BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021D10

Length=742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010113097.1|  Eukaryotic initiation factor 4A-1                  330   3e-111   
gb|AAD20980.1|  translation initiation factor 4A2                       328   4e-110   Zea mays [maize]
ref|XP_009784285.1|  PREDICTED: eukaryotic initiation factor 4A-14      334   1e-109   Nicotiana sylvestris
sp|Q40467.1|IF414_TOBAC  RecName: Full=Eukaryotic initiation fact...    334   1e-109   Nicotiana tabacum [American tobacco]
ref|XP_004291063.1|  PREDICTED: eukaryotic initiation factor 4A-2       334   1e-109   Fragaria vesca subsp. vesca
ref|XP_009780782.1|  PREDICTED: eukaryotic initiation factor 4A-1...    334   1e-109   Nicotiana sylvestris
gb|AFC90091.1|  eukaryotic initiation factor 4A-14                      333   2e-109   Nicotiana benthamiana
ref|XP_004245077.1|  PREDICTED: eukaryotic initiation factor 4A-2       333   2e-109   Solanum lycopersicum
ref|XP_008220506.1|  PREDICTED: eukaryotic initiation factor 4A-1...    333   3e-109   Prunus mume [ume]
ref|XP_007222702.1|  hypothetical protein PRUPE_ppa006409mg             333   3e-109   Prunus persica
gb|AAO17729.1|  translation initition factor eIF4A                      324   3e-109   Apium graveolens Dulce Group [celery]
sp|Q40469.1|IF4A6_TOBAC  RecName: Full=Eukaryotic initiation fact...    327   4e-109   Nicotiana tabacum [American tobacco]
ref|XP_006453067.1|  hypothetical protein CICLE_v10008468mg             332   4e-109   Citrus clementina [clementine]
gb|KDO65152.1|  hypothetical protein CISIN_1g015129mg                   328   4e-109   Citrus sinensis [apfelsine]
ref|XP_008337727.1|  PREDICTED: eukaryotic initiation factor 4A-11      332   6e-109   Malus domestica [apple tree]
ref|XP_007202168.1|  hypothetical protein PRUPE_ppa006450mg             332   6e-109   Prunus persica
ref|XP_004253093.1|  PREDICTED: eukaryotic initiation factor 4A-2       332   7e-109   Solanum lycopersicum
ref|XP_002277703.1|  PREDICTED: eukaryotic initiation factor 4A-8       332   7e-109   Vitis vinifera
ref|XP_004253094.1|  PREDICTED: eukaryotic initiation factor 4A-2...    332   7e-109   Solanum lycopersicum
ref|XP_007012776.1|  Eukaryotic translation initiation factor 4A1...    332   7e-109   
ref|XP_006342504.1|  PREDICTED: eukaryotic initiation factor 4A-2...    332   9e-109   Solanum tuberosum [potatoes]
ref|XP_006342502.1|  PREDICTED: eukaryotic initiation factor 4A-2...    332   1e-108   Solanum tuberosum [potatoes]
ref|XP_011010150.1|  PREDICTED: eukaryotic initiation factor 4A-8       332   1e-108   Populus euphratica
ref|XP_002304104.1|  translation initiation factor 4A family protein    332   1e-108   
gb|EYU29343.1|  hypothetical protein MIMGU_mgv1a007274mg                331   1e-108   Erythranthe guttata [common monkey flower]
ref|XP_009604178.1|  PREDICTED: eukaryotic initiation factor 4A-6...    325   1e-108   Nicotiana tomentosiformis
emb|CDP08290.1|  unnamed protein product                                331   1e-108   Coffea canephora [robusta coffee]
ref|XP_010033764.1|  PREDICTED: eukaryotic initiation factor 4A-2...    331   1e-108   Eucalyptus grandis [rose gum]
ref|XP_009602748.1|  PREDICTED: eukaryotic initiation factor 4A-11      331   2e-108   Nicotiana tomentosiformis
gb|KDO65151.1|  hypothetical protein CISIN_1g015129mg                   330   2e-108   Citrus sinensis [apfelsine]
dbj|BAH20394.1|  AT3G13920                                              324   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009604758.1|  PREDICTED: eukaryotic initiation factor 4A-1...    331   2e-108   Nicotiana tomentosiformis
sp|P41382.1|IF410_TOBAC  RecName: Full=Eukaryotic initiation fact...    330   3e-108   Nicotiana tabacum [American tobacco]
sp|P41379.1|IF4A2_NICPL  RecName: Full=Eukaryotic initiation fact...    330   3e-108   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002278119.1|  PREDICTED: eukaryotic initiation factor 4A-11      330   3e-108   Vitis vinifera
