN6.1|CML22_ARATH RecName: Full=Probable calcium-binding protein CML22; AltName: 
Full=Calmodulin-like protein 22 [Arabidopsis thaliana]
 dbj|BAB01352.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76858.1| putative calcium-binding protein CML22 [Arabidopsis thaliana]
Length=229

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 135/180 (75%), Gaps = 3/180 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  REGL+ IR+VFE +D D+NG ID EELKKCL++L+  + +EE+  L+  CDVD ++ 
Sbjct  49   PKLREGLRNIRSVFESYDNDTNGTIDIEELKKCLEELKLSLSDEEVKGLYSWCDVDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDA--PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKK  320
            I+FNEFIVLLCLIYLL      SS  + ++G  +VES F+ IVE FLFLDK+G GKL+K 
Sbjct  109  IQFNEFIVLLCLIYLLAKPSSESSTESREMGPKLVESIFDPIVEVFLFLDKDGKGKLNKA  168

Query  319  DVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
            DV+K  N+  +PLE+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D+D M+
Sbjct  169  DVIKTLNNEDYPLERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDDADDDFMS  228



>ref|XP_010107777.1| putative calcium-binding protein CML22 [Morus notabilis]
 gb|EXC16942.1| putative calcium-binding protein CML22 [Morus notabilis]
Length=233

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 135/173 (78%), Gaps = 17/173 (10%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P FRE LK IR+VFEQ+DEDSNGAIDR ELK  LQ+LQ  + EEE+D+LF SCD+D +E 
Sbjct  69   PQFREELKRIRSVFEQYDEDSNGAIDRVELKNSLQQLQLQLSEEEVDDLFHSCDIDGSEG  128

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFI+                 SK+GSP +E+TF+TI+E FLFLDKNGDGKL+KKD+
Sbjct  129  IQFNEFIM-----------------SKMGSPQLEATFDTIIEVFLFLDKNGDGKLNKKDM  171

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            V+A ND+   E+SP+H+TR+RF+EMDWDR+G +SFR+FLFAF+ WVGI+ D+E
Sbjct  172  VRALNDSNTSERSPAHITRSRFREMDWDRNGHVSFREFLFAFIHWVGIETDEE  224



>ref|XP_010909319.1| PREDICTED: probable calcium-binding protein CML22 [Elaeis guineensis]
Length=249

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            PHF++GL  I+ VFEQ+DEDSNG ID EELKKCL  LQ H+ EEEI+ L+  CDVD NE 
Sbjct  72   PHFKDGLGNIKDVFEQYDEDSNGTIDLEELKKCLSTLQVHLTEEEINGLYHYCDVDGNEG  131

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+ NEFI+LLCLIYLLM+ A ++   S+IGSP VE+TF+ IV+AFLFLDKNGDGK+ +KD
Sbjct  132  IQVNEFIILLCLIYLLMEPASATDRMSRIGSPQVEATFDAIVDAFLFLDKNGDGKIKRKD  191

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHM  146
            ++ AFN+    EKSP H+T  RFKEMDW++ GK++F++FLF+F  W+G+D DD++ +
Sbjct  192  MMLAFNETTTKEKSPKHITLRRFKEMDWNKKGKVNFKEFLFSFTKWIGMDADDQESL  248



>ref|XP_010532789.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Tarenaya hassleriana]
Length=267

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  REGL+ IR VFE +D+D NG ID EELK CL++L  ++ EEE+++L+  CDVD ++ 
Sbjct  85   PRLREGLRNIRGVFESYDKDGNGTIDLEELKNCLEELNLNMSEEEVEDLYGWCDVDGSKG  144

Query  493  IKFNEFIVLLCLIYLLMD--APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKK  320
            I+FNEFIVLLCLIYLL +  +PS+ ++ +IG   + +TF+ I+E FLFLDKNGDG L+K 
Sbjct  145  IQFNEFIVLLCLIYLLAEPSSPSNTTSPEIGERGLGATFDPIIEIFLFLDKNGDGMLNKL  204

Query  319  DVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            DV   +N A+P EKSPSHVT+ RF+EMDW R GK+ FR+F+FAF+ WVG+
Sbjct  205  DVRTTWNGAYPREKSPSHVTKMRFEEMDWGRKGKVGFREFMFAFISWVGL  254



>ref|XP_010488497.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
 ref|XP_010488498.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=240

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 135/182 (74%), Gaps = 6/182 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNE  497
            P  REGL+ IR+VFE +D D NG ID EELKKCL++LQ   + +EE+  L+  CDVD ++
Sbjct  49   PKLREGLRNIRSVFESYDNDKNGTIDIEELKKCLEELQLISLSDEEVKGLYGWCDVDGSK  108

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSK---IGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
             I+FNEFIVLLCLIYLL   PSS S ++   +G  +VES F+ IVE FLFLDK+G GKL+
Sbjct  109  GIQFNEFIVLLCLIYLL-SKPSSESNAESREMGPKLVESIFDPIVEVFLFLDKDGKGKLN  167

Query  325  KKDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            K DV+K  N+  +PLE+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D+ +
Sbjct  168  KADVIKTLNNEDYPLERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDDADDYY  227

Query  148  MA  143
            + 
Sbjct  228  IV  229



>gb|KHN01846.1| Putative calcium-binding protein CML22 [Glycine soja]
Length=193

 Score =   203 bits (516),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 135/173 (78%), Gaps = 1/173 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E LK +R +FEQ+DEDSNG+I+  ELKK L+ L+ H+ E+EI+ LF+ CD+D ++ 
Sbjct  22   PMFKERLKTLRGMFEQYDEDSNGSIEPNELKKFLEHLELHLKEQEIEHLFQYCDLDGSKG  81

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLI+LL +  SS  +SK     V   FNTIVE F+F D+NGDGKL++KD+
Sbjct  82   IQFNEFIVLLCLIHLLAEPSSSDISSKAELAQVGEIFNTIVEVFVFFDQNGDGKLNQKDM  141

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            V+  N+  P E+SP+ +++ RF+EMDWD++G+++FR+FLF F++WVGI GDDE
Sbjct  142  VRTLNETNPRERSPARISKHRFQEMDWDKNGQVTFREFLFGFINWVGI-GDDE  193



>ref|XP_006418801.1| hypothetical protein EUTSA_v10002654mg [Eutrema salsugineum]
 gb|ESQ37237.1| hypothetical protein EUTSA_v10002654mg [Eutrema salsugineum]
Length=226

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 132/176 (75%), Gaps = 3/176 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  REGL+ IR+VFE +D+D NG ID EELKKCL++L+  + EEE+  L+  CDVD ++ 
Sbjct  49   PKLREGLRNIRSVFESYDKDGNGTIDMEELKKCLEELKLSLSEEEVKGLYGWCDVDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDA--PSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKK  320
            I+FNEFIVLLCLIYLL      SS  + ++G  +VES F+ IVE FLFLDK+G GKL+K 
Sbjct  109  IEFNEFIVLLCLIYLLAKPSSESSLESREMGPKLVESVFDPIVEVFLFLDKDGKGKLNKA  168

Query  319  DVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            DV+K  N+  +PLE+SPSHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D+
Sbjct  169  DVIKTLNNEDYPLERSPSHVTNMRFEEMDWGRKGKVGFREFLFAFIGWVGLDDADD  224



>ref|XP_003530839.1| PREDICTED: probable calcium-binding protein CML22-like [Glycine 
max]
Length=216

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 135/173 (78%), Gaps = 1/173 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E LK +R +FEQ+DEDSNG+I+  ELKK L+ L+ H+ E+EI+ LF+ CD+D ++ 
Sbjct  45   PMFKERLKTLRGMFEQYDEDSNGSIEPNELKKFLEHLELHLKEQEIEHLFQYCDLDGSKG  104

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLI+LL +  SS  +SK     V   FNTIVE F+F D+NGDGKL++KD+
Sbjct  105  IQFNEFIVLLCLIHLLAEPSSSDISSKAELAQVGEIFNTIVEVFVFFDQNGDGKLNQKDM  164

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            V+  N+  P E+SP+ +++ RF+EMDWD++G+++FR+FLF F++WVGI GDDE
Sbjct  165  VRTLNETNPRERSPARISKHRFQEMDWDKNGQVTFREFLFGFINWVGI-GDDE  216



>ref|XP_007140756.1| hypothetical protein PHAVU_008G139100g [Phaseolus vulgaris]
 gb|ESW12750.1| hypothetical protein PHAVU_008G139100g [Phaseolus vulgaris]
Length=220

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E LK +R +FEQ+DEDSNG+I+  ELKK L+ L  H+ E+EI+ LF  CD+D ++ 
Sbjct  49   PMFKEKLKTLRGMFEQYDEDSNGSIEPNELKKFLEHLDLHLKEKEIETLFEYCDIDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLI+LL +  SS ++SK G   V   FN IVE F+F DKNGDGKL+KKD+
Sbjct  109  IQFNEFIVLLCLIHLLEEPSSSNNSSKAGLERVGEIFNAIVETFVFFDKNGDGKLNKKDM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            V+  N+  P E+SP+ +++ RF+EMDWD++G+++FR+FLF F++WVGID D+
Sbjct  169  VRTLNETNPRERSPARISKHRFQEMDWDKNGQVTFREFLFGFINWVGIDADE  220



>gb|AFK36647.1| unknown [Lotus japonicus]
Length=220

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 129/172 (75%), Gaps = 0/172 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F E LK +R +FEQFDEDSNG+I+  ELK  L  L+ H+ E+EI+ LF  CD+D ++ 
Sbjct  49   PMFHERLKTLRGMFEQFDEDSNGSIEPNELKGFLDHLELHLPEQEIENLFHYCDIDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLI+LL +  S  ++ K     +   FNTIVE FLF DKNGDGKL++KD+
Sbjct  109  IQFNEFIVLLCLIHLLTEPLSYDTSPKAELAKLGEVFNTIVEVFLFFDKNGDGKLNQKDM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            ++  N+  P E+SP+ +T+ RF+EMDWD++G+++FR+FLF F++WVGID D+
Sbjct  169  IRTLNETNPRERSPARITKDRFREMDWDKNGQVTFREFLFGFINWVGIDVDE  220



>emb|CDY18071.1| BnaA01g23320D [Brassica napus]
Length=229

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 133/181 (73%), Gaps = 5/181 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNE  497
            P  REGL++IRTVFE +D D NG ID EELKKCL +L+   + EEE+  L+  CDVD ++
Sbjct  49   PKLREGLRKIRTVFESYDSDGNGTIDMEELKKCLVELELMSLSEEEVKGLYGWCDVDGSK  108

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSK--IGSPVVESTFNTIVEAFLFLDKNGDGKLHK  323
             I+FNEFIVLLCLIYLL    S  S+    +G  +VES F+ IVE FLFLDK+G GKL+K
Sbjct  109  GIQFNEFIVLLCLIYLLAKPSSPSSSESSEMGPKLVESIFDPIVEVFLFLDKDGKGKLNK  168

Query  322  KDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHM  146
             DV+K  N+  +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D D +D++
Sbjct  169  ADVIKRLNNEDYPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD-DADDYI  227

Query  145  A  143
            +
Sbjct  228  S  228



>ref|XP_009106153.1| PREDICTED: probable calcium-binding protein CML22 [Brassica rapa]
Length=233

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 134/182 (74%), Gaps = 6/182 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNE  497
            P  REGL++IRTVFE +D D NG ID EELKKCL +L+   + EEE+  L+  CDVD ++
Sbjct  52   PKLREGLRKIRTVFESYDSDGNGTIDMEELKKCLVELELMSLSEEEVKGLYGWCDVDGSK  111

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSK---IGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
             I+FNEFIVLLCLIYLL    S  S+ +   +G  +VES F+ IVE FLFLDK+G GKL+
Sbjct  112  GIQFNEFIVLLCLIYLLAKPSSPSSSEESSEMGPKLVESIFDPIVEVFLFLDKDGKGKLN  171

Query  325  KKDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            K DV+K  N+  +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D D +D+
Sbjct  172  KADVIKRLNNEDYPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD-DADDY  230

Query  148  MA  143
            ++
Sbjct  231  IS  232



>emb|CDY46335.1| BnaC01g30350D [Brassica napus]
 emb|CDY18072.1| BnaA01g23330D [Brassica napus]
Length=230

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 134/182 (74%), Gaps = 6/182 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNE  497
            P  REGL++IRTVFE +D D NG ID EELKKCL +L+   + EEE+  L+  CDVD ++
Sbjct  49   PKLREGLRKIRTVFESYDSDGNGTIDMEELKKCLVELELMSLSEEEVKGLYGWCDVDGSK  108

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSK---IGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
             I+FNEFIVLLCLIYLL    S  S+ +   +G  +VES F+ IVE FLFLDK+G GKL+
Sbjct  109  GIQFNEFIVLLCLIYLLAKPSSPSSSEESSEMGPKLVESIFDPIVEVFLFLDKDGKGKLN  168

Query  325  KKDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            K DV+K  N+  +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D D +D+
Sbjct  169  KADVIKRLNNEDYPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD-DADDY  227

Query  148  MA  143
            ++
Sbjct  228  IS  229



>ref|XP_003563635.1| PREDICTED: probable calcium-binding protein CML21 [Brachypodium 
distachyon]
 ref|XP_010227514.1| PREDICTED: probable calcium-binding protein CML21 [Brachypodium 
distachyon]
Length=224

 Score =   197 bits (500),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   EGL++ +T+FEQFDEDSNG ID++ELK C QKL+    EE+I +LF +CD++++  
Sbjct  49   PKIDEGLRKCKTIFEQFDEDSNGEIDKDELKHCFQKLEISFTEEDITDLFEACDINEHMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LC++YLL D P+S + +K+G   +ESTF T+V+AF+FLDKN DG + K ++
Sbjct  109  MKFNEFIVFLCIVYLLNDPPASEAKAKMGLGNLESTFETLVDAFVFLDKNKDGYVSKDEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            ++A N++ P E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI G++ED
Sbjct  169  IQAINESIPGERSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGI-GENED  221



>ref|XP_009406355.1| PREDICTED: probable calcium-binding protein CML22 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406356.1| PREDICTED: probable calcium-binding protein CML22 [Musa acuminata 
subsp. malaccensis]
Length=291

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 128/174 (74%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            PHF+EGL+ I+ +FE++DEDSNG +  EELKKCL+ LQ  + E++ID L+  C +D+N+ 
Sbjct  108  PHFKEGLQNIKNIFEKYDEDSNGTMHHEELKKCLRMLQIQLSEKDIDRLYHYCGMDENKG  167

Query  493  IKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+++EFIVLLC  YLL    S + + S   S  VE+TF+ + EAF FLDKNGDGKL KKD
Sbjct  168  IQYHEFIVLLCFAYLLAGPDSATNNMSNSASRHVEATFDKLAEAFAFLDKNGDGKLDKKD  227

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            ++ A N+A   EKSP+H+T  RFKEMD ++ G +SF++FLF+ + W+GID D E
Sbjct  228  IILALNEAPSKEKSPTHITSRRFKEMDRNKDGTVSFKEFLFSLIKWIGIDTDHE  281



>ref|XP_004509621.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Cicer arietinum]
Length=229

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ R +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++D+  
Sbjct  50   PKIDESFRKCRAIFEQFDEDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINDDLG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL D P++  + S+IG P +E+TF T+V+ F+FLDKN DG + K +
Sbjct  110  MKFNEFIVLLCLVYLLKDDPAALHAKSRIGMPNLEATFETLVDTFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID  +++  AE
Sbjct  170  MVQAINETTSGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGIDEFEDEENAE  228



>gb|EMT01046.1| Putative calcium-binding protein CML21 [Aegilops tauschii]
Length=224

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 131/174 (75%), Gaps = 1/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   EGL++ +T+FEQFDEDSNG ID+EELK C  KL+    EEEI +LF +CD++++  
Sbjct  49   PKIDEGLRKCKTIFEQFDEDSNGEIDKEELKNCFHKLEISFTEEEISDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +K+NEFIV LCL+YLL D  +S + +K+G   +ESTF T+V+AF+FLDKN DG + K ++
Sbjct  109  MKYNEFIVFLCLVYLLNDPAASEAKTKMGLGDLESTFETLVDAFVFLDKNKDGYVSKDEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            ++A N++ P E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI G++ED
Sbjct  169  IQAINESIPGERSAGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGI-GENED  221



>ref|XP_009409857.1| PREDICTED: probable calcium-binding protein CML21 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409859.1| PREDICTED: probable calcium-binding protein CML21 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409860.1| PREDICTED: probable calcium-binding protein CML21 [Musa acuminata 
subsp. malaccensis]
Length=223

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ +++FEQFDEDSNGAID+EELK C QKL+    E+EI +LF +CD+D+N  
Sbjct  49   PKIDESLRKCKSIFEQFDEDSNGAIDQEELKHCFQKLEISFNEQEIGDLFLACDIDENMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIVLLCL+YLL +  +  + S++G P +E+TF T+V+AF+FLDKN DG + K ++
Sbjct  109  MKFNEFIVLLCLVYLLKEPAAVQANSRMGLPDLETTFETLVDAFVFLDKNKDGYVSKNEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            V A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID
Sbjct  169  VHAINETTGGERSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGID  217



>emb|CDX85172.1| BnaC07g07340D [Brassica napus]
Length=526

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 131/178 (74%), Gaps = 7/178 (4%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNE  497
            P  REGL+ IR VFE +D+D NG ID EELKKCL++L+   + EEE+  L+  CDVD ++
Sbjct  345  PKLREGLRNIRNVFESYDQDRNGTIDMEELKKCLEELKLMSLSEEEVKGLYGWCDVDGSK  404

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGS----TSKIGSPVVESTFNTIVEAFLFLDKNGDGKL  329
             I+FNEFIVLLCLIYLL   PS+ S    + ++G  +VES F+ I+E FLFLDK+G GKL
Sbjct  405  GIQFNEFIVLLCLIYLLAK-PSAESNVEESIELGPKLVESIFDPILEVFLFLDKDGKGKL  463

Query  328  HKKDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            +K DV+K  N+  +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVGID  D
Sbjct  464  NKADVIKTLNNEDYPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGIDDAD  521



>gb|KEH22469.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=220

 Score =   194 bits (494),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E LK +R +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ 
Sbjct  49   PMFKERLKTLRGMFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLI++L +  SS ++ K     +   F+ I+E FLF D+NGDGKL+KKD+
Sbjct  109  IQFNEFIVLLCLIHILTEPLSSDNSPKEELAQLGQVFDKIIEIFLFFDQNGDGKLNKKDM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            V+  N+  P E+SP+HVT+ RF+EMDWD++G+++FR+FLF F++WVGID D+
Sbjct  169  VRTMNETNPRERSPAHVTKNRFREMDWDKNGQVTFREFLFGFINWVGIDVDE  220



>gb|KEH22470.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=238

 Score =   195 bits (495),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E LK +R +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ 
Sbjct  67   PMFKERLKTLRGMFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKG  126

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLI++L +  SS ++ K     +   F+ I+E FLF D+NGDGKL+KKD+
Sbjct  127  IQFNEFIVLLCLIHILTEPLSSDNSPKEELAQLGQVFDKIIEIFLFFDQNGDGKLNKKDM  186

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            V+  N+  P E+SP+HVT+ RF+EMDWD++G+++FR+FLF F++WVGID D+
Sbjct  187  VRTMNETNPRERSPAHVTKNRFREMDWDKNGQVTFREFLFGFINWVGIDVDE  238



>emb|CDX77458.1| BnaA07g05960D [Brassica napus]
Length=230

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 126/174 (72%), Gaps = 5/174 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNE  497
            P  +EGL+ IR VFE +D+D NG ID EELKKCL++L+   + +EE+  L+  CDVD ++
Sbjct  49   PKLKEGLRNIRNVFESYDQDGNGTIDMEELKKCLEELKLMSLSDEEVKGLYGWCDVDGSK  108

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSK---IGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
             I+FNEFIVLLCLIYLL    S     +   +G  +VES F+ IVE FLFLDK+G GKL+
Sbjct  109  GIQFNEFIVLLCLIYLLAKPSSESREEESRELGPKLVESIFDPIVEVFLFLDKDGKGKLN  168

Query  325  KKDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            K DV+K  N+  +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D
Sbjct  169  KADVIKTLNNEDYPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD  222



>ref|XP_009102545.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Brassica rapa]
Length=230

 Score =   194 bits (493),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 126/174 (72%), Gaps = 5/174 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNE  497
            P  +EGL+ IR VFE +D+D NG ID EELKKCL++L+   + +EE+  L+  CDVD ++
Sbjct  49   PKLKEGLRNIRNVFESYDQDGNGTIDMEELKKCLEELKLMSLSDEEVKGLYGWCDVDGSK  108

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSK---IGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
             I+FNEFIVLLCLIYLL    S     +   +G  +VES F+ IVE FLFLDK+G GKL+
Sbjct  109  GIQFNEFIVLLCLIYLLAKPSSESREEESRELGPKLVESIFDPIVEVFLFLDKDGKGKLN  168

Query  325  KKDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            K DV+K  N+  +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D
Sbjct  169  KADVIKTLNNEDYPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD  222



>gb|KHG01864.1| putative calcium-binding CML21 -like protein [Gossypium arboreum]
Length=215

 Score =   194 bits (492),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 123/169 (73%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + VFEQFDEDSNGAID EELKKC  KLQ    EEEI +LF++CD + N  
Sbjct  35   PKIDESLRNCKAVFEQFDEDSNGAIDNEELKKCFNKLQISFTEEEISDLFKACDFNQNMG  94

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVLLCL+YLL D AP     S++G P +E+TF T V+AF+FLDKN DG + K +
Sbjct  95   IKFNEFIVLLCLVYLLKDNAPGHEGKSRMGMPNLEATFETFVDAFVFLDKNKDGFVSKNE  154

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N++   E+S   +   RF+EMDWD++G +SF++FLFAF +WVGI
Sbjct  155  MVQAINES--GERSSGRIAMKRFEEMDWDKNGSVSFKEFLFAFTNWVGI  201



>ref|XP_009102544.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Brassica rapa]
Length=246

 Score =   195 bits (495),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQF-HVGEEEIDELFRSCDVDDNE  497
            P  +EGL+ IR VFE +D+D NG ID EELKKCL++L+   + +EE+  L+  CDVD ++
Sbjct  65   PKLKEGLRNIRNVFESYDQDGNGTIDMEELKKCLEELKLMSLSDEEVKGLYGWCDVDGSK  124

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSK---IGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
             I+FNEFIVLLCLIYLL    S     +   +G  +VES F+ IVE FLFLDK+G GKL+
Sbjct  125  GIQFNEFIVLLCLIYLLAKPSSESREEESRELGPKLVESIFDPIVEVFLFLDKDGKGKLN  184

Query  325  KKDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            K DV+K  N+  +PLE+SP HVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D  D
Sbjct  185  KADVIKTLNNEDYPLERSPKHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLDDVD  241



>gb|KJB11853.1| hypothetical protein B456_002G104000 [Gossypium raimondii]
Length=215