ref|XP_009624937.1|  PREDICTED: eukaryotic initiation factor 4A-8...    330   3e-108   Nicotiana tomentosiformis
emb|CAN61608.1|  hypothetical protein VITISV_040122                     330   3e-108   Vitis vinifera
ref|XP_009372398.1|  PREDICTED: eukaryotic initiation factor 4A-8       330   4e-108   Pyrus x bretschneideri [bai li]
ref|XP_011100200.1|  PREDICTED: eukaryotic initiation factor 4A-14      330   4e-108   Sesamum indicum [beniseed]
ref|XP_004141688.1|  PREDICTED: eukaryotic initiation factor 4A-1...    330   4e-108   Cucumis sativus [cucumbers]
ref|XP_010322839.1|  PREDICTED: eukaryotic initiation factor 4A-8...    330   4e-108   Solanum lycopersicum
ref|XP_008392378.1|  PREDICTED: eukaryotic initiation factor 4A-8       330   4e-108   Malus domestica [apple tree]
ref|XP_010322836.1|  PREDICTED: eukaryotic initiation factor 4A-8...    330   4e-108   Solanum lycopersicum
ref|XP_009624936.1|  PREDICTED: eukaryotic initiation factor 4A-8...    330   4e-108   Nicotiana tomentosiformis
ref|XP_006357392.1|  PREDICTED: eukaryotic initiation factor 4A-8...    330   4e-108   
ref|XP_009798256.1|  PREDICTED: eukaryotic initiation factor 4A-8       330   4e-108   Nicotiana sylvestris
gb|AFW69337.1|  putative DEAD-box ATP-dependent RNA helicase fami...    330   5e-108   
ref|XP_010087709.1|  Eukaryotic initiation factor 4A-8                  330   5e-108   
gb|EYU29345.1|  hypothetical protein MIMGU_mgv1a007246mg                330   5e-108   Erythranthe guttata [common monkey flower]
gb|AFW75865.1|  putative DEAD-box ATP-dependent RNA helicase fami...    330   5e-108   
ref|XP_007215455.1|  hypothetical protein PRUPE_ppa006399mg             330   6e-108   Prunus persica
gb|ACN34609.1|  unknown                                                 330   6e-108   Zea mays [maize]
ref|XP_010501104.1|  PREDICTED: eukaryotic initiation factor 4A-1...    328   6e-108   Camelina sativa [gold-of-pleasure]
ref|XP_009389913.1|  PREDICTED: eukaryotic initiation factor 4A-11      330   6e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006426587.1|  hypothetical protein CICLE_v10025724mg             330   6e-108   
ref|XP_010533343.1|  PREDICTED: eukaryotic initiation factor 4A-1...    327   8e-108   Tarenaya hassleriana [spider flower]
ref|XP_011046150.1|  PREDICTED: eukaryotic initiation factor 4A-8...    329   9e-108   Populus euphratica
emb|CAC43286.1|  translation initiation factor eIF-4A1                  328   9e-108   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08220.1|  BnaA05g13990D                                          329   1e-107   Brassica napus [oilseed rape]
ref|XP_007024535.1|  Eukaryotic translation initiation factor 4A1...    329   1e-107   Theobroma cacao [chocolate]
ref|XP_003533770.1|  PREDICTED: eukaryotic initiation factor 4A-1...    329   1e-107   
ref|XP_008379513.1|  PREDICTED: eukaryotic initiation factor 4A-8       329   1e-107   Malus domestica [apple tree]
sp|Q40465.1|IF411_TOBAC  RecName: Full=Eukaryotic initiation fact...    329   1e-107   Nicotiana tabacum [American tobacco]
sp|P41381.1|IF4A8_TOBAC  RecName: Full=Eukaryotic initiation fact...    329   1e-107   Nicotiana tabacum [American tobacco]
ref|XP_008798133.1|  PREDICTED: eukaryotic initiation factor 4A-14      329   1e-107   Phoenix dactylifera
ref|XP_006338111.1|  PREDICTED: eukaryotic initiation factor 4A-1...    329   1e-107   Solanum tuberosum [potatoes]
ref|XP_010552227.1|  PREDICTED: eukaryotic initiation factor 4A-1       327   1e-107   Tarenaya hassleriana [spider flower]
emb|CBI27885.3|  unnamed protein product                                328   2e-107   Vitis vinifera
ref|XP_006338110.1|  PREDICTED: eukaryotic initiation factor 4A-1...    328   2e-107   
ref|XP_002521376.1|  dead box ATP-dependent RNA helicase, putative      328   2e-107   Ricinus communis
ref|XP_008447621.1|  PREDICTED: eukaryotic initiation factor 4A-8       328   2e-107   Cucumis melo [Oriental melon]