 Score =   194 bits (492),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 123/169 (73%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + VFEQFDEDSNGAID EELKKC  KLQ    EEEI +LF++CD + N  
Sbjct  35   PKIDESLRNCKAVFEQFDEDSNGAIDNEELKKCFNKLQISFTEEEISDLFKACDFNQNMG  94

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVLLCL+YLL D AP     S++G P +E+TF T V+AF+FLDKN DG + K +
Sbjct  95   IKFNEFIVLLCLVYLLKDNAPGHEGKSRMGMPNLEATFETFVDAFVFLDKNKDGFVSKNE  154

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N++   E+S   +   RF+EMDWD++G +SF++FLFAF +WVGI
Sbjct  155  MVQAINES--GERSSGRIAMKRFEEMDWDKNGSVSFKEFLFAFTNWVGI  201



>ref|XP_010691275.1| PREDICTED: probable calcium-binding protein CML22 isoform X4 
[Beta vulgaris subsp. vulgaris]
Length=236

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 127/172 (74%), Gaps = 2/172 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  +E +K++R VFE +DED +G+IDREELK+C ++LQ ++  EE D+LF SCDVD N +
Sbjct  54   PQLKEQVKKLRGVFEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDDLFESCDVDRNGR  113

Query  493  IKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+F EFIVLLCLIYL+    S + + S+  SP  E+TF+ IV+ F+++DKNGDGKL KKD
Sbjct  114  IQFREFIVLLCLIYLITKPSSPTDAVSRTESPNWEATFDIIVQVFIYMDKNGDGKLSKKD  173

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            +V A  +  P E+SPSHV +TRF EMD D+ G ++FR++LF    W+GID D
Sbjct  174  MVAALTEP-PWERSPSHVMKTRFMEMDKDKDGNVTFREYLFGLTSWLGIDSD  224



>ref|XP_010691270.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010691272.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=264

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 128/174 (74%), Gaps = 2/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  +E +K++R VFE +DED +G+IDREELK+C ++LQ ++  EE D+LF SCDVD N +
Sbjct  82   PQLKEQVKKLRGVFEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDDLFESCDVDRNGR  141

Query  493  IKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+F EFIVLLCLIYL+    S + + S+  SP  E+TF+ IV+ F+++DKNGDGKL KKD
Sbjct  142  IQFREFIVLLCLIYLITKPSSPTDAVSRTESPNWEATFDIIVQVFIYMDKNGDGKLSKKD  201

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +V A  +  P E+SPSHV +TRF EMD D+ G ++FR++LF    W+GID D +
Sbjct  202  MVAALTEP-PWERSPSHVMKTRFMEMDKDKDGNVTFREYLFGLTSWLGIDSDSD  254



>ref|XP_008794706.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
Length=226

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = -2

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
            E L+  +T+FE+FDEDSNGAID EELK+C Q L+    EEEI++LF++CD+++N  IKFN
Sbjct  53   ESLRNCKTIFERFDEDSNGAIDPEELKRCFQNLEISATEEEINDLFKACDINENMGIKFN  112

Query  481  EFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAF  302
            EFIVLLCL+YLL +  ++   S +G P +E+TF T+V+AF+FLDKN DG + K ++V+A 
Sbjct  113  EFIVLLCLVYLLKEPAAARVKSSMGLPSLEATFETLVDAFVFLDKNKDGYVSKNEMVQAI  172

Query  301  NDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  173  NETTTGERSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTCWVGI  216



>gb|KHG00196.1| putative calcium-binding CML21 -like protein [Gossypium arboreum]
Length=220

 Score =   191 bits (486),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 133/178 (75%), Gaps = 5/178 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P     L++ + +FEQFDEDSNGAID EELKKCL KLQ    EEEI++LF++CD++++  
Sbjct  44   PKIDHTLRKCKAIFEQFDEDSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMG  103

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVLLCL+YLL D A    + S++G P +E+TF T+V+AF+ LDKN DG + K +
Sbjct  104  IKFNEFIVLLCLVYLLKDNATEFEAKSRMGVPNLEATFETLVDAFVLLDKNKDGYVSKNE  163

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID--GDDEDH  149
            +V+A N++   E+S   +   RF+EMDWD++G +SF++FLFAF  WVGI+  GDD++H
Sbjct  164  MVQAINESG--ERSSGPIATKRFEEMDWDKNGSVSFKEFLFAFTTWVGIEEVGDDDEH  219



>ref|XP_008782977.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
Length=226

 Score =   191 bits (486),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  +T+FEQFDEDSNGAID EELK C QKL+    EEEI +LF++CD++++  
Sbjct  49   PKIDESLRNCKTIFEQFDEDSNGAIDPEELKHCFQKLEISATEEEISDLFKACDINESMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I F+EFIVLLCL+YLL +  +    S++G P +E+TF T+V+AF+FLDKN DG + K ++
Sbjct  109  INFSEFIVLLCLVYLLKEPAAVQVKSRMGLPSLEATFETLVDAFVFLDKNKDGYVSKNEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  VQAINETTTGERSSGRIAMKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|XP_003628953.1| hypothetical protein MTR_8g070510 [Medicago truncatula]
Length=203

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ R +FEQFDEDSNG ID+EELKKC  KL+    EEE ++LF +CD++D+  
Sbjct  26   PKIDESFRKCRAIFEQFDEDSNGTIDQEELKKCFSKLEISFSEEETNDLFEACDINDDLG  85

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KF+EFIVLLCL+YLL D P++  + S+IG P +E+TF T+V+ F+FLDKN DG + K +
Sbjct  86   MKFSEFIVLLCLVYLLKDDPAALHAKSRIGMPNLEATFETLVDTFVFLDKNKDGYVSKNE  145

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID
Sbjct  146  MVQAINETTSGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGID  195



>gb|EMS55923.1| putative calcium-binding protein CML21 [Triticum urartu]
Length=223

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   EGL++ +T+FEQFDEDSNG ID+EELK C QKL+     EEI +LF +CD++++  
Sbjct  49   PKIDEGLRKCKTIFEQFDEDSNGEIDKEELKHCFQKLEISF-TEEIGDLFEACDINEDMG  107

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +K+NEFIV LCL+YLL D  +S + +K+G   +ESTF T+V+AF+FLDKN DG + K ++
Sbjct  108  MKYNEFIVFLCLVYLLNDPTASEAKTKMGLGDLESTFETLVDAFVFLDKNKDGYVSKDEM  167

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            ++A N++ P E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI G++ED
Sbjct  168  IQAINESIPGERSAGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGI-GENED  220



>gb|AFJ15127.1| putative calcium-binding protein CML21 [Camellia sinensis]
Length=230

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 129/176 (73%), Gaps = 1/176 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDED+NG ID EELK+C  KL+ ++ EEEI++LF +CD+ +N  
Sbjct  49   PKIDESLRKCKAIFEQFDEDANGTIDPEELKRCFLKLEINLPEEEINDLFEACDIYENLG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL + P++  + S++G P +E+TF T+V AF+FLDKN DG + K +
Sbjct  109  MKFNEFIVLLCLVYLLKENPTALHAKSRMGMPSLEATFETLVNAFVFLDKNKDGYVSKSE  168

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            ++ A N+    E+S   +   RF+EMDWDR+G ++F++FLFAF  WVGID  ++D 
Sbjct  169  MIDAINETTTGERSSGRIAMKRFEEMDWDRNGMVNFKEFLFAFTRWVGIDDIEDDE  224



>gb|ACN85246.1| calcium ion binding protein [Oryza officinalis]
Length=224

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ +T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  
Sbjct  49   PKIDESLRKCKTIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCLIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++
Sbjct  109  MKFNEFIVFLCLIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            V++ N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  169  VQSINETATGERSSGRIAMRRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDD  222



>gb|AET03429.2| EF hand calcium-binding family protein [Medicago truncatula]
Length=223

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ R +FEQFDEDSNG ID+EELKKC  KL+    EEE ++LF +CD++D+  
Sbjct  46   PKIDESFRKCRAIFEQFDEDSNGTIDQEELKKCFSKLEISFSEEETNDLFEACDINDDLG  105

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KF+EFIVLLCL+YLL D P++  + S+IG P +E+TF T+V+ F+FLDKN DG + K +
Sbjct  106  MKFSEFIVLLCLVYLLKDDPAALHAKSRIGMPNLEATFETLVDTFVFLDKNKDGYVSKNE  165

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID
Sbjct  166  MVQAINETTSGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGID  215



>gb|ACN85218.1| calcium ion binding protein [Oryza punctata]
Length=224

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ +T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  
Sbjct  49   PKIDESLRKCKTIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCLIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++
Sbjct  109  MKFNEFIVFLCLIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            V++ N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  169  VQSINETATGERSSGRIAMRRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDD  222



>ref|XP_003628952.1| hypothetical protein MTR_8g070510 [Medicago truncatula]
 gb|AET03428.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK43589.1| unknown [Medicago truncatula]
Length=227

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ R +FEQFDEDSNG ID+EELKKC  KL+    EEE ++LF +CD++D+  
Sbjct  50   PKIDESFRKCRAIFEQFDEDSNGTIDQEELKKCFSKLEISFSEEETNDLFEACDINDDLG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KF+EFIVLLCL+YLL D P++  + S+IG P +E+TF T+V+ F+FLDKN DG + K +
Sbjct  110  MKFSEFIVLLCLVYLLKDDPAALHAKSRIGMPNLEATFETLVDTFVFLDKNKDGYVSKNE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID
Sbjct  170  MVQAINETTSGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGID  219



>gb|ACN85259.1| calcium ion binding protein [Oryza alta]
Length=224

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ +T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  
Sbjct  49   PKIDESLRKCKTIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCLIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++
Sbjct  109  MKFNEFIVFLCLIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            V++ N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  169  VQSINETATGERSSGRIAMRRFEEMDWDKNGMVTFKEFLFAFTHWVGIDENEDD  222



>ref|XP_006584629.1| PREDICTED: uncharacterized protein LOC100820628 isoform X1 [Glycine 
max]
 ref|XP_006584630.1| PREDICTED: uncharacterized protein LOC100820628 isoform X2 [Glycine 
max]
 gb|KHN31582.1| Putative calcium-binding protein CML21 [Glycine soja]
Length=229

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++++  
Sbjct  50   PKIDESLRKCKAIFEQFDEDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLC++YLL + P++  + S+IG P +E TF T+V+ F+FLDKN DG + K +
Sbjct  110  MKFNEFIVLLCVVYLLKNDPAALHAKSRIGMPKLEGTFETLVDTFVFLDKNKDGYVSKNE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  170  MVQAINETTSGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGI  218



>ref|XP_010913274.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913275.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913276.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913277.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
 ref|XP_010913278.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
Length=227

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  +T+F+QFDEDSNG ID EELK C  KL+    EEEI +LF +CD+ +N  
Sbjct  49   PKIDESLRNCKTIFDQFDEDSNGMIDPEELKHCFHKLEISCPEEEISDLFEACDIRENMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIVLLCL+YLL +  +  + S +G P +E+TF T+VEAF+ LDKN DG + K ++
Sbjct  109  MKFNEFIVLLCLVYLLKEPAALQAKSGMGLPNLEATFETLVEAFVLLDKNKDGYVSKNEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            V A N+    E+S  H+   RF+EMDWD++G +SF++FLFA + WVGID  +E+
Sbjct  169  VDAINETTAGERSSGHIAMRRFEEMDWDKNGMVSFKEFLFACIRWVGIDDAEEE  222



>ref|XP_006857595.1| hypothetical protein AMTR_s00061p00095500 [Amborella trichopoda]
 gb|ERN19062.1| hypothetical protein AMTR_s00061p00095500 [Amborella trichopoda]
Length=226

 Score =   189 bits (481),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 120/170 (71%), Gaps = 0/170 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+ ++T+FEQFDEDSNG+ID EELK C  KLQ    EEE+ +LF +CD+ + + 
Sbjct  50   PKIDENLRNVKTIFEQFDEDSNGSIDPEELKHCFNKLQISFTEEEVSDLFEACDISETQG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIVLLCL+YLL +     +  K+G P +ESTF  +V AF+FLDKN DG + K ++
Sbjct  110  MKFNEFIVLLCLVYLLKEPAVLPAKLKLGLPQLESTFEKLVNAFVFLDKNKDGYVSKYEM  169

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDG  164
            V+A N+    E+S   +   RF+EMDWD++G +SF++FLFAF  WVGID 
Sbjct  170  VQAINETTSGERSSGRIAMRRFEEMDWDKNGMVSFKEFLFAFTHWVGIDA  219



>ref|XP_010928993.1| PREDICTED: probable calcium-binding protein CML21 [Elaeis guineensis]
Length=226

 Score =   189 bits (481),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  +T+FEQFDEDSNGAID EELK C QKL+    EEEI +LF +CD++++  
Sbjct  49   PKIDESLRNCKTIFEQFDEDSNGAIDPEELKHCFQKLEISAMEEEISDLFMACDINESMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I F+EFIVLLCL+YLL +  +    S++G P +E+TF T+V+AF+FLDKN DG + K ++
Sbjct  109  INFSEFIVLLCLVYLLKEPAALQVKSRMGLPSLEATFETLVDAFVFLDKNKDGYVSKNEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  VQAINETTAGERSSGRIAMKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|XP_002883485.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59744.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=217

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 128/180 (71%), Gaps = 15/180 (8%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  REGL+ IR+VFE +D D NG ID EELKKCL++L+  + EEE+  L+  CDVD ++ 
Sbjct  49   PKLREGLRNIRSVFETYDSDKNGTIDIEELKKCLEELKLCLSEEEVKGLYGWCDVDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS---KIGSPVVESTFNTIVEAFLFLDKNGDGKLHK  323
            I+FNEFIVLLCLIYLL   PSS S +   ++G  +VES F+ IVE FLFLDK+G GKL+K
Sbjct  109  IQFNEFIVLLCLIYLL-SKPSSESNTESKEMGPKLVESIFDPIVEVFLFLDKDGKGKLNK  167

Query  322  KDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMA  143
             D+  +F        + SHVT  RF+EMDW R GK+ FR+FLFAF+ WVG+D D ED+M 
Sbjct  168  ADI--SF--------TSSHVTNMRFEEMDWGRKGKVGFREFLFAFMSWVGLD-DAEDYMT  216



>ref|XP_006656237.1| PREDICTED: probable calcium-binding protein CML21-like [Oryza 
brachyantha]
Length=225

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ +T+FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  
Sbjct  49   PKIDESLRKCKTIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCLIYLL +   S +  K+G   ++ TF T+V+AF+FLDKN DG + K+++
Sbjct  109  MKFNEFIVFLCLIYLLNEPAVSEAKLKMGLGNLQGTFETLVDAFVFLDKNKDGYVSKEEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  169  VQALNETATGERSSGRIAMRRFEEMDWDKNGMVTFKEFLFAFTHWVGIDENEDD  222



>ref|XP_003547815.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Glycine max]
 ref|XP_006599197.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Glycine max]
 ref|XP_006599198.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X3 [Glycine max]
 gb|KHN14062.1| Putative calcium-binding protein CML21 [Glycine soja]
Length=229

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++++  
Sbjct  50   PKIDESLRKCKAIFEQFDEDSNGAIDQEELKKCFSKLEISFTEEEINDLFEACDINEDMV  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KF+EFIVLLC++YLL D P++  + S+IG P +E TF T+V+ F+FLDKN DG + K +
Sbjct  110  MKFSEFIVLLCVVYLLKDDPAALHAKSRIGMPKLERTFETLVDTFVFLDKNKDGYVSKNE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  170  MVQAINETTSGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGI  218



>gb|ACN85272.1| calcium ion binding protein [Oryza alta]
Length=216

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ +T+FEQFDEDSNG ID++ELK C QKL+    EEEI+ELF +CD++++  
Sbjct  49   PKIDESLRKCKTIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINELFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCLIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++
Sbjct  109  MKFNEFIVFLCLIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            V++ N+    E+S   +   RF+EMDWD++G ++F+KFLFAF  WVGI
Sbjct  169  VQSINETVTGERSSGRIAVRRFEEMDWDKNGMVTFKKFLFAFTRWVGI  216



>ref|XP_006370792.1| hypothetical protein POPTR_0001s47510g [Populus trichocarpa]
 gb|ERP67361.1| hypothetical protein POPTR_0001s47510g [Populus trichocarpa]
Length=224

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 131/176 (74%), Gaps = 4/176 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ +  FEQFDEDSNG+ID+EEL+KC  KL+    +EEI++LF +CDV+++  
Sbjct  50   PKIDESFRKCKATFEQFDEDSNGSIDKEELRKCFHKLETAFTDEEINDLFETCDVNEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL D P+   + S+IG P +E+TF T+V AF+FLDKN DG + K +
Sbjct  110  MKFNEFIVLLCLVYLLKDDPAIPQAKSRIGMPDLEATFETLVGAFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            +V+A N++   E+S   +   RF+EMDWDR+G ++F++FLFAF +WVGID D+ED 
Sbjct  170  MVQAINESG--ERSSGRIAMKRFEEMDWDRNGMVNFKEFLFAFTNWVGID-DNEDE  222



>gb|ACN85168.1| calcium ion binding protein [Oryza nivara]
 gb|ACN85185.1| calcium ion binding protein [Oryza rufipogon]
Length=224

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 129/175 (74%), Gaps = 0/175 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  
Sbjct  49   PKIDESLRKCKIIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCLIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++
Sbjct  109  MKFNEFIVFLCLIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            V++ N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D+
Sbjct  169  VQSMNETATGERSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDDN  223



>ref|NP_001058046.1| Os06g0609600 [Oryza sativa Japonica Group]
 dbj|BAD35633.1| calcium-binding EF hand-like protein [Oryza sativa Japonica Group]
 dbj|BAD35476.1| calcium-binding EF hand-like protein [Oryza sativa Japonica Group]
 dbj|BAF19960.1| Os06g0609600 [Oryza sativa Japonica Group]
 gb|EAZ01634.1| hypothetical protein OsI_23671 [Oryza sativa Indica Group]
 gb|EAZ37606.1| hypothetical protein OsJ_21942 [Oryza sativa Japonica Group]
 dbj|BAG93019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 129/175 (74%), Gaps = 0/175 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  
Sbjct  49   PKIDESLRKCKIIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCLIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++
Sbjct  109  MKFNEFIVFLCLIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            V++ N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D+
Sbjct  169  VQSMNETATGERSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDDN  223



>gb|ACN85201.1| calcium ion binding protein [Oryza glaberrima]
Length=224

 Score =   186 bits (473),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  
Sbjct  49   PKIDESLRKCKIIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCLIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++
Sbjct  109  MKFNEFIVFLCLIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            V++ N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  169  VQSMNETATGERSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDD  222



>gb|ACN85332.1| calcium ion binding protein [Oryza granulata]
Length=224

 Score =   186 bits (472),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 127/173 (73%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDEDSNG ID++ELK C QKL+    EEEI++LF +CD++++  
Sbjct  49   PKIDESLRKCKAIFEQFDEDSNGEIDKQELKHCFQKLEISFTEEEINDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCLIYLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K+++
Sbjct  109  MKFNEFIVFLCLIYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKEEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++
Sbjct  169  VQAINETATGERSSGRIAMRRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENED  221



>ref|XP_002438663.1| hypothetical protein SORBIDRAFT_10g023890 [Sorghum bicolor]
 gb|EER90030.1| hypothetical protein SORBIDRAFT_10g023890 [Sorghum bicolor]
Length=224

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 126/174 (72%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ +T+FEQFDEDSNG ID+EELK C QKL+    EEEI +LF +CD++++  
Sbjct  49   PKIDESFRKCKTIFEQFDEDSNGEIDKEELKHCFQKLEISFTEEEISDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K ++
Sbjct  109  MKFNEFIVFLCLVYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKDEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  169  IQAINETTTGERSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDD  222



>ref|XP_010244812.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
 ref|XP_010244813.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
 ref|XP_010244814.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
 ref|XP_010244815.1| PREDICTED: probable calcium-binding protein CML21 [Nelumbo nucifera]
Length=230

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  +  +T+FEQFDEDSNGAID EELK C  KL+    EEEI +LF +CD+ +N  
Sbjct  50   PKIDESFRNCKTIFEQFDEDSNGAIDPEELKHCFHKLEISFTEEEISDLFEACDIHENMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGS-TSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL + P++    SK+G P +E+TF T+V+AF+FLDKN DG + K +
Sbjct  110  MKFNEFIVLLCLVYLLKEDPAALQFKSKMGFPNLEATFETLVDAFVFLDKNRDGYVSKNE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVG+
Sbjct  170  MVQAINETTSGERSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGM  218



>ref|NP_001242483.1| uncharacterized protein LOC100820628 [Glycine max]
 gb|ACU21290.1| unknown [Glycine max]
Length=229

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FE FD DSNGAID+EELKKC  KL+    EEEI++LF +CD++++  
Sbjct  50   PKIDESLRKCKAIFEPFDGDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLC++YLL + P++  + S+IG P +E TF T+V+ F+FLDKN DG + K +
Sbjct  110  MKFNEFIVLLCVVYLLKNDPAALHAKSRIGMPKLEGTFETLVDTFVFLDKNKDGYVSKNE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDG-DDEDH  149
            +V+A N+    E+S   +   RF+EMDWD++G  +F++FLFAF  WVGI+  DDE++
Sbjct  170  MVQAINETTSGERSSGRIAMKRFEEMDWDKNGMANFKEFLFAFTRWVGINEVDDEEN  226



>ref|XP_004965909.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Setaria italica]
 ref|XP_004965910.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Setaria italica]
Length=224

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 125/174 (72%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ +T+FEQFDEDSNG ID+EELK C QKL+    EEEI +LF +CD++++  
Sbjct  49   PRIDESFRKCKTIFEQFDEDSNGEIDKEELKHCFQKLEISFTEEEISDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL +   S +  K+G   +E+TF T+V+AF+FLDKN DG + K ++
Sbjct  109  MKFNEFIVFLCLVYLLNEPAVSEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKDEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            ++A  +    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID +++D
Sbjct  169  IQAITETTTGERSSGRIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGIDENEDD  222



>ref|XP_007156300.1| hypothetical protein PHAVU_003G275000g [Phaseolus vulgaris]
 gb|ESW28294.1| hypothetical protein PHAVU_003G275000g [Phaseolus vulgaris]
Length=228

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDEDSNG I++EELKK   KL+  + EEEI++LF +CD++D+  
Sbjct  52   PKIDESLRKCKAIFEQFDEDSNGTIEKEELKKSFSKLEIPLTEEEINDLFEACDINDDMG  111

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            ++F+EFIVLLCL+YLL D P++  + S++G P +E+TF T+V+ F+FLDKN DG + K +
Sbjct  112  MEFSEFIVLLCLVYLLKDDPAAAHAKSQVGMPNLEATFETLVDTFVFLDKNKDGYVSKNE  171

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVG++ ++
Sbjct  172  MVQAINETTSGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGLEDEE  224



>ref|XP_008449066.1| PREDICTED: probable calcium-binding protein CML21 [Cucumis melo]
Length=224

 Score =   184 bits (466),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 123/176 (70%), Gaps = 1/176 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   + L+  +T+F+QFDED NG IDR ELKKC   L+  + EEEID+LF +CD+     
Sbjct  49   PKIDDSLRNCKTIFQQFDEDLNGIIDRRELKKCFDGLEILLTEEEIDDLFEACDISAAMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVLLCL+YLL D P +  S S+ G P +E TF ++V+AF+FLDKN DG + K +
Sbjct  109  IKFNEFIVLLCLVYLLKDDPDAVFSKSQFGMPKLEETFESLVDAFVFLDKNKDGYVSKSE  168

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            ++ A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID ++E+ 
Sbjct  169  MISAINETTSGERSSGRIAMRRFEEMDWDKNGMVNFKEFLFAFTRWVGIDENEEEE  224



>emb|CDP13649.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   184 bits (466),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +F++FD D NGAID +ELK+C +KL+    +EEI++LF +CD++D+  
Sbjct  49   PKIDENLRKCKAIFQEFDMDGNGAIDPQELKQCFRKLEISFSDEEINDLFEACDINDDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL + P++  + S+IG P +E+TF T+V+AF+FLDKN DG++ K +
Sbjct  109  MKFNEFIVLLCLVYLLKNDPAAEHAKSRIGLPNLEATFETLVDAFVFLDKNKDGQVSKNE  168

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI+
Sbjct  169  MVEAINETTSGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGIE  218



>gb|EEC78513.1| hypothetical protein OsI_18448 [Oryza sativa Indica Group]
 gb|EEE62320.1| hypothetical protein OsJ_17109 [Oryza sativa Japonica Group]
Length=231

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 124/178 (70%), Gaps = 0/178 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGL+ IR VF+Q+DEDSNG ID EEL+ CL KLQ  + EEEID + R CD+D+ + 
Sbjct  51   PRFKEGLRNIRDVFDQYDEDSNGTIDNEELRNCLNKLQVQMSEEEIDNIHRYCDIDNRKG  110

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EF+V LCL+YLL  +  +   S+  S  +   F+ +++AFLF DK+G+GK+ +KDV
Sbjct  111  IQFPEFVVFLCLMYLLFGSDVTYRVSEFESARLNYVFDELIDAFLFFDKDGNGKMKRKDV  170

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDHMAE  140
             +  N+A   E++PSH+T   FKEMD +R+G ++ ++FL + + W G++ DD++   E
Sbjct  171  TQRMNEATHQERTPSHITSQLFKEMDLNRNGHVNLKEFLLSIIRWAGVETDDDEARNE  228



>ref|XP_011039863.1| PREDICTED: probable calcium-binding protein CML21 [Populus euphratica]
 ref|XP_011039864.1| PREDICTED: probable calcium-binding protein CML21 [Populus euphratica]
 ref|XP_011039865.1| PREDICTED: probable calcium-binding protein CML21 [Populus euphratica]
Length=229

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 127/169 (75%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ +  FEQFDEDSNG+ID+EEL+KC  KL+    +EEI++LF +CDV+++  
Sbjct  50   PKIDESFRKCKATFEQFDEDSNGSIDKEELRKCFHKLETAFTDEEINDLFETCDVNEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL D P++  + S+IG P +E+TF T+V AF+FLDKN DG + K +
Sbjct  110  VKFNEFIVLLCLVYLLKDDPATPQAKSRIGMPDLEATFETLVGAFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N++   E+S   +   RF+EMDWD++G ++F++FLFAF +WVGI
Sbjct  170  MVQAINESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTNWVGI  216



>ref|XP_002268527.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Vitis vinifera]
 emb|CBI39804.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + +F+QFDEDSNGAID EELK+C  KL+    EEEI++LF +CD++++  
Sbjct  50   PKIDESLRNCKAIFQQFDEDSNGAIDHEELKRCFLKLEISFSEEEINDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL + P++  + S++G P +E+TF T+V+AF+FLDKN DG + K +
Sbjct  110  MKFNEFIVLLCLVYLLKEDPAALQAKSRMGMPNLEATFETLVDAFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWV  176
            +V A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WV
Sbjct  170  MVHAINETTAGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWV  216



>gb|KDP36321.1| hypothetical protein JCGZ_09536 [Jatropha curcas]
Length=222

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 124/170 (73%), Gaps = 3/170 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDEDSNG IDREEL+KC  KL+    EEEID+LF +CD +++  
Sbjct  49   PKIDESLRKCKDIFEQFDEDSNGIIDREELRKCFHKLELSFTEEEIDDLFLACDFNEDMG  108

Query  493  IKFNEFIVLLCLIYLL-MDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            ++FNEFIVLLCL+YLL  D  +  S S++G P +E+TF T+V AF+FLDKN DG + K +
Sbjct  109  MEFNEFIVLLCLVYLLKYDTAAVHSKSRMGMPNLEATFETLVNAFVFLDKNKDGYVSKNE  168

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            +V+A N++   E+    +   RF+EMDWD++G ++F++FLFAF  WVGID
Sbjct  169  MVQAINESG--ERPSGRIAMKRFEEMDWDKNGTVNFKEFLFAFTRWVGID  216



>emb|CAN71481.1| hypothetical protein VITISV_006244 [Vitis vinifera]
Length=257

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 123/171 (72%), Gaps = 4/171 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + +F+QFDEDSNGAID EELK+C  KL+    EEEI++LF +CD++++  
Sbjct  50   PKIDESLRNCKAIFQQFDEDSNGAIDHEELKRCFLKLEISFSEEEINDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS----GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
            +KFNEFIVLLCL+YLL + P++       S++G P +E+TF T+V+AF+FLDKN DG + 
Sbjct  110  MKFNEFIVLLCLVYLLKEDPTALQAVSKKSRMGMPNLEATFETLVDAFVFLDKNKDGYVS  169

Query  325  KKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVG  173
            K ++V A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVG
Sbjct  170  KSEMVHAINETTAGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVG  220



>ref|XP_007020327.1| Calcium-binding EF-hand family protein [Theobroma cacao]
 gb|EOY11852.1| Calcium-binding EF-hand family protein [Theobroma cacao]
Length=230

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 126/169 (75%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDEDSNGAID EELKKCL KL+    EEEI++LF +CD++++  
Sbjct  50   PKIDENLRKCKAIFEQFDEDSNGAIDHEELKKCLNKLEVSFTEEEINDLFNACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL++L  D A S  + S++G   +E+TF T+V+AF+FLDKN DG + K +
Sbjct  110  MKFNEFIVLLCLVHLFKDNATSLEAKSRMGMQNLEATFETLVDAFVFLDKNKDGYVSKNE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  170  MVQAINESG--ERSSGRIAMKRFEEMDWDKNGSVNFKEFLFAFTRWVGI  216



>ref|XP_002532937.1| Troponin C, skeletal muscle, putative [Ricinus communis]
 gb|EEF29441.1| Troponin C, skeletal muscle, putative [Ricinus communis]
Length=227

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +FEQFDEDSNG ID+EEL+KC  KL+    EEE ++LF +CD++++  
Sbjct  48   PKIDESLRKCKAIFEQFDEDSNGTIDQEELRKCFCKLEISFTEEETNDLFEACDINEDMG  107

Query  493  IKFNEFIVLLCLIYLLM-DAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL  D+ +  + SK+G P +E+TF T+V+ F FLDKN DG + K +
Sbjct  108  MKFNEFIVLLCLVYLLKDDSAAVHAKSKMGMPNLEATFETLVDTFAFLDKNKDGYVSKNE  167

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            +V+A N++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGID
Sbjct  168  MVQAINESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGID  215



>ref|XP_010644632.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Vitis vinifera]
 ref|XP_010644633.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Vitis vinifera]
 ref|XP_010644634.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Vitis vinifera]
Length=235

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 122/170 (72%), Gaps = 4/170 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + +F+QFDEDSNGAID EELK+C  KL+    EEEI++LF +CD++++  
Sbjct  50   PKIDESLRNCKAIFQQFDEDSNGAIDHEELKRCFLKLEISFSEEEINDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS----GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLH  326
            +KFNEFIVLLCL+YLL + P++       S++G P +E+TF T+V+AF+FLDKN DG + 
Sbjct  110  MKFNEFIVLLCLVYLLKEDPAALQAVSKKSRMGMPNLEATFETLVDAFVFLDKNKDGYVS  169

Query  325  KKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWV  176
            K ++V A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WV
Sbjct  170  KSEMVHAINETTAGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWV  219



>ref|NP_001132390.1| uncharacterized protein LOC100193836 [Zea mays]
 gb|ACF81210.1| unknown [Zea mays]
 gb|ACG46514.1| calcium ion binding protein [Zea mays]
 gb|AFW87516.1| calcium ion binding protein [Zea mays]
Length=226

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ +T+FEQFDEDSNG ID+EELK C QKL+    EEEI +LF +CD++++  
Sbjct  49   PKIDESFRKCKTIFEQFDEDSNGEIDKEELKHCFQKLEISFTEEEICDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL +A    +  K+G   +E+TF T+V+AF+FLDKN DG + K ++
Sbjct  109  MKFNEFIVFLCLVYLLNEAAVLEAKIKMGLGNLEATFETLVDAFVFLDKNKDGYVSKDEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  IQAINETTTGERSSGPIAMKRFEEMDWDKNGMVTFKEFLFAFTRWVGI  216



>ref|XP_010676135.1| PREDICTED: probable calcium-binding protein CML21 [Beta vulgaris 
subsp. vulgaris]
Length=230

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 120/169 (71%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +  ++ + +FE+FDED N  ID  ELK C +KL+    EEE+D+ F++CD+++N  
Sbjct  51   PKIDQSFRKCKAIFEEFDEDKNEVIDHNELKHCFRKLEISFTEEEVDDFFKACDINENMG  110

Query  493  IKFNEFIVLLCLIYLLM-DAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL  D P +G  S++G P +E+TF T+V+AF FLDKN DG + K +
Sbjct  111  MKFNEFIVLLCLVYLLQEDQPKTGVKSRMGLPNLEATFETLVDAFAFLDKNKDGYVSKTE  170

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  171  MIQAINETTSGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWVGI  219



>ref|XP_010092394.1| putative calcium-binding protein CML21 [Morus notabilis]
 gb|EXB51070.1| putative calcium-binding protein CML21 [Morus notabilis]
Length=229

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 119/170 (70%), Gaps = 1/170 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + +FE FDEDSNGAID+EE+KKC  KL     EEEI + F +CD++++  
Sbjct  50   PKIDESLRNCKAIFELFDEDSNGAIDQEEMKKCFHKLGISFTEEEISDFFNACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVLLCL+YLL D  ++  T  K+  P  E+TF T+V+AF+FLDKN DG + + +
Sbjct  110  IKFNEFIVLLCLVYLLKDGQTAIHTKLKVVMPNQETTFETLVDAFVFLDKNKDGYVSRSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            +V+A N+    E+S   +   RF+EMDWD++G +S ++FLFAF  WVGID
Sbjct  170  MVEAINETTSGERSSGRIAMKRFEEMDWDKNGMVSVKEFLFAFTRWVGID  219



>ref|XP_004149571.1| PREDICTED: probable calcium-binding protein CML21-like [Cucumis 
sativus]
 ref|XP_004170177.1| PREDICTED: probable calcium-binding protein CML21-like [Cucumis 
sativus]
 gb|KGN56046.1| hypothetical protein Csa_3G061000 [Cucumis sativus]
Length=229

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 119/169 (70%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   + L+  +T+F+QFDED NG IDR ELKKC   L+  + EEEID+LF +CD+     
Sbjct  49   PKIDDSLRNCKTIFQQFDEDLNGIIDRRELKKCFDGLEILLTEEEIDDLFDACDISTAMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL D P++  S S+ G P +E TF ++V+AF+FLDKN DG + K +
Sbjct  109  MKFNEFIVLLCLVYLLKDDPNAVFSKSQFGMPKLEQTFESLVDAFVFLDKNKDGYVSKSE  168

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  MVSAINETTSGERSSGRIAMRRFEEMDWDKNGMVNFKEFLFAFTRWVGI  217



>ref|XP_009346680.1| PREDICTED: probable calcium-binding protein CML21 [Pyrus x bretschneideri]
Length=227

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + +FEQFDEDSNG ID+EE+KKC  KL+    +EEID+LF +CD++++  
Sbjct  50   PKIDESLRNCKAIFEQFDEDSNGMIDQEEMKKCFYKLEVSFTDEEIDDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVL+CL++LL D   +  T  ++G P +E+TF T+V+ F+FLDKN DG + K +
Sbjct  110  IKFNEFIVLICLVHLLKDDNKAVHTKLQLGMPEMEATFETLVDGFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  170  MVEAINETTTGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_008805537.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
 ref|XP_008805538.1| PREDICTED: probable calcium-binding protein CML21 [Phoenix dactylifera]
Length=227

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + +F+QFDEDSNG ID EELK+C  KL+    EEEI +LF +CD+ +N  
Sbjct  49   PKIDESLRNCKAIFDQFDEDSNGMIDPEELKRCFHKLEISCTEEEISDLFEACDIRENMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            ++FNEFIVLLCL+YLL +  +  + S +G P +E+TF T+V+AF+ LDKN DG + K ++
Sbjct  109  MRFNEFIVLLCLVYLLKEPAALQAKSGMGLPNLEATFETLVDAFVLLDKNKDGYVSKNEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            V A N+    E+S   +   RF+EMDWD++G +SF++FLFA   WVGI
Sbjct  169  VDAINETTAGERSSGCIAMNRFEEMDWDKNGMVSFKEFLFACTRWVGI  216



>ref|XP_011097697.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011097698.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011097699.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
Length=229

 Score =   179 bits (454),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ +T FE+FDED NG+I+ +ELK C +KL+    +EEID+LF +CD++++ +
Sbjct  49   PKIDESFRKCKTTFEEFDEDGNGSIEPQELKHCFRKLEIKFTDEEIDDLFEACDINEDMR  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGS-TSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVLLCL+YLL + P++    S+ G P +E+TF T+V+ F+FLDKN DG + + +
Sbjct  109  IKFNEFIVLLCLVYLLKEYPTAEQDKSQRGMPNLEATFETLVDTFVFLDKNRDGYVSRNE  168

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI-DGDDED  152
            +V A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI D DDE+
Sbjct  169  MVHAINETTTGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTHWVGIEDMDDEE  224



>ref|XP_008384627.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
 ref|XP_008384628.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
Length=227

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  +  + +FEQFDEDSNG ID+EE+KKC  KL+    +EEID+LF +CD++++  
Sbjct  50   PKIDESFRNCKAIFEQFDEDSNGMIDQEEMKKCFYKLEVSFTDEEIDDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVL+CL++LL D   +  T  ++G P +E+TF T+V+AF+FLDKN DG + K +
Sbjct  110  IKFNEFIVLICLVHLLKDDNKAVHTKLQLGLPEMEATFETLVDAFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  170  MVEAINETTTGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_011095629.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095630.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095632.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095633.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095634.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095635.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
 ref|XP_011095636.1| PREDICTED: probable calcium-binding protein CML21 [Sesamum indicum]
Length=229

 Score =   178 bits (452),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 125/176 (71%), Gaps = 1/176 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P     L++ +  FE FDED NGAIDREELK C  KL+    +EE+++LF +CD++++  
Sbjct  49   PKIDRSLRKCKATFEDFDEDGNGAIDREELKHCFHKLEISFTDEEVNDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL + P++  + S++G   +E+TF T+V+AF+FLDKN DG + K +
Sbjct  109  MKFNEFIVLLCLVYLLKEDPAAEHAKSRMGMLNLEATFETLVDAFVFLDKNKDGYVSKNE  168

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            +V A N+    E+S   +   RF+EMDWD++G ++F++F+FAF  WVGI+  D+D 
Sbjct  169  MVDAINETTSGERSSGRIAMKRFEEMDWDKNGMVNFKEFVFAFTRWVGIEEGDDDE  224



>ref|XP_008353863.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
 ref|XP_008353869.1| PREDICTED: probable calcium-binding protein CML21 [Malus domestica]
Length=227

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + +FEQFDEDSNG ID+EE+KKC  KL+    +EEI +LF +CD++++  
Sbjct  50   PKIDESLRNCKAIFEQFDEDSNGMIDQEEMKKCFSKLEVSFTDEEIIDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVL+CL++LL D   +  T  ++G P +E+TF T+V+AF+FLDKN DG + K +
Sbjct  110  IKFNEFIVLICLVHLLKDDNKAVHTKLQLGMPELEATFETLVDAFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  170  MVEAINETTTGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_006654041.1| PREDICTED: probable calcium-binding protein CML22-like [Oryza 
brachyantha]
Length=229

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 121/173 (70%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGL  IR VF+Q+DEDSNG ID +EL+ CL +L   + EEE+D + R CD+D+ + 
Sbjct  51   PRFKEGLNNIRDVFDQYDEDSNGTIDNDELRNCLNELHVQLSEEEVDNIHRYCDIDNRKG  110

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EF V LCL+YLL  +  +   S+  S  +   F+ +++A+LF DK+G+GK+++KDV
Sbjct  111  IQFQEFAVFLCLMYLLFGSDVTRRISEFESARLNYVFDELIDAYLFFDKDGNGKMNRKDV  170

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
             +  N+A   E++PSH+T   FKEMD +R+G ++ ++FLF+ + W G++ D+E
Sbjct  171  TERMNEATHQERTPSHITTQLFKEMDLNRNGNVNLKEFLFSIIRWAGVESDEE  223



>ref|XP_006647028.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006647029.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X2 [Oryza brachyantha]
Length=227

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 119/168 (71%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  RT+F+QFDEDSNG ID+EELK C QKL     +EEI +LF++CD+ ++  
Sbjct  49   PKIDESLRNCRTIFQQFDEDSNGEIDQEELKHCFQKLGIAFTDEEIKDLFQACDIYEHMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S +  ++G   +E TF T+V++F+FLDKN DG + K ++
Sbjct  109  MKFNEFIVFLCLVYLLNDPLVSEARKRMGLGNLEPTFETLVDSFVFLDKNKDGYVSKNEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  IQAINETIGGERSSGRIGMKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|XP_010063214.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML21 [Eucalyptus grandis]
Length=235

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +  ++ +++FEQFDEDSN  ID+EEL+ C  KL+    +EEI++LF +CD++D+  
Sbjct  50   PKIDKSFRKCKSIFEQFDEDSNHVIDKEELRHCFNKLEISFSDEEINDLFEACDINDDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVLLCL++LL D P++  + SK+G P +E+TF T+V+AF+FLDKN DG + K +
Sbjct  110  IKFNEFIVLLCLVHLLKDDPTAQLAKSKMGMPDLETTFETLVDAFVFLDKNKDGHVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDR-SGKISFRKFLFAFLDWVGI  170
            +V A N+    E+S   +   RF+EMDWDR +G ++F++FLFAF  WVGI
Sbjct  170  MVDAINETASGERSSGQIAMKRFEEMDWDRKNGMVNFKEFLFAFTRWVGI  219



>ref|NP_001046205.1| Os02g0198200 [Oryza sativa Japonica Group]
 dbj|BAD25460.1| calcium-binding EF hand-like protein [Oryza sativa Japonica Group]
 dbj|BAF08119.1| Os02g0198200 [Oryza sativa Japonica Group]
 dbj|BAG86728.1| unnamed protein product [Oryza sativa Japonica Group]
Length=228

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  R +F+QFDEDSNG ID++ELK C QKL     +EEI +LF++CD+ +N  
Sbjct  49   PKIDESLRNCRIIFQQFDEDSNGEIDQQELKHCFQKLDISFTDEEIKDLFQACDIYENMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S +  ++G   +E TF T+V++F+FLDKN DG + K ++
Sbjct  109  MKFNEFIVFLCLVYLLNDPLVSEARKRMGLGSLEPTFETLVDSFVFLDKNKDGYVSKNEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  IQAINETIGGERSSGRIGMKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>gb|EEC72684.1| hypothetical protein OsI_06250 [Oryza sativa Indica Group]
Length=228

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  R +F+QFDEDSNG ID++ELK C QKL     +EEI +LF++CD+ +N  
Sbjct  49   PKIDESLRNCRIIFQQFDEDSNGEIDQQELKHCFQKLDISFTDEEIKDLFQACDIYENMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S +  ++G   +E TF T+V++F+FLDKN DG + K ++
Sbjct  109  MKFNEFIVFLCLVYLLNDPLVSEARKRMGLGSLEPTFETLVDSFVFLDKNKDGYVSKNEM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  IQAINETIGGERSSGRIGMKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|NP_001148425.1| calcium ion binding protein [Zea mays]
 gb|ACG31429.1| calcium ion binding protein [Zea mays]
Length=225

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 118/169 (70%), Gaps = 0/169 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ RT+F+QFDEDSNG ID+ ELK C Q L     ++EI +LF++CD+ +N  
Sbjct  48   PKIDESLRKCRTIFQQFDEDSNGEIDQLELKHCFQNLGIESTDQEIKDLFQACDIYENMG  107

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S    ++G   +E TF T+VE+F+FLDKN DG + K ++
Sbjct  108  MKFNEFIVFLCLVYLLDDPAVSEVRKRMGLGSLEPTFETLVESFVFLDKNKDGYVSKSEM  167

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI+
Sbjct  168  IQAINETIGGERSSGRIGMKRFEEMDWDKNGTVTFKEFLFAFTHWVGIN  216



>ref|XP_004951561.1| PREDICTED: probable calcium-binding protein CML21-like [Setaria 
italica]
Length=226

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  RT+F+QFDEDSNG ID++ELK C QKL     ++EI +LF +CD+ ++  
Sbjct  48   PKIDESLRNCRTIFQQFDEDSNGEIDQQELKHCFQKLGIESTDDEIKDLFEACDIYEHMG  107

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S +  ++G   +E TF T+VE+F+FLDKN DG + K ++
Sbjct  108  MKFNEFIVFLCLVYLLNDPAVSEARKRMGLGSLEPTFETLVESFVFLDKNKDGYVSKNEM  167

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  168  IQAINETTAGERSSGRIGVKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  215



>gb|AFW66169.1| calcium ion binding protein [Zea mays]
Length=225

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 118/169 (70%), Gaps = 0/169 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ RT+F+QFDEDSNG ID+ ELK C Q L     ++EI +LF++CD+ +N  
Sbjct  48   PKIDESLRKCRTIFQQFDEDSNGEIDQLELKHCFQNLGIESTDQEIKDLFQACDIYENMG  107

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S    ++G   +E TF T+VE+F+FLDKN DG + K ++
Sbjct  108  MKFNEFIVFLCLVYLLDDPAVSEVRKRMGLGSLEPTFETLVESFVFLDKNKDGYVSKSEM  167

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI+
Sbjct  168  IQAINETIGGERSSGRIGMKRFEEMDWDKNGTVTFKEFLFAFTHWVGIN  216



>ref|XP_010327214.1| PREDICTED: probable calcium-binding protein CML21 [Solanum lycopersicum]
Length=230

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  
Sbjct  52   PKIDENLRKCKVIFQEFDEDSNGAIDPQELKHAFNKLEINFTDEEISDLFEACDINEDMG  111

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+F+EFIVLLCL+YLL D PS+  + S++G P +E TF T+V+AF+FLDKN DG + + +
Sbjct  112  IEFSEFIVLLCLVYLLKDDPSALHAKSRMGLPNLEVTFETLVDAFVFLDKNKDGYVSRNE  171