ref|XP_004303662.1|  PREDICTED: eukaryotic initiation factor 4A-8       328   2e-107   Fragaria vesca subsp. vesca
ref|XP_004146811.1|  PREDICTED: eukaryotic initiation factor 4A-8...    328   2e-107   Cucumis sativus [cucumbers]
gb|KJB70132.1|  hypothetical protein B456_011G063400                    328   2e-107   Gossypium raimondii
ref|XP_010501441.1|  PREDICTED: eukaryotic initiation factor 4A-1       328   2e-107   Camelina sativa [gold-of-pleasure]
ref|XP_007012323.1|  Eukaryotic translation initiation factor 4A1       328   2e-107   Theobroma cacao [chocolate]
gb|KDP33852.1|  hypothetical protein JCGZ_07423                         328   2e-107   Jatropha curcas
ref|NP_001105396.1|  translational initiation factor eIF-4A             328   2e-107   
ref|NP_001189885.1|  translational initiation factor 4A-1               328   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078148.1|  translational initiation factor 4A-1               328   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010915249.1|  PREDICTED: eukaryotic initiation factor 4A-8...    328   3e-107   Elaeis guineensis
sp|Q40468.1|IF415_TOBAC  RecName: Full=Eukaryotic initiation fact...    328   3e-107   Nicotiana tabacum [American tobacco]
ref|XP_006297793.1|  hypothetical protein CARUB_v10013828mg             328   3e-107   Capsella rubella
gb|KHN28839.1|  Eukaryotic initiation factor 4A-15                      328   3e-107   Glycine soja [wild soybean]
ref|XP_002438954.1|  hypothetical protein SORBIDRAFT_10g028940          328   3e-107   Sorghum bicolor [broomcorn]
ref|XP_010480021.1|  PREDICTED: eukaryotic initiation factor 4A-1...    328   3e-107   Camelina sativa [gold-of-pleasure]
dbj|BAE98559.1|  eukaryotic protein synthesis initiation factor 4A      328   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566469.1|  translational initiation factor 4A-1                  328   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392695.1|  hypothetical protein EUTSA_v10011528mg             328   3e-107   Eutrema salsugineum [saltwater cress]
gb|AAL91176.1|  eukaryotic translation initiation factor                328   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307670.1|  hypothetical protein CARUB_v10009297mg             328   3e-107   Capsella rubella
gb|KJB56903.1|  hypothetical protein B456_009G142800                    328   3e-107   Gossypium raimondii
ref|NP_001242064.1|  uncharacterized protein LOC100786735               328   4e-107   Glycine max [soybeans]
ref|XP_009764703.1|  PREDICTED: eukaryotic initiation factor 4A-1...    328   4e-107   Nicotiana sylvestris
ref|XP_010929386.1|  PREDICTED: eukaryotic initiation factor 4A-2       327   4e-107   Elaeis guineensis
ref|XP_009597977.1|  PREDICTED: eukaryotic initiation factor 4A-15      327   4e-107   Nicotiana tomentosiformis
ref|XP_010462344.1|  PREDICTED: eukaryotic initiation factor 4A-1...    327   4e-107   
ref|XP_008801403.1|  PREDICTED: eukaryotic initiation factor 4A-15      327   5e-107   Phoenix dactylifera
ref|XP_011081667.1|  PREDICTED: eukaryotic initiation factor 4A-2       327   5e-107   Sesamum indicum [beniseed]
ref|XP_010534921.1|  PREDICTED: eukaryotic initiation factor 4A-1       327   5e-107   Tarenaya hassleriana [spider flower]
ref|XP_009135344.1|  PREDICTED: eukaryotic initiation factor 4A-1...    327   5e-107   Brassica rapa
ref|XP_009106914.1|  PREDICTED: eukaryotic initiation factor 4A-1...    327   5e-107   Brassica rapa
ref|XP_003522265.1|  PREDICTED: eukaryotic initiation factor 4A-11      327   5e-107   Glycine max [soybeans]
emb|CDY10607.1|  BnaC03g70070D                                          327   5e-107   Brassica napus [oilseed rape]
ref|XP_009764706.1|  PREDICTED: eukaryotic initiation factor 4A-6...    326   5e-107   Nicotiana sylvestris
emb|CDY02469.1|  BnaA08g00760D                                          327   5e-107   
ref|XP_002891805.1|  predicted protein                                  327   6e-107   Arabidopsis lyrata subsp. lyrata
emb|CDY39079.1|  BnaA01g29770D                                          327   6e-107   Brassica napus [oilseed rape]
ref|XP_006407149.1|  hypothetical protein EUTSA_v10020824mg             327   6e-107   
ref|XP_009117360.1|  PREDICTED: eukaryotic initiation factor 4A-1...    327   6e-107   Brassica rapa
ref|XP_009334736.1|  PREDICTED: eukaryotic initiation factor 4A-6...    327   6e-107   
ref|XP_009334735.1|  PREDICTED: eukaryotic initiation factor 4A-6...    327   7e-107   
ref|XP_002884997.1|  predicted protein                                  327   7e-107   Arabidopsis lyrata subsp. lyrata
ref|XP_009334733.1|  PREDICTED: eukaryotic initiation factor 4A-1...    327   7e-107   
ref|XP_009334732.1|  PREDICTED: eukaryotic initiation factor 4A-6...    327   7e-107   
gb|KJB34989.1|  hypothetical protein B456_006G095400                    327   7e-107   Gossypium raimondii
ref|XP_010062659.1|  PREDICTED: eukaryotic initiation factor 4A-1...    327   7e-107   Eucalyptus grandis [rose gum]
ref|XP_008462340.1|  PREDICTED: eukaryotic initiation factor 4A-11      327   7e-107   Cucumis melo [Oriental melon]
ref|XP_009334734.1|  PREDICTED: eukaryotic initiation factor 4A-1...    327   8e-107   
ref|XP_009604756.1|  PREDICTED: eukaryotic initiation factor 4A-7       327   8e-107   Nicotiana tomentosiformis
ref|XP_003526019.1|  PREDICTED: eukaryotic initiation factor 4A-11      327   8e-107   Glycine max [soybeans]
ref|XP_010929385.1|  PREDICTED: eukaryotic initiation factor 4A-15      327   8e-107   Elaeis guineensis
ref|XP_009415521.1|  PREDICTED: eukaryotic initiation factor 4A-15      327   8e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006369263.1|  hypothetical protein POPTR_0001s20480g             327   9e-107   
gb|AAN74635.1|  DEAD box RNA helicase                                   327   9e-107   Pisum sativum [garden pea]
ref|XP_004951905.1|  PREDICTED: eukaryotic initiation factor 4A-like    327   9e-107   Setaria italica
ref|XP_010242273.1|  PREDICTED: eukaryotic initiation factor 4A-11      327   1e-106   Nelumbo nucifera [Indian lotus]
ref|XP_008782542.1|  PREDICTED: eukaryotic initiation factor 4A-1...    327   1e-106   Phoenix dactylifera
ref|XP_004966111.1|  PREDICTED: eukaryotic initiation factor 4A-3...    327   1e-106   Setaria italica
gb|AFK46989.1|  unknown                                                 320   1e-106   Lotus japonicus
ref|NP_001104874.1|  translation initiation factor                      326   1e-106   Zea mays [maize]
dbj|BAJ96964.1|  predicted protein                                      326   1e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89461.1|  predicted protein                                      326   1e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003574572.1|  PREDICTED: eukaryotic initiation factor 4A-1...    326   1e-106   Brachypodium distachyon [annual false brome]
ref|XP_009399791.1|  PREDICTED: eukaryotic initiation factor 4A-8       326   1e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011038130.1|  PREDICTED: eukaryotic initiation factor 4A-15      326   1e-106   Populus euphratica
ref|XP_003563508.1|  PREDICTED: eukaryotic initiation factor 4A         326   1e-106   Brachypodium distachyon [annual false brome]
ref|NP_001151064.1|  LOC100284697                                       326   1e-106   Zea mays [maize]
ref|NP_001058481.1|  Os06g0701100                                       326   1e-106   
ref|XP_009107078.1|  PREDICTED: eukaryotic initiation factor 4A-1       326   1e-106   Brassica rapa
ref|XP_006656443.1|  PREDICTED: eukaryotic initiation factor 4A-1...    326   2e-106   Oryza brachyantha
ref|XP_010542416.1|  PREDICTED: eukaryotic initiation factor 4A-1       326   2e-106   Tarenaya hassleriana [spider flower]
ref|XP_002324737.1|  translation initiation factor eIF-4A family ...    326   2e-106   Populus trichocarpa [western balsam poplar]