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  172  MVQAINETISGERSSGRIAMRRFEEMDWDKNGMVNFKEFLFAFTHWVGI  220



>ref|XP_002451725.1| hypothetical protein SORBIDRAFT_04g006670 [Sorghum bicolor]
 gb|EES04701.1| hypothetical protein SORBIDRAFT_04g006670 [Sorghum bicolor]
Length=228

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  RT+F+QFDEDSNG ID+ ELK C QKL     +EEI  LF++CD+ ++  
Sbjct  48   PKIDENLRNCRTIFQQFDEDSNGEIDQLELKHCFQKLGIESTDEEIKALFQACDIYEHMG  107

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S +  ++G   +E TF T+VE+F+FLDKN DG + K ++
Sbjct  108  MKFNEFIVFLCLVYLLNDPAVSEARKRMGLGNLEPTFETLVESFVFLDKNKDGYVSKSEM  167

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  168  IQAINETIGGERSSGRIGVKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  215



>ref|XP_008219144.1| PREDICTED: probable calcium-binding protein CML21 [Prunus mume]
 ref|XP_008219151.1| PREDICTED: probable calcium-binding protein CML21 [Prunus mume]
Length=227

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = -2

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
            E L++ + +FEQFDEDSNGAID+EE+KKC  KL+    +EEI +LF +CD++++  IKFN
Sbjct  54   ESLRKCKAIFEQFDEDSNGAIDQEEMKKCFYKLEVSFTDEEISDLFEACDINEDMGIKFN  113

Query  481  EFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKA  305
            EFIVL+CL+YLL D  +   T   +  P +E+TF T+V+AF+FLDKN DG + K ++V+A
Sbjct  114  EFIVLICLVYLLKDDSNDVHTKLHMEMPDLEATFETLVDAFVFLDKNKDGYVSKSEMVQA  173

Query  304  FNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             N+    E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  174  INETTTGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_006352556.1| PREDICTED: probable calcium-binding protein CML21-like [Solanum 
tuberosum]
Length=237

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  
Sbjct  52   PKIDENLRKCKVIFQEFDEDSNGAIDPQELKHAFNKLEINFTDEEISDLFEACDINEDMG  111

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+F+EFIVLLCL+YLL D PS+  + S++G P +E TF T+V+AF+FLDKN DG + + +
Sbjct  112  IEFSEFIVLLCLVYLLKDDPSALHAKSRMGLPNLEVTFETLVDAFVFLDKNKDGYVSRNE  171

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  172  MVQAINETISGERSSGRIAMRRFEEMDWDKNGMVNFKEFLFAFTHWVGI  220



>gb|ABK22178.1| unknown [Picea sitchensis]
 gb|ACN39992.1| unknown [Picea sitchensis]
Length=224

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 127/175 (73%), Gaps = 0/175 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  + +R VF++FD+DS+G ID EELK+C ++LQ    +EEI EL + CD+D+++ 
Sbjct  50   PKIDESFENVRDVFQKFDKDSSGTIDLEELKECFRELQVSFTDEEITELHQICDMDESKG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EFIVLLCL+Y+L +     S S+IG P +E+TF++I++AF F DK+GDG + KK++
Sbjct  110  IEFKEFIVLLCLVYILWEPTDPNSKSRIGLPHLEATFDSIIDAFRFFDKDGDGYVSKKEI  169

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDEDH  149
            ++A N A P  ++   +   RF+EMD+D++G ISF++FLFAF  WVG++ DD+D 
Sbjct  170  LQALNQASPGGRAADQIGIKRFEEMDFDKNGMISFKEFLFAFTHWVGVEVDDDDE  224



>ref|XP_007205832.1| hypothetical protein PRUPE_ppa010999mg [Prunus persica]
 gb|EMJ07031.1| hypothetical protein PRUPE_ppa010999mg [Prunus persica]
Length=227

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = -2

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
            E L++ + +FEQFDEDSNGAID+EE+KKC  KL+    +EEI +LF +CD++++  IKFN
Sbjct  54   ESLRKCKAIFEQFDEDSNGAIDQEEMKKCFYKLEVSFTDEEISDLFEACDINEDMGIKFN  113

Query  481  EFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKA  305
            EFIVL+CL+YLL D  +   T   +  P +E+TF T+V+AF+FLDKN DG + K ++V+A
Sbjct  114  EFIVLICLVYLLKDDSNDVHTKLHMEMPDLEATFETLVDAFVFLDKNKDGYVSKSEMVQA  173

Query  304  FNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             N+    E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  174  INETTTGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_010231716.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
 ref|XP_010231717.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
 ref|XP_010231718.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
Length=230

 Score =   176 bits (447),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 122/173 (71%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F++GL++IR VF+ +D DSNG ID EEL+ C+ KLQ  + E+E+D++ R CDV+  + 
Sbjct  51   PRFKDGLRDIRDVFDHYDVDSNGTIDNEELRSCMSKLQVQMSEKEVDDVHRYCDVNSRKG  110

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EF+VLLCL+YLL     +   S+  S  +   F+ +++AFLF +K+GDGK+ +KDV
Sbjct  111  IQFQEFVVLLCLMYLLFGPGVTRQVSEFESAKLNYVFDELIDAFLFFNKDGDGKMRRKDV  170

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
             +  N+A   E++PSH+T   FKEMD +++G ++ ++FLF+ + W GI+ +DE
Sbjct  171  TQRMNEASHQERTPSHITTQLFKEMDLNKNGSVNLKEFLFSMIRWAGIETEDE  223



>ref|XP_008358900.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML21 [Malus domestica]
Length=227

 Score =   176 bits (447),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  +  + +FEQFDEDSNG ID+EE+KKC  KL+    +EEID+LF +CD++++  
Sbjct  50   PKIDESFRNCKAIFEQFDEDSNGMIDQEEMKKCFYKLEVSFTDEEIDDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVL+CL++LL D   +  T  ++G P +E+TF T+V+AF+FLDKN DG + K +
Sbjct  110  IKFNEFIVLICLVHLLKDDNKAVHTKLQLGLPEMEATFETLVDAFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDW ++G ++F++FLFAF  W+GI
Sbjct  170  MVEAINETTTGERSSGRIAMKRFEEMDWXKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_004294881.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461556.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461557.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461558.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461559.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461561.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461562.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461563.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461564.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461565.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461566.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461567.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461568.1| PREDICTED: probable calcium-binding protein CML21 [Fragaria vesca 
subsp. vesca]
Length=228

 Score =   176 bits (447),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + +F+QFDEDSNGAID +ELK+   KL+    +EEID+LF +CD++++  
Sbjct  50   PKIDESLRNCKDIFQQFDEDSNGAIDHDELKRAFSKLEVSFTDEEIDDLFAACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I FNEFIVL+C+++LL D  ++G     +G P +E+TF T+V+AF+FLDKN DG + K +
Sbjct  110  INFNEFIVLICVVFLLKDDQNAGEKKVDMGMPKLEATFETLVDAFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDWDR+G ++F++FLFAF  W+GI
Sbjct  170  MVQAINETTTGERSSGRIAMKRFEEMDWDRNGMVNFKEFLFAFTRWIGI  218



>ref|XP_003568950.2| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Brachypodium distachyon]
Length=244

 Score =   177 bits (448),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 122/173 (71%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F++GL++IR VF+ +D DSNG ID EEL+ C+ KLQ  + E+E+D++ R CDV+  + 
Sbjct  65   PRFKDGLRDIRDVFDHYDVDSNGTIDNEELRSCMSKLQVQMSEKEVDDVHRYCDVNSRKG  124

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EF+VLLCL+YLL     +   S+  S  +   F+ +++AFLF +K+GDGK+ +KDV
Sbjct  125  IQFQEFVVLLCLMYLLFGPGVTRQVSEFESAKLNYVFDELIDAFLFFNKDGDGKMRRKDV  184

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
             +  N+A   E++PSH+T   FKEMD +++G ++ ++FLF+ + W GI+ +DE
Sbjct  185  TQRMNEASHQERTPSHITTQLFKEMDLNKNGSVNLKEFLFSMIRWAGIETEDE  237



>ref|XP_010233984.1| PREDICTED: probable calcium-binding protein CML21 isoform X2 
[Brachypodium distachyon]
Length=226

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ R +F+QFDEDSNG ID+EELK C QKL     +EEI +LF +CD+ ++  
Sbjct  49   PKIDESLRKCRIIFQQFDEDSNGEIDQEELKHCFQKLDISFTDEEIKDLFEACDIYEHMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S +  ++G   +E TF T+V++F+FLDKN DG + K +V
Sbjct  109  MKFNEFIVFLCLVYLLNDPAVSEARKRMGLGNLEPTFETLVDSFVFLDKNKDGYVSKNEV  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVG+
Sbjct  169  IEAINETTAGERSSGRIGVKRFEEMDWDKNGTVTFKEFLFAFTRWVGL  216



>gb|EYU33744.1| hypothetical protein MIMGU_mgv1a013136mg [Erythranthe guttata]
Length=229

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 121/168 (72%), Gaps = 1/168 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ +T F+++DED NG ID +ELK C +KL+    EEEI++LF++CD++++  
Sbjct  49   PKIDESFRKCKTTFDEYDEDKNGTIDLQELKHCFRKLEISFTEEEINDLFQACDINEDMT  108

Query  493  IKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVL+CL+YLL + PS   + S++G P +++TF T+V+ F+FLDKN DG + K +
Sbjct  109  MKFNEFIVLICLVYLLKEDPSDKDAKSQMGMPNLKATFETLVDTFVFLDKNKDGYVSKSE  168

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVG  173
            +V A N+    E+S   +   RF+EMDWDR+G ++F++FLFAF  WVG
Sbjct  169  MVDAINETTSGERSSGRIAMKRFEEMDWDRNGMVNFKEFLFAFTHWVG  216



>ref|NP_001131792.1| calcium ion binding protein [Zea mays]
 gb|ACF80358.1| unknown [Zea mays]
 gb|ACG38606.1| calcium ion binding protein [Zea mays]
 gb|AFW70731.1| calcium ion binding protein [Zea mays]
Length=227

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  RT+F++FDEDSNG ID+ ELK+C Q L     +EEI +LF +CD+ ++  
Sbjct  48   PKIDESLRNCRTIFQEFDEDSNGEIDQLELKRCFQNLGIESTDEEIKDLFEACDIYEHMG  107

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S +  ++G   +E TF T+VE+F+FLDKN DG + K ++
Sbjct  108  MKFNEFIVFLCLVYLLNDPAVSEARKRMGLGNLEPTFETLVESFVFLDKNKDGYVSKSEM  167

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  168  IQAINETIGGERSSGRIGMRRFEEMDWDKNGTVTFKEFLFAFTRWVGI  215



>gb|EMT21140.1| Putative calcium-binding protein CML21 [Aegilops tauschii]
Length=226

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  R +F+QFDEDSNG ID+ ELK C QKL     +EEI +LF +CD+ ++  
Sbjct  49   PKIDESLRNCRIIFQQFDEDSNGEIDQLELKHCFQKLDISFTDEEIKDLFEACDIYEHMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S +  ++G   +E TF T+V+AF+FLDKN DG + K +V
Sbjct  109  MKFNEFIVFLCLVYLLNDPAVSEARKRMGLGNLEPTFETLVDAFVFLDKNKDGYVSKNEV  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  IEAINETSAGERSSGRIGVKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|XP_003571276.1| PREDICTED: probable calcium-binding protein CML21 isoform X1 
[Brachypodium distachyon]
Length=265

 Score =   176 bits (445),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ R +F+QFDEDSNG ID+EELK C QKL     +EEI +LF +CD+ ++  
Sbjct  88   PKIDESLRKCRIIFQQFDEDSNGEIDQEELKHCFQKLDISFTDEEIKDLFEACDIYEHMG  147

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S +  ++G   +E TF T+V++F+FLDKN DG + K +V
Sbjct  148  MKFNEFIVFLCLVYLLNDPAVSEARKRMGLGNLEPTFETLVDSFVFLDKNKDGYVSKNEV  207

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVG+
Sbjct  208  IEAINETTAGERSSGRIGVKRFEEMDWDKNGTVTFKEFLFAFTRWVGL  255



>ref|XP_009608207.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
tomentosiformis]
 ref|XP_009608208.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
tomentosiformis]
Length=227

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  
Sbjct  49   PKIDENLRKCKVIFQEFDEDSNGAIDPQELKHAFGKLEINFTDEEISDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+F+EFIVLLCL+YLL D P++  + S++G P +E TF T+V+AF+FLDKN DG + + +
Sbjct  109  IEFSEFIVLLCLVYLLKDDPTALHAKSRMGLPNLEVTFETLVDAFVFLDKNKDGHVSRNE  168

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  MIQAINETTSGERSSGRIAMRRFEEMDWDKNGMVNFKEFLFAFTHWVGI  217



>ref|XP_009379121.1| PREDICTED: probable calcium-binding protein CML21 [Pyrus x bretschneideri]
 ref|XP_009379122.1| PREDICTED: probable calcium-binding protein CML21 [Pyrus x bretschneideri]
Length=227

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  + +FEQFDEDSNG ID+EE+KKC  KL+    +EEI +LF +CD++++  
Sbjct  50   PKIDESLRNCKAIFEQFDEDSNGMIDQEEMKKCFSKLEVSFTDEEIIDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVL+CL++LL D   +  T  ++G   +E+TF T+V+AF+FLDKN DG + K +
Sbjct  110  IKFNEFIVLICLVHLLKDDNKAVHTKLQLGMLELEATFETLVDAFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  W+GI
Sbjct  170  MVEAINETTTGERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTRWIGI  218



>ref|XP_004960294.1| PREDICTED: probable calcium-binding protein CML22-like [Setaria 
italica]
Length=262

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 122/173 (71%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F++GL++I+ VF+Q+DE+S+G ID EEL++CL KLQ  + +EE D++ R CD+D    
Sbjct  83   PRFKDGLRDIKDVFDQYDENSDGTIDNEELRRCLGKLQVQMSDEEADDVHRYCDIDRRNG  142

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EF+VLLCL+YLL     +   S+  S  +   F+ +++AFLF DK+GDGK+ +KDV
Sbjct  143  IQFQEFVVLLCLMYLLFGPDVTRRVSEFESAKLNYVFDELIDAFLFFDKDGDGKMKRKDV  202

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
             +  N+    E++PSH+T   FKEMD DR+GK++ ++FL++ + W G + +D+
Sbjct  203  TQRMNEESHQERTPSHITAQLFKEMDIDRNGKVNLKEFLYSIIRWAGHETEDD  255



>ref|XP_002300587.1| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE85392.1| calcium-binding EF hand family protein [Populus trichocarpa]
Length=248

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 131/200 (66%), Gaps = 28/200 (14%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ +  FEQFDEDSNG+ID+EEL+KC  KL+    +EEI++LF +CDV+++  
Sbjct  50   PKIDESFRKCKATFEQFDEDSNGSIDKEELRKCFHKLETAFTDEEINDLFETCDVNEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL D P+   + S+IG P +E+TF T+V AF+FLDKN DG + K +
Sbjct  110  MKFNEFIVLLCLVYLLKDDPAIPQAKSRIGMPDLEATFETLVGAFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRF------------------------KEMDWDRSGKISF  209
            +V+A N++   E+S   +   RF                        +EMDWDR+G ++F
Sbjct  170  MVQAINESG--ERSSGRIAMKRFATRGRYFCLKKLTGTNLGPQFTIAEEMDWDRNGMVNF  227

Query  208  RKFLFAFLDWVGIDGDDEDH  149
            ++FLFAF +WVGID D+ED 
Sbjct  228  KEFLFAFTNWVGID-DNEDE  246



>ref|XP_002447440.1| hypothetical protein SORBIDRAFT_06g001080 [Sorghum bicolor]
 gb|EES11768.1| hypothetical protein SORBIDRAFT_06g001080 [Sorghum bicolor]
Length=230

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 120/173 (69%), Gaps = 0/173 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGL++I+ +F+Q+DEDSNG ID EEL+  L KLQ  + ++EID L   CD+D    
Sbjct  51   PRFKEGLRDIKEIFDQYDEDSNGTIDNEELQSFLSKLQVKMSQQEIDNLHSYCDIDSRNG  110

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EF+VLLCL+YLL     +   S+  S  +   F+ +++AF+F DK+GDGK+ K+DV
Sbjct  111  IQFQEFVVLLCLMYLLFGPDVTRRVSEFESVKLNYVFDELIDAFIFFDKDGDGKMKKRDV  170

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
                N+A   E++PSH+T   FKEMD +R+GK++ ++FL++ + W G++ +D+
Sbjct  171  THRMNEASHQERTPSHITAQLFKEMDLNRNGKVNLKEFLYSMIRWAGLETEDD  223



>ref|XP_009776689.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
sylvestris]
 ref|XP_009776690.1| PREDICTED: probable calcium-binding protein CML21 [Nicotiana 
sylvestris]
Length=227

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 123/169 (73%), Gaps = 1/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L++ + +F++FDEDSNGAID +ELK    KL+ +  +EEI +LF +CD++++  
Sbjct  49   PKIDENLRKCKVIFQEFDEDSNGAIDPQELKHAFGKLEINFTDEEISDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+F+EFIVLLCL+YLL D P++  + S++G P +E  F T+V+AF+FLDKN DG + + +
Sbjct  109  IEFSEFIVLLCLVYLLKDDPTALHAKSRMGLPNLEVAFETLVDAFVFLDKNKDGYVSRNE  168

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  MIQAINETTSGERSSGRIGMRRFEEMDWDKNGMVNFKEFLFAFTHWVGI  217



>dbj|BAK07400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 115/168 (68%), Gaps = 0/168 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L+  R +F+QFDEDSNG ID+ EL+ C QKL     +EEI +LF +CD+ ++  
Sbjct  49   PKIDENLRNCRIIFQQFDEDSNGEIDQLELEHCFQKLDISFTDEEIKDLFEACDIYEHMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIV LCL+YLL D   S +  ++G   +E TF T+V+AF+FLDKN D  + K +V
Sbjct  109  MKFNEFIVFLCLVYLLNDPAVSEARKRMGLGNLEPTFETLVDAFVFLDKNKDEYVSKNEV  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            ++A N+    E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  169  IEAINETSAGERSSGRIGVKRFEEMDWDKNGTVTFKEFLFAFTRWVGI  216



>ref|XP_010545296.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML21 [Tarenaya hassleriana]
Length=230

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 119/173 (69%), Gaps = 7/173 (4%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +GL+  R++F QFDEDSNG ID EELKK  +KL+  + EEEI +LF  CD++D+  
Sbjct  49   PKIDDGLRNCRSIFHQFDEDSNGWIDHEELKKSFEKLEISMTEEEIRDLFEGCDINDDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSS-----GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKL  329
            I F EFIVLLCL+YLL D PS+        S    P +E+TF T+V+ F+FLD+N DG +
Sbjct  109  ITFKEFIVLLCLVYLLKDDPSTVIDSFSYASXPSLPKLEATFETLVDTFVFLDENKDGYV  168

Query  328  HKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             ++++V A +++   E+S   +   RF+EMDWDR+G ++F++FLFAF  WVGI
Sbjct  169  SREEMVHAIDESG--ERSSGRIAMKRFEEMDWDRNGMVNFKEFLFAFTQWVGI  219



>ref|XP_006474771.1| PREDICTED: probable calcium-binding protein CML21-like [Citrus 
sinensis]
Length=229

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 119/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   + L+  + +FE+FDEDSNG ID EELKKC  KL+    EEEI++LF +CD++ +  
Sbjct  50   PKIDDSLRNCKAIFEKFDEDSNGTIDHEELKKCFHKLEIKFTEEEINDLFEACDINKDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL D P++  + S++G P +E+TF T+V+AF+FLDKN DG + + +
Sbjct  110  MKFNEFIVLLCLVYLLKDDPTALRAKSRMGMPKLEATFETLVDAFVFLDKNKDGYVSRSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWV  176
            + +A  ++   E S   +   RF+EMDWD++G ++F++FLFAF  W 
Sbjct  170  MTQAVTESG--EGSTGRIAIKRFEEMDWDKNGMVNFKEFLFAFTRWC  214



>ref|XP_006452756.1| hypothetical protein CICLE_v10009385mg [Citrus clementina]
 gb|ESR65996.1| hypothetical protein CICLE_v10009385mg [Citrus clementina]
 gb|KDO73986.1| hypothetical protein CISIN_1g026998mg [Citrus sinensis]
Length=229

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 119/167 (71%), Gaps = 3/167 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   + L+  + +FE+FDEDSNG ID EELKKC  KL+    EEEI++LF +CD++ +  
Sbjct  50   PKIDDSLRNCKAIFEKFDEDSNGTIDHEELKKCFHKLEIKFTEEEINDLFEACDINKDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL D P++  + S++G P +E+TF T+V+AF+FLDKN DG + + +
Sbjct  110  MKFNEFIVLLCLVYLLKDDPTALRAKSRMGMPKLEATFETLVDAFVFLDKNKDGYVSRSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWV  176
            + +A  ++   E S   +   RF+EMDWD++G ++F++FLFAF  W 
Sbjct  170  MTQAVTESG--EGSTGRIAIKRFEEMDWDKNGMVNFKEFLFAFTRWC  214



>ref|XP_004516273.1| PREDICTED: probable calcium-binding protein CML22-like [Cicer 
arietinum]
Length=216

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 120/172 (70%), Gaps = 4/172 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E LK +R +FEQ+DEDSNG+I+  EL+  L+ LQ H+ E+EI+ +F  CD+D ++ 
Sbjct  49   PMFKERLKTLRGMFEQYDEDSNGSIEPHELEIFLEHLQLHLQEQEIESIFHYCDIDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLI++L +  SS ++ K     +   F+TIVE FLF DKNGDGKL KKD+
Sbjct  109  IQFNEFIVLLCLIHILTEPLSSDNSPKAKLAQLGEVFDTIVEIFLFFDKNGDGKLDKKDM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            V+  N+  P       +T     EMDWD++G+++  +FLF F++W+GID D+
Sbjct  169  VRTMNETHPRFSGYFFIT----GEMDWDKNGQVTLIEFLFGFINWIGIDVDE  216



>ref|XP_002869609.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45868.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 122/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +GL+  + +F++FDEDSNG+ID  ELK C++KL+    EEEI++LF++CD++++  
Sbjct  50   PKIDDGLRNCKAIFQEFDEDSNGSIDHTELKNCIKKLEISFDEEEINDLFKACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+      +G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  110  ITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDENKDGYVSREE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  170  MVRAIDESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  216



>ref|NP_194377.2| putative calcium-binding protein CML21 [Arabidopsis thaliana]
 sp|Q52K82.1|CML21_ARATH RecName: Full=Probable calcium-binding protein CML21; AltName: 
Full=Calmodulin-like protein 21 [Arabidopsis thaliana]
 gb|AAY17423.1| At4g26470 [Arabidopsis thaliana]
 gb|AEE85204.1| putative calcium-binding protein CML21 [Arabidopsis thaliana]
Length=231

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 122/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +GL+  + +F++FDEDSNG+ID  ELK C++KL+    EEEI++LF++CD++++  
Sbjct  50   PKIDDGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFDEEEINDLFKACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+      +G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  110  ITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDENKDGYVSREE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  170  MVRAIDESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  216