gb|EMS68416.1|  Eukaryotic initiation factor 4A-1                       326   2e-106   Triticum urartu
ref|XP_004513437.1|  PREDICTED: eukaryotic initiation factor 4A-1...    326   2e-106   
sp|Q40470.1|IF4A7_TOBAC  RecName: Full=Eukaryotic initiation fact...    326   2e-106   Nicotiana tabacum [American tobacco]
sp|Q40471.1|IF4A9_TOBAC  RecName: Full=Eukaryotic initiation fact...    326   2e-106   Nicotiana tabacum [American tobacco]
ref|XP_010927213.1|  PREDICTED: eukaryotic initiation factor 4A-2...    326   2e-106   Elaeis guineensis
ref|XP_009757031.1|  PREDICTED: eukaryotic initiation factor 4A-9       326   2e-106   Nicotiana sylvestris
ref|XP_002451536.1|  hypothetical protein SORBIDRAFT_04g003390          326   2e-106   Sorghum bicolor [broomcorn]
gb|AAF19805.1|  EIF4A protein                                           324   2e-106   Brassica oleracea
ref|XP_009385793.1|  PREDICTED: eukaryotic initiation factor 4A-1...    326   2e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM63951.1|  Eukaryotic initiation factor 4A, putative               326   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927212.1|  PREDICTED: eukaryotic initiation factor 4A-1...    326   2e-106   Elaeis guineensis
ref|XP_010049453.1|  PREDICTED: eukaryotic initiation factor 4A-15      326   2e-106   
ref|XP_007154632.1|  hypothetical protein PHAVU_003G134800g             326   2e-106   Phaseolus vulgaris [French bean]
ref|XP_006597014.1|  PREDICTED: uncharacterized protein LOC100786...    327   3e-106   
ref|XP_011019413.1|  PREDICTED: eukaryotic initiation factor 4A-9...    325   3e-106   Populus euphratica
ref|XP_002308545.1|  translation initiation factor eIF-4A family ...    325   3e-106   Populus trichocarpa [western balsam poplar]
ref|NP_001045878.1|  Os02g0146600                                       325   3e-106   
ref|XP_008798130.1|  PREDICTED: eukaryotic initiation factor 4A-8...    325   3e-106   Phoenix dactylifera
ref|XP_010925445.1|  PREDICTED: eukaryotic initiation factor 4A-8...    325   3e-106   Elaeis guineensis
gb|AAK74073.1|  eukaryotic translation initiation factor 4A-1           316   3e-106   Elaeis oleifera
gb|AFC88837.1|  initiation factor 4A-3-like protein                     324   4e-106   Miscanthus sinensis
dbj|BAJ85348.1|  predicted protein                                      325   4e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIZ68204.1|  eukaryotic initiation factor 4A-14                      325   5e-106   Ornithogalum longebracteatum [sea-onion]
ref|XP_007136846.1|  hypothetical protein PHAVU_009G079100g             325   5e-106   Phaseolus vulgaris [French bean]
emb|CDP03140.1|  unnamed protein product                                325   5e-106   Coffea canephora [robusta coffee]
ref|XP_009146433.1|  PREDICTED: eukaryotic initiation factor 4A-1...    325   5e-106   Brassica rapa
ref|XP_003595233.1|  Eukaryotic initiation factor 4A                    325   6e-106   Medicago truncatula
ref|XP_006646878.1|  PREDICTED: eukaryotic initiation factor 4A-3...    325   6e-106   Oryza brachyantha
gb|KHN17683.1|  Eukaryotic initiation factor 4A-15                      324   7e-106   Glycine soja [wild soybean]
ref|XP_007138709.1|  hypothetical protein PHAVU_009G230600g             324   7e-106   Phaseolus vulgaris [French bean]
ref|XP_009127949.1|  PREDICTED: eukaryotic initiation factor 4A-3...    324   7e-106   Brassica rapa
ref|XP_010536184.1|  PREDICTED: eukaryotic initiation factor 4A-9...    324   7e-106   Tarenaya hassleriana [spider flower]
ref|XP_009127948.1|  PREDICTED: eukaryotic initiation factor 4A-3...    324   9e-106   Brassica rapa
gb|ACJ84921.1|  unknown                                                 324   1e-105   Medicago truncatula
ref|XP_006390626.1|  hypothetical protein EUTSA_v10018626mg             324   1e-105   Eutrema salsugineum [saltwater cress]
gb|KJB54655.1|  hypothetical protein B456_009G043400                    324   1e-105   Gossypium raimondii
dbj|BAH20352.1|  AT1G54270                                              321   1e-105   Arabidopsis thaliana [mouse-ear cress]
sp|P41378.1|IF4A_WHEAT  RecName: Full=Eukaryotic initiation facto...    323   1e-105   Triticum aestivum [Canadian hard winter wheat]
gb|ABK93239.1|  unknown                                                 323   2e-105   Populus trichocarpa [western balsam poplar]
ref|XP_008793233.1|  PREDICTED: eukaryotic initiation factor 4A-1...    323   2e-105   Phoenix dactylifera
ref|XP_011079970.1|  PREDICTED: eukaryotic initiation factor 4A-8       323   2e-105   Sesamum indicum [beniseed]
ref|XP_006302320.1|  hypothetical protein CARUB_v10020373mg             323   2e-105   Capsella rubella
gb|EPS63850.1|  hypothetical protein M569_10933                         323   2e-105   Genlisea aurea
emb|CDY49861.1|  BnaA02g16100D                                          323   2e-105   Brassica napus [oilseed rape]
ref|NP_001185220.1|  eukaryotic initiation factor 4A-2                  323   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175829.1|  eukaryotic initiation factor 4A-2                     323   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006853908.1|  hypothetical protein AMTR_s00036p00181640          323   3e-105   Amborella trichopoda
ref|XP_010688701.1|  PREDICTED: eukaryotic initiation factor 4A-9...    323   3e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006453066.1|  hypothetical protein CICLE_v10008460mg             323   3e-105   Citrus clementina [clementine]
ref|XP_006474427.1|  PREDICTED: eukaryotic initiation factor 4A-9...    323   3e-105   Citrus sinensis [apfelsine]
sp|Q41741.1|IF4A_MAIZE  RecName: Full=Eukaryotic initiation facto...    322   4e-105   Zea mays [maize]
ref|XP_010416036.1|  PREDICTED: eukaryotic initiation factor 4A-3       322   4e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010669372.1|  PREDICTED: eukaryotic initiation factor 4A-9       322   4e-105   Beta vulgaris subsp. vulgaris [field beet]
emb|CDO97887.1|  unnamed protein product                                322   5e-105   Coffea canephora [robusta coffee]
gb|AAR23806.1|  initiation factor eIF4A-15                              322   6e-105   Helianthus annuus
ref|XP_009105938.1|  PREDICTED: eukaryotic initiation factor 4A-3       322   7e-105   Brassica rapa
ref|XP_008242400.1|  PREDICTED: eukaryotic initiation factor 4A-2       333   9e-105   
ref|XP_007135520.1|  hypothetical protein PHAVU_010G136300g             322   9e-105   Phaseolus vulgaris [French bean]
ref|XP_002888890.1|  predicted protein                                  322   9e-105   Arabidopsis lyrata subsp. lyrata
ref|XP_003627168.1|  Eukaryotic initiation factor 4A                    321   1e-104   Medicago truncatula
gb|ACU21478.1|  unknown                                                 321   1e-104   Glycine max [soybeans]
gb|KHN06630.1|  Eukaryotic initiation factor 4A-15                      321   1e-104   Glycine soja [wild soybean]
ref|NP_177417.1|  eukaryotic initiation factor 4A-3                     321   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531602.1|  PREDICTED: eukaryotic initiation factor 4A-10      321   1e-104   Glycine max [soybeans]
ref|XP_004510408.1|  PREDICTED: eukaryotic initiation factor 4A-1...    321   1e-104   Cicer arietinum [garbanzo]
ref|XP_007012324.1|  Eukaryotic translation initiation factor 4A1       321   2e-104   Theobroma cacao [chocolate]
gb|KEH39505.1|  DEAD-box ATP-dependent RNA helicase                     320   2e-104   Medicago truncatula
ref|XP_011072546.1|  PREDICTED: eukaryotic initiation factor 4A-8...    321   2e-104   Sesamum indicum [beniseed]
ref|XP_003597562.1|  Eukaryotic initiation factor 4A                    321   2e-104   Medicago truncatula
gb|ABR18348.1|  unknown                                                 320   2e-104   Picea sitchensis