>ref|XP_006285834.1| hypothetical protein CARUB_v10007314mg [Capsella rubella]
 gb|EOA18732.1| hypothetical protein CARUB_v10007314mg [Capsella rubella]
Length=233

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 122/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   EGL+  + +F++FDEDSNG+ID  ELK C++KL+    E+EI++LF++CD++++  
Sbjct  50   PKIDEGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFEEDEINDLFKACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+      +G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  110  ITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDENKDGYVCREE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  170  MVRAIDESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  216



>ref|NP_001148758.1| calcium ion binding protein [Zea mays]
 gb|ACG32796.1| calcium ion binding protein [Zea mays]
Length=230

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 120/174 (69%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGL++++ +F+Q+DEDS+G ID EEL+    +++ H+ EEE+  L R CD+D  + 
Sbjct  51   PRFKEGLRDVKNIFDQYDEDSDGTIDSEELQSFGSRVRVHMSEEEMSNLHRYCDIDSRKG  110

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            ++F EF+VLLCL YLL     +   S+  S  +   F+ +++A++F DK+GDG L ++DV
Sbjct  111  VQFQEFVVLLCLAYLLFGPDVTRRVSEFESGKLNYVFDELIDAYIFFDKDGDGMLRRRDV  170

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
             +  N+A   E++PSH+T   FKEMD +R+GK++ ++FL++ + W G+  +D+D
Sbjct  171  TRRMNEASHQERTPSHITAQLFKEMDLNRNGKVNLKEFLYSMIRWAGLGTEDDD  224



>ref|XP_006413177.1| hypothetical protein EUTSA_v10026168mg [Eutrema salsugineum]
 gb|ESQ54630.1| hypothetical protein EUTSA_v10026168mg [Eutrema salsugineum]
Length=226

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 121/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +GL+  + +F++FDEDSNG+ID  ELK C +KL+    EEEI++LF +CD++++  
Sbjct  50   PKIDDGLRNCKAIFQEFDEDSNGSIDHTELKNCFRKLEISFDEEEINDLFEACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+     ++G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  110  ITFTEFIVLLCLVYLLKDDSSTLQKKWRLGMPKLEPTFETLVDTFVFLDENKDGYVSREE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  170  MVRAIDESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  216



>ref|XP_009142368.1| PREDICTED: probable calcium-binding protein CML21 [Brassica rapa]
 emb|CDY66743.1| BnaAnng22830D [Brassica napus]
Length=225

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 121/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   EGL+  + +F++FDEDSNG+ID  ELK C +KL+    E+EI++LF +CD++++  
Sbjct  44   PKIDEGLRNCKAIFQEFDEDSNGSIDHTELKNCFRKLEISFEEDEINDLFEACDINEDMG  103

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+     ++G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  104  ITFTEFIVLLCLVYLLKDDSSTLQKKWRLGMPKLEPTFETLVDTFVFLDENKDGLVSREE  163

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  164  MVRAIDESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  210



>gb|KJB63079.1| hypothetical protein B456_009G454500 [Gossypium raimondii]
Length=220

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 133/178 (75%), Gaps = 5/178 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P     L++ + +FEQFDEDSNGAID EELKKCL KLQ    EEEI++LF++CD++++  
Sbjct  44   PKIDHTLRKCKAIFEQFDEDSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMG  103

Query  493  IKFNEFIVLLCLIYLLMD-APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEF+VLLCL+YLL D A    + S++G P +E+TF T+V+AF+ LDKN DG + K +
Sbjct  104  IKFNEFVVLLCLVYLLKDNATEFEAKSRMGVPNLEATFETLVDAFVLLDKNKDGYVSKTE  163

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID--GDDEDH  149
            +V+A N++   E+S   +   RF+EMDWD++G +SF++FLFAF  W+GI+  GD+++H
Sbjct  164  MVQAINESG--ERSSGPIATKRFEEMDWDKNGSVSFKEFLFAFTTWIGIEEVGDNDEH  219



>tpg|DAA38718.1| TPA: calcium ion binding protein [Zea mays]
Length=230

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 119/177 (67%), Gaps = 4/177 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGL++++ +F+Q+DEDS+G ID EEL+    +++ H+ EEE+  L R CD+D  + 
Sbjct  51   PRFKEGLRDVKNIFDQYDEDSDGTIDSEELQSFGSRVRVHMSEEEMSNLHRYCDIDSRKG  110

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            ++F EF+VLLCL YLL     +   S+  S  +   F+ +++A++F DK+GDG L ++DV
Sbjct  111  VQFQEFVVLLCLAYLLFGPDVTRRVSEFESGKLNYVFDELIDAYIFFDKDGDGMLRRRDV  170

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI----DGDDE  155
                N+A   E++PSH+T   FKEMD +R+GK++ ++FL++ + W G+    DG DE
Sbjct  171  THRMNEASHQERTPSHITAQLFKEMDLNRNGKVNLKEFLYSMIRWAGLGTEDDGSDE  227



>ref|XP_010438747.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
 ref|XP_010438748.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
Length=233

 Score =   164 bits (414),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 119/169 (70%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P    GL+  + +F++FDEDSNG+ID  ELK C++KL+    E+EI++LF++CD++++  
Sbjct  50   PKIDVGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFEEDEINDLFKACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+      +G P +E TF T+V+ F+FLD N DG + + +
Sbjct  110  ITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDDNKDGYVSRDE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  170  MVRAIDESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  216



>ref|XP_010448264.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
 ref|XP_010448265.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
Length=232

 Score =   164 bits (414),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 119/169 (70%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P    GL+  + +F++FDEDSNG+ID  ELK C++KL+    E+EI++LF++CD++++  
Sbjct  50   PKIDVGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFEEDEINDLFKACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+      +G P +E TF T+V+ F+FLD N DG + + +
Sbjct  110  ITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDDNKDGYVSRDE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  170  MVRAIDESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  216



>ref|XP_010433497.1| PREDICTED: probable calcium-binding protein CML21 [Camelina sativa]
Length=231

 Score =   163 bits (413),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 119/169 (70%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P    GL+  + +F++FDEDSNG+ID  ELK C++KL+    E+EI++LF++CD++++  
Sbjct  50   PKIDVGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFEEDEINDLFKACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+      +G P +E TF T+V+ F+FLD N DG + + +
Sbjct  110  ITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDDNKDGYVSRDE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  170  MVRAIDESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  216



>ref|XP_001784911.1| predicted protein [Physcomitrella patens]
 gb|EDQ50300.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 116/174 (67%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P      + +R VF + D++ +G++D EELK+CLQ+LQ    ++EI+E     D+D +  
Sbjct  46   PKIDASFEAVREVFNKADKNGDGSLDMEELKQCLQELQVEYSDQEIEEFHHESDMDASHG  105

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EFIV+L LIYLL     +G  S IG P +E+TF+ I EAF+F D+N DG + KK++
Sbjct  106  IQFKEFIVVLALIYLLGRPTHTGVESAIGLPDLEATFDEIAEAFVFFDRNKDGYVSKKEM  165

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            + A N+A P  +    +   RF+EMDWD+ G I+F++FLFAF DWVG++ D+E+
Sbjct  166  IWAINEASPSGRHGHRIGVQRFEEMDWDKDGMITFKEFLFAFTDWVGLENDEEE  219



>gb|EMS52340.1| putative calcium-binding protein CML22 [Triticum urartu]
Length=321

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 120/174 (69%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F++GLK+IR VF  +D DSNG ID EEL+ CL KL+  + E+E D++ R CDVD  + 
Sbjct  141  PRFKDGLKDIRDVFALYDTDSNGTIDNEELRSCLSKLEVRMSEKEADDVHRYCDVDSRKG  200

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EF+VL+CL+YLL     +   S+  S  +   F+ +++AFLF +++GDGK+ +KDV
Sbjct  201  IQFQEFVVLICLMYLLFGPNVTRRVSEFESDKLNYIFDELIDAFLFFNRDGDGKVTRKDV  260

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
             +  N+    E++P+H+T   FKEMD +++GK++ ++FLF+ + W G++ ++ D
Sbjct  261  TQRMNEESDRERTPTHITTQLFKEMDLNKNGKVNLKEFLFSMIRWAGLEPEEGD  314



>ref|XP_010691273.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=250

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  +E +K++R VFE +DED +G+IDREELK+C ++LQ ++  EE D+LF SCDVD N +
Sbjct  82   PQLKEQVKKLRGVFEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDDLFESCDVDRNGR  141

Query  493  IKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+F EFIVLLCLIYL+    S + + S+  SP  E+TF+ IV+ F+++DKNGDGKL KKD
Sbjct  142  IQFREFIVLLCLIYLITKPSSPTDAVSRTESPNWEATFDIIVQVFIYMDKNGDGKLSKKD  201

Query  316  VVKAFNDAFPLEKSPSHVTRTRF  248
            +V A  +  P E+SPSHV +TRF
Sbjct  202  MVAALTEP-PWERSPSHVMKTRF  223



>ref|XP_001775820.1| predicted protein [Physcomitrella patens]
 gb|EDQ59359.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 115/174 (66%), Gaps = 0/174 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P      + +R VF + D++ +G++D +ELK+CLQ+LQ    ++EI+E     D+D    
Sbjct  46   PKIDASFEAVREVFNKADKNGDGSLDMDELKQCLQELQVEYSDQEIEEFHHESDMDSTHG  105

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+F EFIV+L LIYLL     +G  S IG P +E+TF+ I EAF+F D+N DG + KK++
Sbjct  106  IQFKEFIVVLALIYLLGRPTHTGVKSAIGLPDLEATFDEIAEAFVFFDRNKDGYVSKKEM  165

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            + A N+A P  +    +   RF+EMDWD+ G I+F++FLFAF DWVG++ D+E+
Sbjct  166  IWAINEASPSGRHGHRIGVQRFEEMDWDKDGMITFKEFLFAFTDWVGLENDEEE  219



>ref|XP_010691274.1| PREDICTED: probable calcium-binding protein CML22 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=247

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  +E +K++R VFE +DED +G+IDREELK+C ++LQ ++  EE D+LF SCDVD N +
Sbjct  82   PQLKEQVKKLRGVFEHYDEDGDGSIDREELKQCFKELQVNLTVEEFDDLFESCDVDRNGR  141

Query  493  IKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I+F EFIVLLCLIYL+    S + + S+  SP  E+TF+ IV+ F+++DKNGDGKL KKD
Sbjct  142  IQFREFIVLLCLIYLITKPSSPTDAVSRTESPNWEATFDIIVQVFIYMDKNGDGKLSKKD  201

Query  316  VVKAFNDAFPLEKSPSHVTRTRF  248
            +V A  +  P E+SPSHV +TRF
Sbjct  202  MVAALTEP-PWERSPSHVMKTRF  223



>gb|KDO73987.1| hypothetical protein CISIN_1g026998mg [Citrus sinensis]
Length=221

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 113/166 (68%), Gaps = 9/166 (5%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   + L+  + +FE+FDEDSNG ID EELKKC  KL+    EEEI++LF +CD++ +  
Sbjct  50   PKIDDSLRNCKAIFEKFDEDSNGTIDHEELKKCFHKLEIKFTEEEINDLFEACDINKDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            +KFNEFIVLLCL+YLL D P++          +E+TF T+V+AF+FLDKN DG + + ++
Sbjct  110  MKFNEFIVLLCLVYLLKDDPTA-------LRALEATFETLVDAFVFLDKNKDGYVSRSEM  162

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWV  176
             +A  ++   E S   +   RF+EMDWD++G ++F++FLFAF  W 
Sbjct  163  TQAVTESG--EGSTGRIAIKRFEEMDWDKNGMVNFKEFLFAFTRWC  206



>gb|KCW70421.1| hypothetical protein EUGRSUZ_F03649 [Eucalyptus grandis]
Length=223

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 108/150 (72%), Gaps = 1/150 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +  ++ +++FEQFDEDSN  ID+EEL+ C  KL+    +EEI++LF +CD++D+  
Sbjct  50   PKIDKSFRKCKSIFEQFDEDSNHVIDKEELRHCFNKLEISFSDEEINDLFEACDINDDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSG-STSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            IKFNEFIVLLCL++LL D P++  + SK+G P +E+TF T+V+AF+FLDKN DG + K +
Sbjct  110  IKFNEFIVLLCLVHLLKDDPTAQLAKSKMGMPDLETTFETLVDAFVFLDKNKDGHVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDR  227
            +V A N+    E+S   +   RF+EMDWD+
Sbjct  170  MVDAINETASGERSSGQIAMKRFEEMDWDK  199



>ref|XP_004509620.1| PREDICTED: probable calcium-binding protein CML21-like isoform 
X1 [Cicer arietinum]
Length=233

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ R +FEQFDEDSNGAID+EELKKC  KL+    EEEI++LF +CD++D+  
Sbjct  50   PKIDESFRKCRAIFEQFDEDSNGAIDQEELKKCFSKLEISFSEEEINDLFEACDINDDLG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS-GSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +KFNEFIVLLCL+YLL D P++  + S+IG P +E+TF T+V+ F+FLDKN DG + K +
Sbjct  110  MKFNEFIVLLCLVYLLKDDPAALHAKSRIGMPNLEATFETLVDTFVFLDKNKDGYVSKSE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRS  224
            +V+A N+    E+S   +   RF ++   R+
Sbjct  170  MVQAINETTSGERSSGRIAMKRFGQLSLLRT  200



>emb|CAA18223.1| putative protein [Arabidopsis thaliana]
 emb|CAB79502.1| putative protein [Arabidopsis thaliana]
Length=248

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 122/186 (66%), Gaps = 20/186 (11%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +GL+  + +F++FDEDSNG+ID  ELK C++KL+    EEEI++LF++CD++++  
Sbjct  50   PKIDDGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFDEEEINDLFKACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+      +G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  110  ITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDENKDGYVSREE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRF-----------------KEMDWDRSGKISFRKFLFAF  188
            +V+A +++   E+S   +   RF                 +EMDWD++G ++F++FLFAF
Sbjct  170  MVRAIDESG--ERSSGRIAMKRFAFFFTEPRILILIPVSAEEMDWDKNGMVNFKEFLFAF  227

Query  187  LDWVGI  170
              WVGI
Sbjct  228  TQWVGI  233



>emb|CDX92818.1| BnaC07g40760D [Brassica napus]
Length=228

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 121/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   EGL+  + +F++FDEDSNG+ID  ELK C +KL+    EEEI++LF++CD++++  
Sbjct  48   PKIDEGLRNCKAIFQEFDEDSNGSIDHSELKNCFRKLEILFEEEEINDLFQACDINEDMG  107

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+     ++G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  108  ITFTEFIVLLCLVYLLKDDSSTLQKKWRLGMPKLEPTFETLVDTFVFLDENKDGHVSREE  167

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            + +A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  168  MFRAIDESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  214



>ref|XP_009137599.1| PREDICTED: probable calcium-binding protein CML21 [Brassica rapa]
Length=228

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 122/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   EGL+  + +F++FDEDSNG+ID  ELK C +KL+    EEEI++LF++CD++++ +
Sbjct  48   PKIDEGLRNCKAIFQEFDEDSNGSIDHSELKNCFRKLEILFEEEEINDLFQACDINEDME  107

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+     ++G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  108  IAFTEFIVLLCLVYLLKDDSSTLQKKWRLGMPKLEPTFETLVDTFVFLDENKDGHVSREE  167

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            + +A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  168  MFRAIDESG--ERSSGRIALKRFEEMDWDKNGMVNFKEFLFAFTLWVGI  214



>emb|CDY42732.1| BnaA03g48070D [Brassica napus]
Length=228

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 121/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   EGL+  + +F++FDEDSNG+ID  ELK C +KL+    EEEI++LF++CD++++ +
Sbjct  48   PKIDEGLRNCKAIFQEFDEDSNGSIDHSELKNCFRKLEILFEEEEINDLFQACDINEDME  107

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+     ++G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  108  IAFTEFIVLLCLVYLLKDDSSTLQKKWRLGMPKLEPTFETLVDTFVFLDENKDGHVSREE  167

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            + +A +++   E+S   +   RF+EMDWD +G ++F++FLFAF  WVGI
Sbjct  168  MFRAIDESG--ERSSGRIAMKRFEEMDWDNNGMVNFKEFLFAFTLWVGI  214



>gb|AFK48479.1| unknown [Medicago truncatula]
Length=129

 Score =   147 bits (371),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  529  LFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLD  350
             F+ CD+D ++ I+FNEFIVLLCLI++L +  SS ++ K     +   F+ I+E FLF D
Sbjct  6    FFQYCDIDGSKGIQFNEFIVLLCLIHILTEPLSSDNSPKEELAQLGQVFDKIIEIFLFFD  65

Query  349  KNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +NGDGKL+KKD+V+  N+  P E+SP+HVT+ RF+EMDWD++G+++FR+FLF F++WVGI
Sbjct  66   QNGDGKLNKKDMVRTMNETNPRERSPAHVTKNRFREMDWDKNGQVTFREFLFGFINWVGI  125

Query  169  DGDD  158
            D D+
Sbjct  126  DVDE  129



>gb|KEH22472.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=201

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 106/150 (71%), Gaps = 0/150 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E LK +R +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ 
Sbjct  49   PMFKERLKTLRGMFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLI++L +  SS ++ K     +   F+ I+E FLF D+NGDGKL+KKD+
Sbjct  109  IQFNEFIVLLCLIHILTEPLSSDNSPKEELAQLGQVFDKIIEIFLFFDQNGDGKLNKKDM  168

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRS  224
            V+  N+  P E+SP+HVT+ RF  + ++ S
Sbjct  169  VRTMNETNPRERSPAHVTKNRFSIVHFNSS  198



>gb|KEH22471.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=219

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 106/150 (71%), Gaps = 0/150 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+E LK +R +FEQ+DEDSN +I+  EL+  L+ LQ H+ E EI+  F+ CD+D ++ 
Sbjct  67   PMFKERLKTLRGMFEQYDEDSNESIEPHELQTFLEDLQLHLPENEIENFFQYCDIDGSKG  126

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I+FNEFIVLLCLI++L +  SS ++ K     +   F+ I+E FLF D+NGDGKL+KKD+
Sbjct  127  IQFNEFIVLLCLIHILTEPLSSDNSPKEELAQLGQVFDKIIEIFLFFDQNGDGKLNKKDM  186

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRS  224
            V+  N+  P E+SP+HVT+ RF  + ++ S
Sbjct  187  VRTMNETNPRERSPAHVTKNRFSIVHFNSS  216



>ref|XP_010421964.1| PREDICTED: probable calcium-binding protein CML22, partial [Camelina 
sativa]
Length=175

 Score =   145 bits (367),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 4/128 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  REGL+ IR VFE +D DSNG ID EELKKCL++LQ  + +EE+  L+  CDVD ++ 
Sbjct  49   PKLREGLRNIRNVFESYDNDSNGTIDIEELKKCLEELQLSLSDEEVKGLYGWCDVDGSKG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS---KIGSPVVESTFNTIVEAFLFLDKNGDGKLHK  323
            I+FNEFIVLLCLIYLL   PSS S +   ++G  +VES F+ IVE FLFLDK+G GKL+K
Sbjct  109  IQFNEFIVLLCLIYLL-SKPSSESNAESREMGPKLVESIFDPIVEVFLFLDKDGKGKLNK  167

Query  322  KDVVKAFN  299
             DV+K  N
Sbjct  168  ADVIKTLN  175



>ref|XP_008667961.1| PREDICTED: calcium ion binding protein isoform X1 [Zea mays]
Length=260

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 119/207 (57%), Gaps = 34/207 (16%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F+EGL++++ +F+Q+DEDS+G ID EEL+    +++ H+ EEE+  L R CD+D  + 
Sbjct  51   PRFKEGLRDVKNIFDQYDEDSDGTIDSEELQSFGSRVRVHMSEEEMSNLHRYCDIDSRKG  110

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            ++F EF+VLLCL YLL     +   S+  S  +   F+ +++A++F DK+GDG L ++DV
Sbjct  111  VQFQEFVVLLCLAYLLFGPDVTRRVSEFESGKLNYVFDELIDAYIFFDKDGDGMLRRRDV  170

Query  313  VKAFNDAFPLEKSPSHVTRTRF------------------------------KEMDWDRS  224
                N+A   E++PSH+T   F                              +EMD +R+
Sbjct  171  THRMNEASHQERTPSHITAQLFSTRSSCLLLFSPVAVLSKLMCVCVSVSVSAEEMDLNRN  230

Query  223  GKISFRKFLFAFLDWVGI----DGDDE  155
            GK++ ++FL++ + W G+    DG DE
Sbjct  231  GKVNLKEFLYSMIRWAGLGTEDDGSDE  257



>ref|XP_002990940.1| hypothetical protein SELMODRAFT_132549 [Selaginella moellendorffii]
 gb|EFJ07984.1| hypothetical protein SELMODRAFT_132549 [Selaginella moellendorffii]
Length=226

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 111/169 (66%), Gaps = 2/169 (1%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +  +++R VF++FD+D +G ID EELK C ++LQ    + E+       D+D ++ 
Sbjct  47   PKIDKSFEQVRGVFKKFDKDDSGTIDLEELKTCFRELQVEFTDTEVKAFHEESDMDKSKG  106

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            + F EFI++L L+YLL +  +    S+IG   +ESTF TIV+ F F DK+GDG + +K++
Sbjct  107  VDFKEFIIVLALVYLLGETGAK-PKSRIGLAELESTFETIVDTFRFFDKDGDGYVSRKEM  165

Query  313  VKAFNDAFPLEKSPSH-VTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            + A N+A P + S    +   RF+EMDWD++G I+F++FLFAF DWVGI
Sbjct  166  ITAINEASPGQSSSGESIGVKRFEEMDWDKNGMITFKEFLFAFTDWVGI  214



>ref|XP_006840146.1| hypothetical protein AMTR_s00089p00059230 [Amborella trichopoda]
 gb|ERN01821.1| hypothetical protein AMTR_s00089p00059230 [Amborella trichopoda]
Length=225

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 112/174 (64%), Gaps = 5/174 (3%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   EGLKE+  +F+QFD+DSNG I+ EEL++    LQ    ++ +  L+ +C++D ++ 
Sbjct  52   PKLIEGLKELHIIFDQFDKDSNGTINWEELRQIFSYLQLKFSDQTLANLYDACEMDGHKG  111

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I F + ++LL   +LL D P       +  P +E TFNT+++AF+FLDKNGDG +++K++
Sbjct  112  INFAKLVLLLGWFHLLEDHPYESHAGDL--PHIEGTFNTLIDAFVFLDKNGDGYINRKEM  169

Query  313  VKAFNDAFPLEKSP---SHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            V+A  +A   EKS      +   RFKEMD D++G ISF++FL AF  W+ I+ D
Sbjct  170  VQAIKEAPSKEKSSKDTKDIAMNRFKEMDCDKNGHISFKEFLLAFTRWIEINDD  223



>emb|CDX94327.1| BnaC01g18570D [Brassica napus]
Length=225

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 121/169 (72%), Gaps = 3/169 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   EGL+  + +F++FDEDSNG+ID  ELK C +KL+    E+EI++LF +CD++++  
Sbjct  44   PKIDEGLRNCKAIFQEFDEDSNGSIDHTELKNCFRKLEISFEEDEINDLFEACDINEDMG  103

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EF+VLLCL+YLL D  S+     ++G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  104  ITFTEFVVLLCLVYLLKDDSSTLQKKWRLGMPKLEPTFETLVDTFVFLDENKDGLVSREE  163

Query  316  VVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            +V+A +++   E+S   +   RF+EMDWD++G ++F++FLFAF  WVGI
Sbjct  164  MVRAIDESG--ERSSGRIAMKRFEEMDWDKNGMVNFKEFLFAFTQWVGI  210



>ref|XP_002982786.1| hypothetical protein SELMODRAFT_422194 [Selaginella moellendorffii]
 gb|EFJ16031.1| hypothetical protein SELMODRAFT_422194 [Selaginella moellendorffii]
Length=243

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 113/185 (61%), Gaps = 17/185 (9%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +  +++R VF++FD+D +G ID EELK C ++LQ    + E+       D+D ++ 
Sbjct  47   PKIDKSFEQVRGVFKKFDKDDSGTIDLEELKTCFRELQVEFTDTEVKAFHEESDMDKSKG  106

Query  493  IKFNEFIVLLCLIYLLMDAPS-----------SGST-----SKIGSPVVESTFNTIVEAF  362
            + F EFI++L L+YLL +  +            GS      S+IG   +ESTF TIV+ F
Sbjct  107  VDFKEFIIVLALVYLLGETGAKPVKQKEEDKGKGSQLKNLKSRIGLAELESTFETIVDTF  166

Query  361  LFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSH-VTRTRFKEMDWDRSGKISFRKFLFAFL  185
             F DK+GDG + +K+++ A N+A P + S    +   RF+EMDWD++G I+F++FLFAF 
Sbjct  167  RFFDKDGDGYVSRKEMITAINEASPGQSSSGESIGVKRFEEMDWDKNGMITFKEFLFAFT  226

Query  184  DWVGI  170
            DWVGI
Sbjct  227  DWVGI  231



>ref|XP_002990719.1| hypothetical protein SELMODRAFT_429138 [Selaginella moellendorffii]
 gb|EFJ08168.1| hypothetical protein SELMODRAFT_429138 [Selaginella moellendorffii]
Length=233

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 113/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  649  EIRTVFEQF---------DEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNE  497
            ++R VF++F         D+   G ID E+LK C ++L+    EEE+   +   DVD N 
Sbjct  56   QVRDVFKRFASAGWILVADKHKRGTIDLEQLKACFRELKVEFTEEEVQMFYEEGDVDHNR  115

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +I F EFIV+L L YLL +  +S   S+IG P +E +F TI +AF+F DKNGDG + K++
Sbjct  116  RISFKEFIVVLALAYLLGEPLNSDGKSRIGLPDLEWSFETIEDAFVFFDKNGDGYVTKEE  175

Query  316  VVKAFNDAFPLEKSPSHVTRT--------RFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            ++++ +++       SH T T        RF+EMDWDR G+++F++FL AF  WVGI+ D
Sbjct  176  MIESIHES-------SHATNTQQDSIGVERFEEMDWDRDGRVTFKEFLLAFTGWVGIE-D  227

Query  160  DEDH  149
            DED 
Sbjct  228  DEDQ  231



>ref|XP_002986712.1| hypothetical protein SELMODRAFT_425580 [Selaginella moellendorffii]
 gb|EFJ12275.1| hypothetical protein SELMODRAFT_425580 [Selaginella moellendorffii]
Length=233

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 113/184 (61%), Gaps = 25/184 (14%)
 Frame = -2

Query  649  EIRTVFEQF---------DEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNE  497
            ++R VF++F         D+   G ID E+LK C ++L+    EEE+   +   DVD N 
Sbjct  56   QVRDVFKRFASVGWILVADKHKRGTIDLEQLKACFRELKVEFTEEEVQIFYEEGDVDHNR  115

Query  496  KIKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            +I F EFIV+L L YLL +  +S   S+IG P +E +F TI +AF+F DKNGDG + K++
Sbjct  116  RISFKEFIVVLALAYLLGEPLNSDGKSRIGLPDLEWSFETIEDAFVFFDKNGDGYVTKEE  175

Query  316  VVKAFNDAFPLEKSPSHVTRT--------RFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
            ++++ +++       SH T T        RF+EMDWDR G+++F++FL AF  WVGI+ D
Sbjct  176  MIESIHES-------SHATNTQQDSIGVERFEEMDWDRDGRVTFKEFLLAFTGWVGIE-D  227

Query  160  DEDH  149
            DED 
Sbjct  228  DEDQ  231



>ref|XP_002323775.2| hypothetical protein POPTR_0017s08200g [Populus trichocarpa]
 gb|EEF03908.2| hypothetical protein POPTR_0017s08200g [Populus trichocarpa]
Length=136

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 103/174 (59%), Gaps = 47/174 (27%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P F E LK IR VFEQ+DED NG+ID EELKKCLQKL   + +EE+++LF SCD+D++  
Sbjct  9    PQFNEELKHIRGVFEQYDEDVNGSIDLEELKKCLQKLTLTL-KEEVEDLFHSCDIDNSTS  67

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
              F E I LL              TSK+GSP +++TF+TIVEAFLFL+KN          
Sbjct  68   SMFLEVINLL--------------TSKMGSPELQATFDTIVEAFLFLNKN----------  103

Query  313  VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
                                  +EMDWDR+GK+SFR+FL + ++W+ ID D+ +
Sbjct  104  ----------------------EEMDWDRNGKVSFREFLSSLINWIRIDADERN  135



>ref|NP_001078450.1| putative calcium-binding protein CML21 [Arabidopsis thaliana]
 dbj|BAE99871.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85205.1| putative calcium-binding protein CML21 [Arabidopsis thaliana]
Length=211

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 99/143 (69%), Gaps = 3/143 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +GL+  + +F++FDEDSNG+ID  ELK C++KL+    EEEI++LF++CD++++  
Sbjct  50   PKIDDGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFDEEEINDLFKACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTS-KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD  317
            I F EFIVLLCL+YLL D  S+      +G P +E TF T+V+ F+FLD+N DG + +++
Sbjct  110  ITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDENKDGYVSREE  169

Query  316  VVKAFNDAFPLEKSPSHVTRTRF  248
            +V+A +++   E+S   +   RF
Sbjct  170  MVRAIDESG--ERSSGRIAMKRF  190



>ref|XP_010691276.1| PREDICTED: probable calcium-binding protein CML22 isoform X5 
[Beta vulgaris subsp. vulgaris]
Length=226

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 85/119 (71%), Gaps = 2/119 (2%)
 Frame = -2

Query  508  DDNEKIKFNEFIVLLCLIYLLMDAPS-SGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGK  332
            D N +I+F EFIVLLCLIYL+    S + + S+  SP  E+TF+ IV+ F+++DKNGDGK
Sbjct  99   DRNGRIQFREFIVLLCLIYLITKPSSPTDAVSRTESPNWEATFDIIVQVFIYMDKNGDGK  158

Query  331  LHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            L KKD+V A  +  P E+SPSHV +TRF EMD D+ G ++FR++LF    W+GID D +
Sbjct  159  LSKKDMVAALTEP-PWERSPSHVMKTRFMEMDKDKDGNVTFREYLFGLTSWLGIDSDSD  216



>gb|EMS67685.1| putative calcium-binding protein CML21 [Triticum urartu]
Length=313

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/255 (33%), Positives = 116/255 (45%), Gaps = 87/255 (34%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDE-------DSNGAIDREELKKCLQKLQFHVGEEEIDELFRSC  515
            P   E L+  R +F+QF E       DSNG ID+ ELK C QKL     +EEI +LF +C
Sbjct  49   PKIDENLRNCRIIFQQFGEHYPPVYEDSNGEIDQLELKHCFQKLDISFTDEEIKDLFEAC  108

Query  514  DVDDNEKIKFNEFIVLLCLIYLLMDAPSSGSTS---------------------------  416
            D+ ++  +KFNEFIV LCL+YLL D   S + S                           
Sbjct  109  DIYEHMGMKFNEFIVFLCLVYLLNDPAVSEAVSFILPNIKYTYFQIPAITWCFTAAATPW  168

Query  415  -------------KIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKS  275
                         ++G   +E TF T+V+AF+FLDKN DG + K +V++A N+    E+S
Sbjct  169  SRNRMQSAFDQRKRMGLGNLEPTFETLVDAFVFLDKNKDGYVSKNEVIEAINETSAGERS  228

Query  274  PSHVTRTRF----------------------------------------KEMDWDRSGKI  215
               +   RF                                        +EMDWD++G +
Sbjct  229  SGRIGVKRFEILFKFGNCIGGLVLSAYYSPHYESFLIYVDPDVYSLVVPEEMDWDKNGTV  288

Query  214  SFRKFLFAFLDWVGI  170
            +F++FLFAF  WVGI
Sbjct  289  TFKEFLFAFTRWVGI  303



>ref|XP_003062470.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53289.1| predicted protein [Micromonas pusilla CCMP1545]
Length=204

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 103/187 (55%), Gaps = 18/187 (10%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQK---LQFHVGEEEIDELFRSCDVDD  503
            P      + +R +F++ D+D+NG I++ E    +++    +  V  E I+ ++   D+  
Sbjct  4    PSMLSSFEALRGIFDRVDKDANGFIEKHEFVTAVEEGFSRKVTVEREMIERIYDEADLKH  63

Query  502  NEKIKFNEFIVLLCLIYLLM---------DAPSSGSTSKIGSPVVESTFNTIVEAFLFLD  350
            + ++ + EF++++ L+YL+          D   SGS  +    +V +    ++EAFLF D
Sbjct  64   DGRVNYKEFVLMIVLLYLVSWETDLSVGKDTAVSGSAGE--DTLVHNAVQKVLEAFLFFD  121

Query  349  KNGDGKLHKKDVVK---AFNDAFPLEKSP-SHVTRTRFKEMDWDRSGKISFRKFLFAFLD  182
             NGDG + K +V+K   A   A   +K+    +T  RF+E+DWD+SG++ F++FLFA   
Sbjct  122  ANGDGYIRKDEVLKKLEAHEGAHAKQKTEHGGLTAARFRELDWDKSGRVDFKQFLFAVEG  181

Query  181  WVGIDGD  161
            W G+D D
Sbjct  182  WCGMDDD  188



>gb|AFW87515.1| hypothetical protein ZEAMMB73_336887 [Zea mays]
Length=165

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 70/107 (65%), Gaps = 2/107 (2%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ +T+FEQFDEDSNG ID+EELK C QKL+    EEEI +LF +CD++++  
Sbjct  49   PKIDESFRKCKTIFEQFDEDSNGEIDKEELKHCFQKLEISFTEEEICDLFEACDINEDMG  108

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFL  353
            +KFNEFIV LCL+YLL +A    + S I    + S  N ++   + L
Sbjct  109  MKFNEFIVFLCLVYLLNEAAVLEAVSFISH--INSHSNILIALLVLL  153



>emb|CDY70736.1| BnaCnng69600D, partial [Brassica napus]
Length=85

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 1/73 (1%)
 Frame = -2

Query  370  EAFLFLDKNGDGKLHKKDVVKAFNDA-FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLF  194
            E FLFLDK+G GKL+K DV+K  N+  +PLE SP HVT  RF+EMDW R GK+ FR+FLF
Sbjct  1    EVFLFLDKDGKGKLNKADVIKRLNNEDYPLEISPKHVTNMRFEEMDWGRKGKVGFREFLF  60

Query  193  AFLDWVGIDGDDE  155
            AF+ WVG+D  D+
Sbjct  61   AFMSWVGLDDADD  73



>ref|XP_002862334.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38592.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=142

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +GL+  + +F++FDEDSNG+ID  ELK C++KL+    EEEI++LF++CD++++  
Sbjct  50   PKIDDGLRNCKAIFQEFDEDSNGSIDHTELKNCIKKLEISFDEEEINDLFKACDINEDMG  109

Query  493  IKFNEFIVLLCLIYLLMDAPSS  428
            I F EFIVLLCL+YLL D  S+
Sbjct  110  ITFTEFIVLLCLVYLLKDDSST  131



>ref|XP_008619093.1| hypothetical protein SDRG_14719 [Saprolegnia diclina VS20]
 gb|EQC27519.1| hypothetical protein SDRG_14719 [Saprolegnia diclina VS20]
Length=287

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 104/218 (48%), Gaps = 46/218 (21%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  +E    +R  F +FD+   G I  ++++  L +L  +  + EIDE F   D+ +N +
Sbjct  67   PALKEAFDSVRVTFREFDKQQKGFIVFDDMESALNRLGGNFTKAEIDEAFSEADMAENGQ  126

Query  493  IKFNEFIVLLCLIYLLMDAPSSGST-----SKIGSPV----------------VESTFNT  377
            + F EF+V L + ++L   P+  +T     S   +P+                +   F  
Sbjct  127  LSFKEFLVCLAMGFVLHRIPALETTETPQLSIFYAPLAGKAEPKTLLFGEGNKLRQAFQL  186

Query  376  IVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSH-----------------------  266
             V+ FL+ D +GDG + K+++++   ++   E SP+                        
Sbjct  187  AVDVFLWFDMDGDGLIEKEEMLRRLTESMH-EHSPTKKMSKVRKLGSTTKSSGTCPANAF  245

Query  265  VTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDED  152
            +++ RF EMDWD  G I+F++FL AF  WVG+D DDED
Sbjct  246  ISQKRFNEMDWDHDGSITFKEFLMAFESWVGVD-DDED  282



>ref|XP_010468449.1| PREDICTED: probable calcium-binding protein CML22 [Camelina sativa]
Length=182

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 90/176 (51%), Gaps = 47/176 (27%)
 Frame = -2

Query  622  DEDSNGAIDREELKKCLQKLQFHVGEEEIDELFR-SCDVDDNEKIKFNEFIVLLCLIYLL  446
            + D NG ID EELKKCL++LQ  + +EE+  L+   CDVD ++ I+FNEF+  L      
Sbjct  37   NNDKNGTIDIEELKKCLEELQLSLSDEEVKGLYGIWCDVDGSKGIQFNEFMFKL------  90

Query  445  MDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA-FPLEKSPS  269
                                    +E FLFLDK G GK++K DV+K  N+  +PLE+S S
Sbjct  91   ------------------------IEVFLFLDKEGKGKVNKADVIKTLNNEDYPLERSLS  126

Query  268  HVTRTRFKEMDWDRSGKISFR------------KFLF--AFLDWVGIDGDDEDHMA  143
            HVT  RF E D      I F             K++   AF+ WVG+D  D+ +M+
Sbjct  127  HVTNMRF-EFDLLIGDSICFHELQKKWIGEEKEKWVLESAFMSWVGLDDADDYYMS  181



>gb|ACR34117.1| unknown [Zea mays]
 gb|AFW87514.1| hypothetical protein ZEAMMB73_336887 [Zea mays]
Length=163

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 4/107 (4%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E  ++ +T+FEQFD  SNG ID+EELK C QKL+    EEEI +LF +CD++++  
Sbjct  49   PKIDESFRKCKTIFEQFD--SNGEIDKEELKHCFQKLEISFTEEEICDLFEACDINEDMG  106

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFL  353
            +KFNEFIV LCL+YLL +A    + S I    + S  N ++   + L
Sbjct  107  MKFNEFIVFLCLVYLLNEAAVLEAVSFISH--INSHSNILIALLVLL  151



>gb|EAZ22107.1| hypothetical protein OsJ_05766 [Oryza sativa Japonica Group]
Length=93

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  412  IGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRTRFKEMDW  233
            +G   +E TF T+V++F+FLDKN DG + K ++++A N+    E+S   +   RF+EMDW
Sbjct  1    MGLGSLEPTFETLVDSFVFLDKNKDGYVSKNEMIQAINETIGGERSSGRIGMKRFEEMDW  60

Query  232  DRSGKISFRKFLFAFLDWVGI  170
            D++G ++F++FLFAF  WVGI
Sbjct  61   DKNGTVTFKEFLFAFTRWVGI  81



>ref|XP_009840757.1| hypothetical protein H257_14590 [Aphanomyces astaci]
 gb|ETV69742.1| hypothetical protein H257_14590 [Aphanomyces astaci]
Length=356

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 104/219 (47%), Gaps = 50/219 (23%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  ++    +R+ F+ FD+   G+I   ++++ L +L  +  ++EI++ F   D+ ++ +
Sbjct  116  PSLKQAFDSVRSTFDAFDKLKQGSISFNDMEEALNRLGGNFTKDEINDAFTEADMSESGR  175

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVE--------------------------  392
            + F EF+V L + ++L   P+    S+ G P +                           
Sbjct  176  LTFKEFLVCLAIGFVLHRIPALDDRSEGGQPRLSIFYAPLKGSGKDGQPKALLFGDGNKL  235

Query  391  -STFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAF----PLEKS----------------  275
               F+  V+ FL+ D +GDG + K +++   +++     P +K+                
Sbjct  236  RQAFHLAVDVFLWFDMDGDGLIEKNEMLSRLHESMHEHSPTKKTSKQRSLAKGDVEAMIN  295

Query  274  -PSH--VTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
             P++  +T+ RF EMDWD  G I+F++FL AF  WVG++
Sbjct  296  CPANTFITQRRFNEMDWDHDGSITFKEFLMAFESWVGVN  334



>gb|KJB63080.1| hypothetical protein B456_009G454500 [Gossypium raimondii]
Length=128

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P     L++ + +FEQFDEDSNGAID EELKKCL KLQ    EEEI++LF++CD++++  
Sbjct  44   PKIDHTLRKCKAIFEQFDEDSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMG  103

Query  493  IKFNEF  476
            IKFNEF
Sbjct  104  IKFNEF  109



>gb|KJB63081.1| hypothetical protein B456_009G454500 [Gossypium raimondii]
Length=165

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P     L++ + +FEQFDEDSNGAID EELKKCL KLQ    EEEI++LF++CD++++  
Sbjct  44   PKIDHTLRKCKAIFEQFDEDSNGAIDHEELKKCLHKLQVCFTEEEIEDLFKACDMNEDMG  103

Query  493  IKFNEF  476
            IKFNEF
Sbjct  104  IKFNEF  109



>ref|XP_008878820.1| hypothetical protein H310_13196 [Aphanomyces invadans]
 gb|ETV92513.1| hypothetical protein H310_13196 [Aphanomyces invadans]
Length=345

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/223 (25%), Positives = 103/223 (46%), Gaps = 51/223 (23%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  ++    +R+ F+ FD    G+I   ++++ L +L  +  ++E+ + F   D+ ++ +
Sbjct  119  PSLKQAFDSVRSTFDAFDTHKQGSISFGDMEEALNRLGGNFTKDEVYDAFNEADMTESGR  178

Query  493  IKFNEFIVLLCLIYLLMDAPSS------------------GSTSKIGSPV---------V  395
            + F EF+V L + ++L   P+                    S+ K G P          +
Sbjct  179  LTFKEFLVCLAIGFVLHRIPALDDREPDGQPQLSIFYAPLNSSIKDGEPKSLLFGDGNKL  238

Query  394  ESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSP-------------------  272
               F+  V+ FL+ D +GDG + + +++   +++   E SP                   
Sbjct  239  RQAFHLAVDVFLWFDIDGDGLIERNEMLSRLHESM-HEHSPTKKTSKQRSFLKASDATVT  297

Query  271  ----SHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
                S +T+ RF EMDWD  G I+F++FL AF  WVG+D +D+
Sbjct  298  CPANSFITQRRFNEMDWDHDGSITFKEFLMAFESWVGVDDEDD  340



>gb|KDO27543.1| hypothetical protein SPRG_06811 [Saprolegnia parasitica CBS 223.65]
Length=287

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 96/209 (46%), Gaps = 45/209 (22%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P  +E    +R  F +FD+   G I  ++++  L +L  +  + EIDE F   D+ +N +
Sbjct  67   PALKEAFDSVRVTFREFDKQQKGFIVFDDMESALNRLGGNFTKAEIDEAFSEADMAENGQ  126

Query  493  IKFNEFIVLLCLIYLLMDAPSSGST-----SKIGSPVVEST----------------FNT  377
            + F EF+V L + ++L   P+  +T     S   +P+   T                F  
Sbjct  127  LSFKEFLVCLAMGFVLHRIPALETTETPQLSIFYAPLAGKTEPKTLLFGEGNKLRQAFQL  186

Query  376  IVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSH-----------------------  266
             V+ FL+ D +GDG + K+++++   ++   E SP+                        
Sbjct  187  AVDVFLWFDMDGDGLIEKEEMLRRLTESMH-EHSPTKKMSKARKLGSTTKSGSTCPANAF  245

Query  265  VTRTRFKEMDWDRSGKISFRKFLFAFLDW  179
            +++ RF EMDWD  G I+F++FL AF  W
Sbjct  246  ISQKRFNEMDWDHDGSITFKEFLMAFESW  274



>emb|CBN76140.1| calcium ion binding [Ectocarpus siliculosus]
Length=378

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 95/186 (51%), Gaps = 20/186 (11%)
 Frame = -2

Query  655  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  476
            + +IR VF++ D D +G ID  E+   ++ L+ ++ E+EI  LF+  D  +++++   +F
Sbjct  59   MNDIRRVFQERDTDQSGRIDMCEMSTAMKDLKVNLSEDEIKALFKMADFYEDKQLTMKQF  118

Query  475  IVLLCLIYL------LMDAPSSGSTSKIGS-------------PVVESTFNTIVEAFLFL  353
            +V+L + Y+      LM+ P++                       V +       A+L  
Sbjct  119  LVVLAMGYVLDAIPDLMENPATAEAEAAARAAGRRMSNFYNKEQTVRNALELFTYAYLLF  178

Query  352  DKNGDGKLHKKDV-VKAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWV  176
            DK   G + ++ V +    +    E S S +++ R+ EMDWD +G ISF +F++AF  WV
Sbjct  179  DKECKGVISREQVMIVVAENGQKDEGSMSILSQERWDEMDWDSNGDISFGEFVYAFTKWV  238

Query  175  GIDGDD  158
             +DG+D
Sbjct  239  DVDGED  244



>ref|XP_007224348.1| hypothetical protein PRUPE_ppa020720mg [Prunus persica]
 gb|EMJ25547.1| hypothetical protein PRUPE_ppa020720mg [Prunus persica]
Length=160

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  619  EDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMD  440
            EDSNGAID+EE+KKC  KL+    +EEI +LF +CD++++  IKFNEFIVL+CL+YLL D
Sbjct  21   EDSNGAIDQEEMKKCFYKLEVCFTDEEISDLFEACDINEDMGIKFNEFIVLICLVYLLKD  80



>ref|XP_009526471.1| hypothetical protein PHYSODRAFT_502537, partial [Phytophthora 
sojae]
 gb|EGZ17413.1| hypothetical protein PHYSODRAFT_502537 [Phytophthora sojae]
Length=236

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 90/202 (45%), Gaps = 39/202 (19%)
 Frame = -2

Query  646  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  467
            +R+ F  +D ++ G I+  +L +  ++L  +   EEI  +F+  D+  + K+ F EF+V 
Sbjct  24   VRSTFRVYDRENKGYIEFADLSRVFEQLGANFSSEEISMVFQESDMMKDGKLNFKEFLVC  83

Query  466  LCLIYLLMDAPS-SGSTSKIGSPVVEST--------------------FNTIVEAFLFLD  350
            L + ++L   PS  G    I    + ST                    F   V+AFL+ D
Sbjct  84   LAIGFVLHKIPSLEGERLSIFYAPINSTPASAPTQFILFGEGNKLRLAFQLAVDAFLWFD  143

Query  349  KNGDGKLHKKDVVKAFNDAFPLEKSPSHVT------------------RTRFKEMDWDRS  224
             +GDG +++ ++      +  L      +T                    RF EMDW+  
Sbjct  144  VDGDGVINRSEMSTKLQHSMALHSPTKKMTADDMNKDTSDDSSNQAIWEQRFMEMDWNGD  203

Query  223  GKISFRKFLFAFLDWVGIDGDD  158
            G I F++FL AF  WVG++ DD
Sbjct  204  GTIQFKEFLMAFESWVGLEDDD  225



>gb|ETL87187.1| hypothetical protein L917_13535 [Phytophthora parasitica]
Length=292

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/204 (24%), Positives = 85/204 (42%), Gaps = 34/204 (17%)
 Frame = -2

Query  664  REGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKF  485
            R+    +R+++ QF       +D E LK  L  +  H+ E ++ E+F   D+  +  +  
Sbjct  89   RDAFTTLRSIYRQFANAEKDGLDFEGLKAALNAMGAHIKETDVSEIFYESDMVRDNSLSQ  148

Query  484  NEFIVLLCLIYL----------------------LMDAPSSGSTSKIGSPVVESTFNTIV  371
            NEF+V L + +L                      L+  P   +     S ++    + +V
Sbjct  149  NEFVVSLAIAHLLGLITNFDSIKDSVVHAPEDVTLVTPPDEPAEQGNASKLIAKALDLMV  208

Query  370  EAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT------------RFKEMDWDR  227
             A+L  D +  G +   +V++          SP  + R             R KE+D+D+
Sbjct  209  TAYLLFDNDASGTIQTSEVLEQMRQNPTGPNSPRRLERMESSFSSKAIRDERIKELDFDQ  268

Query  226  SGKISFRKFLFAFLDWVGIDGDDE  155
             G I+F++F+  F  W G D DDE
Sbjct  269  DGTITFQEFVLTFQRWAGSDDDDE  292



>ref|XP_008909760.1| hypothetical protein PPTG_14587 [Phytophthora parasitica INRA-310]
 gb|ETI40385.1| hypothetical protein F443_14192 [Phytophthora parasitica P1569]
 gb|ETK80489.1| hypothetical protein L915_13831 [Phytophthora parasitica]
 gb|ETL33914.1| hypothetical protein L916_13728 [Phytophthora parasitica]
 gb|ETM40377.1| hypothetical protein L914_13640 [Phytophthora parasitica]
 gb|ETN04823.1| hypothetical protein PPTG_14587 [Phytophthora parasitica INRA-310]
 gb|ETO69095.1| hypothetical protein F444_14211 [Phytophthora parasitica P1976]
 gb|ETP10206.1| hypothetical protein F441_14088 [Phytophthora parasitica CJ01A1]
 gb|ETP38305.1| hypothetical protein F442_14032 [Phytophthora parasitica P10297]
Length=292

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/204 (24%), Positives = 85/204 (42%), Gaps = 34/204 (17%)
 Frame = -2

Query  664  REGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKF  485
            R+    +R+++ QF       +D E LK  L  +  H+ E ++ E+F   D+  +  +  
Sbjct  89   RDAFTTLRSIYRQFANAEKDGLDFEGLKAALNAMGAHIKETDVSEIFYESDMVRDNSLSQ  148

Query  484  NEFIVLLCLIYL----------------------LMDAPSSGSTSKIGSPVVESTFNTIV  371
            NEF+V L + +L                      L+  P   +     S ++    + +V
Sbjct  149  NEFVVSLAIAHLLGLITNFDSIKDSVVHAPEDVTLVTPPDEPAEQGNASKLIAKALDLMV  208

Query  370  EAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT------------RFKEMDWDR  227
             A+L  D +  G +   +V++          SP  + R             R KE+D+D+
Sbjct  209  TAYLLFDNDASGTIQTSEVLEQMRQNPTGPNSPRRLERMESSFSSKAIRDERIKELDFDQ  268

Query  226  SGKISFRKFLFAFLDWVGIDGDDE  155
             G I+F++F+  F  W G D DDE
Sbjct  269  DGTITFQEFVLTFQRWAGSDDDDE  292



>ref|XP_002896992.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY66473.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=237

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/210 (26%), Positives = 94/210 (45%), Gaps = 51/210 (24%)
 Frame = -2

Query  646  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  467
            +R+ F  FD++  G I+  +L +  ++L      EEI ++F   D+ ++ K+ FNEF+V 
Sbjct  26   VRSTFNAFDKERKGYIEFADLSRVFEQLGAKFSIEEIGQVFEESDMMEDGKLTFNEFLVC  85

Query  466  LCLIYLLMDAPS-----SGSTSKIGSPV--------------------------VESTFN  380
            L + ++L   PS         S   +P+                          +   F 
Sbjct  86   LAIGFVLHKIPSLEGEQEQPLSIFYAPMSRTSSNSSRSSSGGSGQSILFGDGNKLRLAFQ  145

Query  379  TIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT------------------  254
              V+AFL+ D +G+G++++ ++V    ++  L  SP+    T                  
Sbjct  146  LAVDAFLWFDVDGNGEINRDEMVTKLQNSMTLH-SPTKKMSTGERSRGTSDDSSNRAIWE  204

Query  253  -RFKEMDWDRSGKISFRKFLFAFLDWVGID  167
             RF EMDW+  G I F++FL AF  WVG++
Sbjct  205  QRFMEMDWNGDGTIHFKEFLMAFESWVGLE  234



>gb|ETI45580.1| hypothetical protein F443_09884 [Phytophthora parasitica P1569]
 gb|ETM45391.1| hypothetical protein L914_09550 [Phytophthora parasitica]
Length=325

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/219 (26%), Positives = 95/219 (43%), Gaps = 51/219 (23%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P         R+ F  FD++  G I+  +L +  ++L  +   EEI ++F   D+ ++ K
Sbjct  105  PQAAVAFNSARSTFNAFDKEGKGYIEFSDLSRVFEQLGANFSSEEIGQVFEESDMMEDGK  164

Query  493  IKFNEFIVLLCLIYLLMDAPSSGS-----TSKIGSPV-----------------------  398
            + FNEF+V L + ++L   PS  S      S   +P+                       
Sbjct  165  LNFNEFLVCLAIGFVLHKIPSLESEQEQQLSIFYAPMSRTSSNSSRTSSAVSSQSILFGD  224

Query  397  ---VESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT---------  254
               +   F   V+AFL+ D +G+G +++ ++V    ++  L  SP+    T         
Sbjct  225  GNNLRLAFQLAVDAFLWFDVDGNGVINRDEMVTKLENSIVLH-SPTKKMSTGDRNRGSSD  283

Query  253  ----------RFKEMDWDRSGKISFRKFLFAFLDWVGID  167
                      RF EMDW+  G I F++FL AF  WVG++
Sbjct  284  YSSNRAIWEQRFMEMDWNGDGTIHFKEFLMAFESWVGLE  322



>gb|ETK85532.1| hypothetical protein L915_09682 [Phytophthora parasitica]
 gb|ETL38971.1| hypothetical protein L916_09586 [Phytophthora parasitica]
 gb|ETL92092.1| hypothetical protein L917_09511 [Phytophthora parasitica]
 gb|ETO74224.1| hypothetical protein F444_09978 [Phytophthora parasitica P1976]
 gb|ETP15388.1| hypothetical protein F441_09834 [Phytophthora parasitica CJ01A1]
 gb|ETP43453.1| hypothetical protein F442_09789 [Phytophthora parasitica P10297]
Length=325

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/219 (26%), Positives = 95/219 (43%), Gaps = 51/219 (23%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P         R+ F  FD++  G I+  +L +  ++L  +   EEI ++F   D+ ++ K
Sbjct  105  PQAAVAFNSARSTFNAFDKEGKGYIEFSDLSRVFEQLGANFSSEEIGQVFEESDMMEDGK  164

Query  493  IKFNEFIVLLCLIYLLMDAPSSGST-----SKIGSPV-----------------------  398
            + FNEF+V L + ++L   PS  S      S   +P+                       
Sbjct  165  LNFNEFLVCLAIGFVLHKIPSLESEQEQQLSIFYAPMSRTSSNSSRTSSAVSSQSILFGD  224

Query  397  ---VESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT---------  254
               +   F   V+AFL+ D +G+G +++ ++V    ++  L  SP+    T         
Sbjct  225  GNNLRLAFQLAVDAFLWFDVDGNGVINRDEMVTKLENSIVLH-SPTKKMSTGDRNRGSSD  283

Query  253  ----------RFKEMDWDRSGKISFRKFLFAFLDWVGID  167
                      RF EMDW+  G I F++FL AF  WVG++
Sbjct  284  DSSNRAIWEQRFMEMDWNGDGTIHFKEFLMAFESWVGLE  322



>ref|XP_008892917.1| hypothetical protein PPTG_01392 [Phytophthora parasitica INRA-310]
 gb|ETN21086.1| hypothetical protein PPTG_01392 [Phytophthora parasitica INRA-310]
Length=325

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/218 (25%), Positives = 94/218 (43%), Gaps = 49/218 (22%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P         R+ F  FD++  G I+  +L +  ++L  +   EEI ++F   D+ ++ K
Sbjct  105  PQAAVAFNSARSTFNAFDKEGKGYIEFSDLSRVFEQLGANFSSEEIGQVFEESDMMEDGK  164

Query  493  IKFNEFIVLLCLIYLLMDAPSSGS-----TSKIGSPV-----------------------  398
            + FNEF+V L + ++L   PS  S      S   +P+                       
Sbjct  165  LNFNEFLVCLAIGFVLHKIPSLESEQEQQLSIFYAPMSRISSNSSRTSSAVSSQSILFGD  224

Query  397  ---VESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPL------------------E  281
               +   F   V+AFL+ D +G+G +++ ++V    ++  L                  +
Sbjct  225  GNNLRLAFQLAVDAFLWFDVDGNGVINRDEMVTKLENSIVLHSPTKKMFTGDRNRGSSDD  284

Query  280  KSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGID  167
             S   +   RF EMDW+  G I F++FL AF  WVG++
Sbjct  285  SSNRAIWEQRFMEMDWNGDGTIHFKEFLMAFESWVGLE  322



>ref|XP_002907045.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY63609.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=296

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 84/206 (41%), Gaps = 36/206 (17%)
 Frame = -2

Query  664  REGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKF  485
            R+    +R+++ QF       +D E LK  L  +  H+ E ++ E+F   D+  +  +  
Sbjct  91   RDAFTTLRSIYRQFANAEKDGLDFEGLKAALNAMGAHIKESDVSEIFYESDMVRDNSLSQ  150

Query  484  NEFIVLLCLIYLL-------------MDAP-----------SSGSTSKIGSPVVESTFNT  377
            NEF+V L + +LL             + AP                    S ++    + 
Sbjct  151  NEFVVSLAIAHLLGLITNFDSIKASVVQAPEDVTLITPPDEPPAEQGNNASKLIAKALDL  210

Query  376  IVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT------------RFKEMDW  233
            ++ A+L  D +  G +   +V+           SP  + R             R KE+D+
Sbjct  211  MISAYLLFDNDASGTIQTSEVLDQMRQNPTGPNSPRRLERMESSFSSKAIRDERIKELDF  270

Query  232  DRSGKISFRKFLFAFLDWVGIDGDDE  155
            D+ G I+F++F+  F  W G D DDE
Sbjct  271  DQDGTITFQEFVLTFQRWAGSDDDDE  296



>emb|CCI44687.1| unnamed protein product [Albugo candida]
Length=272

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 87/187 (47%), Gaps = 23/187 (12%)
 Frame = -2

Query  664  REGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKF  485
            R     +R ++++F ED    +    LK  L+ L   + ++++ E+F   DV  +  +  
Sbjct  87   RAAFDSLREIYDEFAEDD--GLTYVGLKLALKALGTTILDQDLQEIFFESDVVRDNSLSM  144

Query  484  NEFIVLLCLIYLL----------------MDAPSSGSTSKIGSPVVESTFNTIVEAFLFL  353
            NEF+V L + +LL                 D+  S S       VV   F+ ++ A+L  
Sbjct  145  NEFVVSLAIGHLLGLLQTSESRKASSSSKRDSECSPSLGVNELDVVVKMFDLLISAYLLF  204

Query  352  DKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT-----RFKEMDWDRSGKISFRKFLFAF  188
            D +G G +   +V+K  N      ++ +H  R+     R KE+D +  G I+F++F+  F
Sbjct  205  DADGSGMIDSNEVLKVINPKTTSGRAGNHTERSGIGEARIKELDVNEDGTITFQEFVLTF  264

Query  187  LDWVGID  167
              WVG+D
Sbjct  265  QGWVGVD  271



>ref|XP_009519854.1| hypothetical protein PHYSODRAFT_325675 [Phytophthora sojae]
 gb|EGZ24566.1| hypothetical protein PHYSODRAFT_325675 [Phytophthora sojae]
Length=294

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 88/209 (42%), Gaps = 43/209 (21%)
 Frame = -2

Query  664  REGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKF  485
            R+    IR++++QF +     +D E LK  L  +   + E ++ ELF   D+  +  +  
Sbjct  90   RDAFTTIRSIYKQFADAEKDGLDFEGLKSALSAMGAQIKESDMSELFYESDMVRDNSLSQ  149

Query  484  NEFIVLLCLIYL-------------LMDAPS--------------SGSTSKIGSPVVEST  386
            NEF+V L + +L             L+ AP                G+ SK+    +   
Sbjct  150  NEFVVSLAIAHLLGLITNFDSIKNSLVHAPEDVTLITPPEEQPADQGNASKL----IAKA  205

Query  385  FNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEKSPSHVTRT------------RFKE  242
             + +V A+L  D +  G +   +V++          SP  + R             R KE
Sbjct  206  LDLMVTAYLLFDNDASGTIQTSEVLEQMRQNTTGANSPRRLERVSSGLSSKAIQDERIKE  265

Query  241  MDWDRSGKISFRKFLFAFLDWVGIDGDDE  155
            +D+D+ G I+F++F+  F  W   D DDE
Sbjct  266  LDFDQDGTITFQEFVLTFQRWAVSDDDDE  294



>ref|XP_006823620.1| PREDICTED: calmodulin-like [Saccoglossus kowalevskii]
Length=184

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 77/150 (51%), Gaps = 14/150 (9%)
 Frame = -2

Query  646  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  467
            +   F++ D+D +G +  +E+KK L+ L   V +E+ID+ F S D +D+ KI +NEF   
Sbjct  40   VMEAFKEIDKDDSGYVTVDEVKKVLKDLGEEVSDEDIDKFFESADKNDDGKISYNEFYA-  98

Query  466  LCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFP  287
               +    +A   G  S+          + ++EAF  LD +G+G L K +V KA  DA  
Sbjct  99   -AWVKATEEAKKEGELSQ----------DEMLEAFKALDADGNGSLTKDEVKKALQDASS  147

Query  286  LEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
                      +  KE D D+ GK+ +++F+
Sbjct  148  Y--YSDEQVDSMIKEADEDKDGKVDYKEFV  175



>ref|XP_008863480.1| hypothetical protein H310_01913 [Aphanomyces invadans]
 gb|ETW07387.1| hypothetical protein H310_01913 [Aphanomyces invadans]
Length=300

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 86/185 (46%), Gaps = 21/185 (11%)
 Frame = -2

Query  646  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  467
            IR ++ +  +     +  +     L      +    I ++F   D+  +  + FNEF V 
Sbjct  116  IREIYSKHTDPVRKTMQMDNFCGALSAFGVTIDRPAIQDIFNESDLIRDNSLNFNEFAVS  175

Query  466  LCLIYLLMDAP--SSGSTSK--------------IGSPVVESTFNTIVEAFLFLDKNGDG  335
            L + YLL   P  S+ ST++                +  V   F+T+V A+L  D++  G
Sbjct  176  LAICYLLNVVPGLSACSTTQGDDHLDDANVELDASDAKRVAKAFDTVVNAYLMFDEDASG  235

Query  334  KLHKKDVVKAFNDA-FPLEKSPSHVTR----TRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
             +   ++ +  N       KS +H T+     R+KE+DW++ G I+F++F  AF  WVG+
Sbjct  236  IIKWDEMKEILNKPENGKAKSTTHKTKFFNVERWKELDWNKDGSINFQEFFLAFQKWVGV  295

Query  169  DGDDE  155
            D DD+
Sbjct  296  DDDDQ  300



>emb|CCA15835.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=276

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 90/187 (48%), Gaps = 23/187 (12%)
 Frame = -2

Query  664  REGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKF  485
            R     +R ++++F E+ NG +    LK  L+ L   + ++++ E+F   DV  +  +  
Sbjct  91   RAAFDSLREIYDEFAEE-NG-LTYVGLKSALEALGTTILDQDLQEIFFESDVVRDNSLSM  148

Query  484  NEFIVLLCLIYLL-----MDAPSSGSTSKIGSP-----------VVESTFNTIVEAFLFL  353
            NEF+V L + +LL      ++    STSK  +            VV   F+ ++ A+L  
Sbjct  149  NEFVVSLAIGHLLGLLQTFESKQVSSTSKRDTETSTSLGDNERDVVVKMFDLLISAYLLF  208

Query  352  DKNGDGKLHKKDVVKAFN----DAFPLEKS-PSHVTRTRFKEMDWDRSGKISFRKFLFAF  188
            D +G G +   +V+K  N         + S  S +   R KE+D +  G I+F++F+  F
Sbjct  209  DADGSGIIDSSEVLKVMNPNTNSGLACKHSEKSGIGEARIKELDINEDGTITFQEFVLTF  268

Query  187  LDWVGID  167
              WVG+D
Sbjct  269  QGWVGVD  275



>emb|CCK71480.1| hypothetical protein KNAG_0H00640 [Kazachstania naganishii CBS 
8797]
Length=148

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 73/154 (47%), Gaps = 20/154 (13%)
 Frame = -2

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
            E ++E R  F+ FD+D +G+I   EL   ++ L     E+E+ +L    D D N +I F+
Sbjct  8    EQIQEFRDAFDLFDKDKSGSISASELTTVMKSLGLTPSEDEVRDLMNEIDQDGNNEIDFD  67

Query  481  EFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAF  302
            EF+ L+      MD+                    ++EAF   DKNGDG + K ++ +  
Sbjct  68   EFLSLMARQANAMDSE-----------------QELIEAFKVFDKNGDGHISKSELKQVL  110

Query  301  NDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKF  200
            N     E+       T FKE+  D SG+IS  +F
Sbjct  111  NSIG--EQLTEEELDTMFKEV-SDGSGEISIEQF  141



>ref|XP_008620055.1| hypothetical protein SDRG_15654 [Saprolegnia diclina VS20]
 gb|EQC26476.1| hypothetical protein SDRG_15654 [Saprolegnia diclina VS20]
Length=281

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 74/152 (49%), Gaps = 22/152 (14%)
 Frame = -2

Query  547  EEEIDELFRSCDVDDNEKIKFNEFIVLLCLIYLLMDAP----SSGSTSKIGSP-------  401
            E  + ++F   D+  +  + FNEF V L + YLL   P    + G   +  +P       
Sbjct  129  ENAVKDIFNESDIIRDNALNFNEFAVSLAICYLLDIIPNLFHARGGGDEDDAPGADYKEI  188

Query  400  ------VVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFN--DAFPLEKSPSHV---TRT  254
                   +   F T+V A+L  D++  G +   ++ +  N  ++  L+ + +H       
Sbjct  189  ERDDALKISKAFETVVNAYLMFDQDASGIIKWGEMKEILNKPESSKLKSNAAHAKFFNVE  248

Query  253  RFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
            R+KE+DW++ G I+F++F  AF  WVGID D+
Sbjct  249  RWKELDWNKDGSINFQEFFLAFQKWVGIDEDE  280



>ref|XP_009825682.1| hypothetical protein H257_03354 [Aphanomyces astaci]
 gb|ETV83990.1| hypothetical protein H257_03354 [Aphanomyces astaci]
Length=280

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/189 (24%), Positives = 82/189 (43%), Gaps = 25/189 (13%)
 Frame = -2

Query  646  IRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVL  467
            IR ++ +  + +   +  +   + L      +    I ++F   D+  +  + FNEF V 
Sbjct  92   IRDIYTKHIDPTRKTMQMDNFCRALSAFGVTIDRPAIQDIFNESDLIRDNSLNFNEFAVS  151

Query  466  LCLIYLLMDAPS-SGSTSKIGSPV-------------------VESTFNTIVEAFLFLDK  347
            L + YLL   P  S + S    P+                   V   F+T+V A+L  D+
Sbjct  152  LAICYLLDVVPGLSAANSSPADPLADEPLEDPGVELDATDAKRVAKAFDTVVNAYLMFDE  211

Query  346  NGDGKL---HKKDVVKAFNDAFPLEKSPSHV--TRTRFKEMDWDRSGKISFRKFLFAFLD  182
            +  G +     K+++    D      +         R+KE+DW++ G I+F++F  AF  
Sbjct  212  DASGIIKWDEMKEILNKPEDGKAKTTTHKTKFFNIERWKELDWNKDGSINFQEFFLAFQK  271

Query  181  WVGIDGDDE  155
            WVG+D D++
Sbjct  272  WVGVDEDEQ  280



>gb|KJB17909.1| hypothetical protein B456_003G023300 [Gossypium raimondii]
Length=169

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 77/153 (50%), Gaps = 21/153 (14%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF+
Sbjct  27   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIEQMIADVDKDGSGAIDFDEFV  86

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFND-  296
             ++              T+KIG      T   + +AF  +D++ +GK+  +D+ +  N+ 
Sbjct  87   YMM--------------TAKIGER---DTKEELTKAFQIIDQDNNGKISAQDIERIANEL  129

Query  295  AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
               L K      +   +E D D  G++S  +F+
Sbjct  130  GVNLTKKE---IQDMIEEADKDNDGEVSMDEFM  159



>gb|ELU06160.1| hypothetical protein CAPTEDRAFT_227531 [Capitella teleta]
Length=145

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 74/157 (47%), Gaps = 21/157 (13%)
 Frame = -2

Query  664  REGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKF  485
            R+ ++E+R  FE FD+D +G+I  EEL   +  L+    E EI ++ +  D+D   ++ F
Sbjct  3    RQQVEELREAFELFDKDGDGSITSEELLTVMTSLRQQATEAEIKDMIQQVDIDGKGQVSF  62

Query  484  NEFI-VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVK  308
             +F+ +++CL                     +S  + +  AF   D++GDG +   D+ +
Sbjct  63   EDFVELMMCL------------------RTQQSVNDEMRSAFQIFDQDGDGFIDAMDIGR  104

Query  307  AFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
               D    EK  +        E D D  GKI+F +F+
Sbjct  105  TMADLG--EKLTAGDVEQMIHEADADGDGKINFEQFI  139



>gb|KJB17910.1| hypothetical protein B456_003G023300 [Gossypium raimondii]
Length=170

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 77/153 (50%), Gaps = 21/153 (14%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF+
Sbjct  28   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIEQMIADVDKDGSGAIDFDEFV  87

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFND-  296
             ++              T+KIG      T   + +AF  +D++ +GK+  +D+ +  N+ 
Sbjct  88   YMM--------------TAKIGER---DTKEELTKAFQIIDQDNNGKISAQDIERIANEL  130

Query  295  AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
               L K      +   +E D D  G++S  +F+
Sbjct  131  GVNLTKKE---IQDMIEEADKDNDGEVSMDEFM  160



>gb|EPB82214.1| calmodulin [Mucor circinelloides f. circinelloides 1006PhL]
Length=150

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 74/153 (48%), Gaps = 18/153 (12%)
 Frame = -2

Query  655  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  476
            + E R  F  FD++ +GAID EEL + ++ L     +EE+ ++    D D+N +I FNEF
Sbjct  10   ISEYRESFALFDKNGDGAIDVEELGQVMRSLNQEPTDEELKDMINDVDSDNNGRIDFNEF  69

Query  475  IVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFND  296
            + ++  +                    + T N ++EAF   DK+ DG + + ++     +
Sbjct  70   LTIMSRM----------------KGADDETENDLLEAFKVFDKDQDGSITQDELRSVMTN  113

Query  295  AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
                +K  S       KE D D  GKI++++F+
Sbjct  114  LG--QKLTSQELDEMIKEADTDGDGKINYKEFV  144



>emb|CBY17793.1| unnamed protein product [Oikopleura dioica]
 emb|CBY22473.1| unnamed protein product [Oikopleura dioica]
Length=151

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 79/163 (48%), Gaps = 24/163 (15%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   E L E R  F+ FD+D NG I+ +ELK  L  L     +EE++EL +  D+D +  
Sbjct  4    PLTHERLLEYREAFQLFDKDGNGTIEIDELKIVLSSLGQPATQEELEELMKLADIDGDGT  63

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I  +EFI ++     + DA  + ++ +           T+ E F   D +G GK+   ++
Sbjct  64   IDLDEFIEMM----RVQDAMETENSHE----------ETLRETFQLFDTDGSGKISSSEL  109

Query  313  VKAFNDAFPLEKSPSHVTRTR----FKEMDWDRSGKISFRKFL  197
             +       +EK   H+T ++     KE D D  G+I F +F+
Sbjct  110  KQV------MEKLGDHLTDSQIQAMIKEADADGDGEIDFEEFV  146



>ref|XP_005850665.1| hypothetical protein CHLNCDRAFT_140699 [Chlorella variabilis]
 gb|EFN58563.1| hypothetical protein CHLNCDRAFT_140699 [Chlorella variabilis]
Length=276

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 84/182 (46%), Gaps = 15/182 (8%)
 Frame = -2

Query  667  FREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIK  488
              EG    + VF +      G +  E+L+     L +H+ E  +  +F   D+D +  + 
Sbjct  99   LHEGFAASKRVFRELVGVEGGELSLEQLRPACASLGYHLDEATLHSIFAGADMDGSRTLN  158

Query  487  FNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVK  308
             +EF+  + +++ L          ++  P + +T+ T  EAF+    + DG + K ++  
Sbjct  159  VHEFLATMAIVHSLRGPED----EELVDPQILATWRTAEEAFMSFASSRDGFIEKDELTG  214

Query  307  AFNDAFPLEKSPS----------HVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGDD  158
              +++   +   S           + + RF+E+D + SG++SF +FLF    WV  D ++
Sbjct  215  LMHESATDQVRHSANGSGGDPIRSIAQQRFEELDLNGSGRVSFLEFLFCLEGWVE-DAEE  273

Query  157  ED  152
            ED
Sbjct  274  ED  275



>dbj|GAN06811.1| calmodulin [Mucor ambiguus]
Length=149

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 76/153 (50%), Gaps = 19/153 (12%)
 Frame = -2

Query  655  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  476
            + E R  F  FD++ +GAID EEL + ++ L      EE+ ++    D D+N +I FNEF
Sbjct  10   ISEYRESFALFDKNGDGAIDAEELGQVMRSLNQDPTNEELKDMINDVDSDNNGRIDFNEF  69

Query  475  IVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFND  296
            + ++  +         G+         + T N ++EAF   DK+ DG + + ++    ++
Sbjct  70   LTIMSRM--------KGN---------DETENDLLEAFKVFDKDQDGSITQDELRSVMSN  112

Query  295  AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
                +K  S       KE D D  GKI++++F+
Sbjct  113  LG--QKLTSQELDEMIKEADTDGDGKINYKEFV  143



>ref|XP_011397401.1| Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic 
[Auxenochlorella protothecoides]
 gb|KFM24513.1| Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic 
[Auxenochlorella protothecoides]
Length=585

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 86/184 (47%), Gaps = 16/184 (9%)
 Frame = -2

Query  673  PHFREGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEK  494
            P   +GL     VF   D    G I  ++L+   +KL + V ++ ++  F S D+D +  
Sbjct  61   PSLHDGLSRAAKVFRSLDVPPTGEISLDQLRAGARKLGYAVDDDVLESAFVSADLDRSST  120

Query  493  IKFNEFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV  314
            I  +EF+V+L +++LL           + +  +++ F    +AFL  D +  G + + ++
Sbjct  121  INVDEFVVILAILHLLK---GPRDEEDVDAATLKA-FELATQAFLSFDSSRHGFISRDEL  176

Query  313  VKAFNDAFPLEKSP--SHVTRT---------RFKEMDWDRSGKISFRKFLFAFLDWVGID  167
              A  +   LE  P   H + T         RF E+D D +G+I+F  FL     WV   
Sbjct  177  ESALLEPH-LENMPHSPHASATNTIVPLVQQRFLELDRDGNGRITFPDFLACITHWVDEA  235

Query  166  GDDE  155
            G++E
Sbjct  236  GEEE  239



>ref|XP_011402686.1| PREDICTED: LOW QUALITY PROTEIN: calmodulin-like protein 12 [Amphimedon 
queenslandica]
Length=449

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 74/152 (49%), Gaps = 15/152 (10%)
 Frame = -2

Query  649  EIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIV  470
            EI+  F  FD+D NG I  EEL++ +  L  ++ +EE+D++ R  D+D + ++ + EF+ 
Sbjct  215  EIKEAFRVFDKDGNGFISSEELRQVMTNLGENLTDEEVDDMIREADLDGDGQVNYEEFVK  274

Query  469  LLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAF  290
            ++           +     +   + E       EAF   DK+GDG +  K++        
Sbjct  275  MM-----------TNKVQGVSEKLSEEQVAEFKEAFSLFDKDGDGTITTKELGVVMR---  320

Query  289  PLEKSPSHVT-RTRFKEMDWDRSGKISFRKFL  197
             L ++P+    +    E+D D +G I F +FL
Sbjct  321  SLGQNPTEAELQDMINEVDIDGNGTIDFPEFL  352


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  F  FD+D NG I  EEL++ +  L   + +EEIDE+ R  D+D + ++ + EF+
Sbjct  366  EEIKEAFRVFDKDGNGFISSEELRQVMVNLGEDLSKEEIDEMIREADIDGDGQVNYEEFV  425

Query  472  VLLC  461
             ++ 
Sbjct  426  KMMS  429



>ref|XP_010269961.1| PREDICTED: caltractin-like [Nelumbo nucifera]
Length=168

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 78/152 (51%), Gaps = 19/152 (13%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF+
Sbjct  26   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIEQMIADVDKDGSGAIDFDEFV  85

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA  293
             ++              T+KIG      T   +++AF  +D++ +GK+ + D +K     
Sbjct  86   HMM--------------TAKIGER---DTKEELMKAFHIIDQDKNGKISEAD-IKHIAKE  127

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
              L  S   + R   +E D DR G+++  +F+
Sbjct  128  LNLNFSDKEI-RDMVEEADRDRDGEVNSEEFI  158



>gb|ABR16212.1| unknown [Picea sitchensis]
Length=183

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 75/153 (49%), Gaps = 8/153 (5%)
 Frame = -2

Query  658  GLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNE  479
            G  E+R VF  FD++ +G I ++E+++   KL+  +GEEE+    R+ DV+ +  + F+E
Sbjct  28   GRDELRRVFAIFDKNGDGLISKQEMRESFDKLRLCIGEEELASTIRTVDVNGDGYVDFDE  87

Query  478  FIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFN  299
            F+ L    Y  M    SG   + G    E     + EAF   D+NGDG +  +++     
Sbjct  88   FVTL----YESM----SGKRGEGGDAKAEHEDADLAEAFGVFDENGDGLITVEELQSVLK  139

Query  298  DAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKF  200
                 E       +   +++D D  G +++ +F
Sbjct  140  SLCFEEGRTIGDCKKMIQKVDKDGDGMVNYMEF  172



>ref|XP_009040569.1| hypothetical protein AURANDRAFT_66979 [Aureococcus anophagefferens]
 gb|EGB04654.1| hypothetical protein AURANDRAFT_66979 [Aureococcus anophagefferens]
Length=339

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 55/208 (26%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQF--HVGEEEIDELFRSCDVDDNEKIKFNE  479
            K I  V++  D D NG++D +EL+K + +L+    V  E++  +F  CD+D +  I   E
Sbjct  57   KRINAVYDSLDTDKNGSLDLKELQKMIDELEIGHEVSSEDLRSVFELCDIDHDGTISLKE  116

Query  478  FIVLLCLIYLLMDAPSSGSTSK---------------------IGSP-----------VV  395
            FIV L L+YLL   P+  S                        +GSP           + 
Sbjct  117  FIVTLSLLYLLRAVPTLVSVRSEGKDVAGLIKPTCSARTQGPDMGSPERATKQVDHLKLD  176

Query  394  EST---------------------FNTIVEAFLFLDKNGDGKLHKKDVVKAFNDAFPLEK  278
            +ST                      + +V A+L  D +  G + K +V +        + 
Sbjct  177  QSTPRSESANQDAFLGRSNDIRYLVHWVVAAYLLFDTDCTGSISKDNVKQMQTQREIGDG  236

Query  277  SPSHVTRTRFKEMDWDRSGKISFRKFLF  194
            S   +   R++E+DWD +G + F +F F
Sbjct  237  SDVFLNEDRWQELDWDHNGVVDFEEFGF  264



>ref|XP_002507740.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68998.1| predicted protein [Micromonas sp. RCC299]
Length=275

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 75/179 (42%), Gaps = 18/179 (10%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFH-----------VGEEEIDELFRSCDVD  506
            + +R VF++ D DS+  ID +E     ++L+             V  + +  L+   D +
Sbjct  55   RGVRAVFDRMDADSSDTIDFDEFLIACEQLRVRKRWRILGSDDGVTADTLRALYLHADSN  114

Query  505  DNEKIKFNEFIVLLCLIYLLMD--APSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGK  332
             +  I F EF+ LL L+YL+ D  AP+          V  S     + A+L  D  GDG 
Sbjct  115  GDGTIDFREFVCLLALLYLMSDPAAPAMDDLHYDTQRVAHSAMTKALGAWLVFDPKGDGF  174

Query  331  LHKKDVVKAFND-----AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            + +  V    +        P ++      R R + + WD    ++ + FL A  +W  +
Sbjct  175  IRRSQVTNVLDSLRLRTVHPQDRDMFRSLRKRLRGLPWDIYDTVTLQAFLMAVQEWTDL  233



>gb|ERG82025.1| calcyphosin-like protein [Ascaris suum]
Length=248

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 69/141 (49%), Gaps = 6/141 (4%)
 Frame = -2

Query  658  GLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNE  479
            G+K +   F   D++ N  +D +E +K L      + EEE++  F++ D +++  I F+E
Sbjct  60   GIKSLGRSFRIMDDNENRTLDMDEFRKGLHDFGVTIDEEEVEAAFKTLDKNNSGTIDFDE  119

Query  478  FIVLL--CLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKA  305
            F+V L  C +Y    A S     K   P+ +S    I  AF  LDK GDG +   D+   
Sbjct  120  FLVALRNCSVYGFFIATSKNRIVKFQPPMSQSRLAVIDLAFKKLDKTGDGVITVDDMKGI  179

Query  304  FNDAFPLEKSPSHVTRTRFKE  242
            +N     E+ P  ++  + +E
Sbjct  180  YN----AERHPQFISGEKTRE  196



>gb|EKC43016.1| Low-density lipoprotein receptor-related protein 6 [Crassostrea 
gigas]
Length=872

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 45/165 (27%), Positives = 80/165 (48%), Gaps = 21/165 (13%)
 Frame = -2

Query  655  LKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEF  476
            + EIR  FE FD D +G +  +E+   ++ L   + ++E+DEL    D D N  ++F EF
Sbjct  62   MDEIRQTFELFDSDHDGKVSTKEISVIMRSLGMLISDKEMDELVARLDTDGNGTVEFAEF  121

Query  475  IVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVV---KA  305
               +          +SG  +KI   + E+    + +AF  LDKN DG + K++++     
Sbjct  122  ENFML---------TSGVLNKIPDEMDEN----LRDAFKILDKNNDGYIDKEELIFYMTK  168

Query  304  FNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGI  170
            F D   ++ +   +     +E D +  G+I ++  +  F D V I
Sbjct  169  FGDKMAVKDAEEMI-----EEADQNGDGRIDYKVDILIFADGVSI  208



>ref|XP_009025821.1| hypothetical protein HELRODRAFT_156044 [Helobdella robusta]
 gb|ESN96702.1| hypothetical protein HELRODRAFT_156044 [Helobdella robusta]
Length=187

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 63/120 (53%), Gaps = 18/120 (15%)
 Frame = -2

Query  658  GLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNE  479
            G++ I  VF+ FD++ N  +D+EEL   LQ+    + + E+D+LF   D D++  I F+E
Sbjct  19   GIRMIGRVFKTFDDNGNKKLDKEELASGLQEFGMSMSKSEVDQLFNYLDKDNSGSINFDE  78

Query  478  FIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFN  299
            F++ L                    P+  S  + I +AF  +DK+GDG+L   D+ K ++
Sbjct  79   FLIALR------------------PPMSASRVDLINKAFNKMDKSGDGQLTVDDLKKNYD  120



>ref|XP_008619594.1| hypothetical protein SDRG_15205 [Saprolegnia diclina VS20]
 gb|EQC26991.1| hypothetical protein SDRG_15205 [Saprolegnia diclina VS20]
Length=1334

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 49/165 (30%), Positives = 82/165 (50%), Gaps = 23/165 (14%)
 Frame = -2

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  458
            +F++FDED +G I  +E    L +L   V + +   +FR+CD D + +I   EF + L  
Sbjct  117  LFKRFDEDHSGLISVDEFLAMLPQLNISVSKPKGLRIFRACDKDGSGEIDLEEFKMALFA  176

Query  457  IYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHK---KDVVKAFN---D  296
            +      P+SG+T +       S+  +  +AF   D+NG G++ +    DVV+ FN   D
Sbjct  177  V-----DPTSGNTLQF----TPSSLLSPKDAFSLFDENGSGQIDELEFADVVEYFNINAD  227

Query  295  AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
                EK         FK+ D D+SG I F +F   +L  + ++ +
Sbjct  228  DAKQEK--------LFKKYDKDKSGYIDFEEFRAMWLQCIDVEAE  264



>emb|CDS09630.1| hypothetical protein LRAMOSA10990 [Absidia idahoensis var. thermophila]
Length=149

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 67/157 (43%), Gaps = 25/157 (16%)
 Frame = -2

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
            E +KE R  F  FD+D NG+ID  EL   ++ L  H    E+ ++    D D N  I FN
Sbjct  8    EQVKEYRDSFALFDKDGNGSIDARELGAVMESLNIHPTGSELKDMINEVDKDGNGTIDFN  67

Query  481  EFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKL---HKKDVV  311
            EF+ +L       D  +                  + EAF   DK+GDG +     + V+
Sbjct  68   EFLTMLAKRQKEADVQAE-----------------MREAFRVFDKDGDGVITIDELRQVM  110

Query  310  KAFNDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKF  200
             +F      EK  S       KE D D  G I++ +F
Sbjct  111  ASFG-----EKLTSQELDQMIKEADADGDGTINYEEF  142



>ref|XP_010923302.1| PREDICTED: calcium-dependent protein kinase 10-like [Elaeis guineensis]
Length=539

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 79/164 (48%), Gaps = 23/164 (14%)
 Frame = -2

Query  661  EGLKEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFN  482
            E ++ IR +F+  D D+NG +  EELK  LQK+   + E E+  L  + DVD N  + + 
Sbjct  367  EEVEVIREMFKLMDTDNNGKVTFEELKAGLQKVGSQLAEPEMKMLMDAADVDGNGVLDYG  426

Query  481  EFIVLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAF  302
            EF+ ++  +  L                  S    +  AF+F DK+G G +   ++ +A 
Sbjct  427  EFVAVIIHLQRL------------------SNDGHLRRAFVFFDKDGSGYIELDELREAL  468

Query  301  NDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLF---AFLDW  179
             D     ++ + V     +E+D D+ G+IS+ +F+    A  DW
Sbjct  469  TDDS--GQTDTEVVYDILREVDTDKDGRISYEEFVAMMKAGTDW  510



>ref|XP_008619593.1| hypothetical protein, variant [Saprolegnia diclina VS20]
 gb|EQC26992.1| hypothetical protein, variant [Saprolegnia diclina VS20]
Length=1314

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 49/165 (30%), Positives = 82/165 (50%), Gaps = 23/165 (14%)
 Frame = -2

Query  637  VFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFIVLLCL  458
            +F++FDED +G I  +E    L +L   V + +   +FR+CD D + +I   EF + L  
Sbjct  117  LFKRFDEDHSGLISVDEFLAMLPQLNISVSKPKGLRIFRACDKDGSGEIDLEEFKMALFA  176

Query  457  IYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHK---KDVVKAFN---D  296
            +      P+SG+T +       S+  +  +AF   D+NG G++ +    DVV+ FN   D
Sbjct  177  V-----DPTSGNTLQF----TPSSLLSPKDAFSLFDENGSGQIDELEFADVVEYFNINAD  227

Query  295  AFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFLFAFLDWVGIDGD  161
                EK         FK+ D D+SG I F +F   +L  + ++ +
Sbjct  228  DAKQEK--------LFKKYDKDKSGYIDFEEFRAMWLQCIDVEAE  264



>sp|P41210.1|CATR_ATRNU RecName: Full=Caltractin; AltName: Full=Centrin [Atriplex nummularia]
 prf||1906390A caltractin-like protein
Length=167

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 78/155 (50%), Gaps = 25/155 (16%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF 
Sbjct  25   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINQMIADVDKDGSGAIDFDEFC  84

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKD---VVKAF  302
             ++              T+KIG      T   +++AF  +D++ +GK+  +D   + K  
Sbjct  85   HMM--------------TAKIGE---RDTKEELMKAFRIIDQDNNGKISPEDIQRIAKEL  127

Query  301  NDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
             + F ++     +     +E D DR G+++  +FL
Sbjct  128  GENFTVKDIQDMI-----EEADRDRDGEVNVEEFL  157



>ref|XP_005099702.1| PREDICTED: uncharacterized protein LOC101861733 [Aplysia californica]
Length=493

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 74/153 (48%), Gaps = 13/153 (8%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EIR  F  FD+D NG I   EL+  +  L   + +EE++E+ R  D D + ++ ++EF+
Sbjct  48   EEIREAFRVFDKDGNGFISAAELRHVMSNLGEKLTDEEVEEMIREADSDGDGQVNYDEFV  107

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA  293
             ++       D P++         + E       EAF   DK+GDG +  K++       
Sbjct  108  QMMS--QKTDDIPTA-------DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMR--  156

Query  292  FPLEKSPSHVT-RTRFKEMDWDRSGKISFRKFL  197
              L ++P+    +    E+D D +G I F +FL
Sbjct  157  -SLGQNPTEAELQDMINEVDADGNGTIDFPEFL  188


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EIR  F  FD+D NG I   EL+  +  L   + +EE+DE+ R  D+D + ++ ++EF+
Sbjct  428  EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADLDGDGQVNYDEFV  487

Query  472  VLL  464
             ++
Sbjct  488  KMM  490



>gb|KJB71091.1| hypothetical protein B456_011G105500 [Gossypium raimondii]
Length=169

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 77/155 (50%), Gaps = 25/155 (16%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF+
Sbjct  27   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINQMIADVDKDGSGAIDFDEFV  86

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDV---VKAF  302
             ++              T+KIG      T   +++AF  +D++ +GK+   DV    K  
Sbjct  87   HMM--------------TAKIGER---DTKEELMKAFQIIDQDNNGKISADDVKRIAKEL  129

Query  301  NDAFPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
             + F  EK    +     +E D D  G++S  +F+
Sbjct  130  GEHFS-EKDIQDM----IEEADRDHDGEVSIEEFM  159



>ref|XP_010674374.1| PREDICTED: caltractin isoform X2 [Beta vulgaris subsp. vulgaris]
Length=167

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 75/152 (49%), Gaps = 19/152 (13%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF 
Sbjct  25   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINQMIADVDKDGSGAIDFDEFC  84

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA  293
             ++              T+KIG      T   +++AF  +D++ +GK+   D+ +   D 
Sbjct  85   HMM--------------TAKIGE---RDTKEELMKAFRIIDQDNNGKISPADIQRIAKDL  127

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
               E       +   +E D DR G+++  +FL
Sbjct  128  G--ENFTDRDIQEMIEEADRDRDGEVNVEEFL  157



>ref|XP_010674373.1| PREDICTED: caltractin isoform X1 [Beta vulgaris subsp. vulgaris]
Length=168

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 75/152 (49%), Gaps = 19/152 (13%)
 Frame = -2

Query  652  KEIRTVFEQFDEDSNGAIDREELKKCLQKLQFHVGEEEIDELFRSCDVDDNEKIKFNEFI  473
            +EI+  FE FD D +G ID +EL   ++ L F + EE+I+++    D D +  I F+EF 
Sbjct  26   QEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINQMIADVDKDGSGAIDFDEFC  85

Query  472  VLLCLIYLLMDAPSSGSTSKIGSPVVESTFNTIVEAFLFLDKNGDGKLHKKDVVKAFNDA  293
             ++              T+KIG      T   +++AF  +D++ +GK+   D+ +   D 
Sbjct  86   HMM--------------TAKIGE---RDTKEELMKAFRIIDQDNNGKISPADIQRIAKDL  128

Query  292  FPLEKSPSHVTRTRFKEMDWDRSGKISFRKFL  197
               E       +   +E D DR G+++  +FL
Sbjct  129  G--ENFTDRDIQEMIEEADRDRDGEVNVEEFL  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600