emb|CAA09211.1|  RNA helicase                                           321   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150491.1|  hypothetical protein PHAVU_005G157100g             320   4e-104   Phaseolus vulgaris [French bean]
ref|XP_006583001.1|  PREDICTED: eukaryotic initiation factor 4A-10      320   5e-104   Glycine max [soybeans]
ref|XP_001758216.1|  predicted protein                                  320   5e-104   
dbj|BAA02152.1|  eukaryotic initiation factor 4A                        320   5e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001783934.1|  predicted protein                                  320   5e-104   
ref|XP_009361722.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    332   6e-104   
gb|KHN39326.1|  Eukaryotic initiation factor 4A-10                      319   7e-104   Glycine soja [wild soybean]
ref|XP_002514133.1|  dead box ATP-dependent RNA helicase, putative      329   8e-104   
ref|XP_001765568.1|  predicted protein                                  319   8e-104   
gb|EYU21355.1|  hypothetical protein MIMGU_mgv1a0072631mg               319   9e-104   Erythranthe guttata [common monkey flower]
gb|EAZ02256.1|  hypothetical protein OsI_24355                          319   1e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_004486853.1|  PREDICTED: eukaryotic initiation factor 4A-1...    319   1e-103   Cicer arietinum [garbanzo]
gb|AFK44355.1|  unknown                                                 314   1e-103   Medicago truncatula
gb|KHN30068.1|  Eukaryotic initiation factor 4A-10                      318   1e-103   Glycine soja [wild soybean]
gb|KHN32709.1|  Eukaryotic initiation factor 4A-10                      318   1e-103   Glycine soja [wild soybean]
ref|XP_003543580.1|  PREDICTED: eukaryotic initiation factor 4A-1...    318   1e-103   Glycine max [soybeans]
ref|XP_001691452.1|  eukaryotic initiation factor 4A-like protein       318   1e-103   Chlamydomonas reinhardtii
gb|AFK40852.1|  unknown                                                 318   1e-103   Lotus japonicus
gb|AAY33860.1|  eukaryotic initiation factor 4A                         318   2e-103   Cenchrus americanus [bulrush millet]
gb|ACJ84369.1|  unknown                                                 312   2e-103   Medicago truncatula
ref|XP_001771324.1|  predicted protein                                  318   2e-103   
ref|XP_009403035.1|  PREDICTED: eukaryotic initiation factor 4A-1...    317   4e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH32495.1|  DEAD-box ATP-dependent RNA helicase                     317   4e-103   Medicago truncatula
gb|EYU45869.1|  hypothetical protein MIMGU_mgv1a007331mg                317   4e-103   Erythranthe guttata [common monkey flower]
gb|KEH32494.1|  DEAD-box ATP-dependent RNA helicase                     317   8e-103   Medicago truncatula
ref|XP_002982302.1|  hypothetical protein SELMODRAFT_228839             316   1e-102   
ref|XP_002966232.1|  hypothetical protein SELMODRAFT_143895             316   1e-102   Selaginella moellendorffii
ref|XP_010656491.1|  PREDICTED: uncharacterized protein LOC100244028    328   1e-102   Vitis vinifera
gb|AAN74636.1|  DEAD box RNA helicase                                   316   1e-102   Pisum sativum [garden pea]
gb|ACN40838.1|  unknown                                                 315   3e-102   Picea sitchensis
ref|XP_006858971.1|  hypothetical protein AMTR_s00068p00116790          310   4e-102   
ref|XP_009381599.1|  PREDICTED: eukaryotic initiation factor 4A-9...    314   6e-102   Musa acuminata subsp. malaccensis [pisang utan]
gb|KIZ04417.1|  Eukaryotic initiation factor 4A-3                       315   7e-102   Monoraphidium neglectum
emb|CDY32586.1|  BnaC03g15540D                                          312   1e-101   Brassica napus [oilseed rape]
gb|EPS65096.1|  hypothetical protein M569_09681                         313   1e-101   Genlisea aurea
gb|ABR16834.1|  unknown                                                 309   1e-101   Picea sitchensis
ref|XP_009132534.1|  PREDICTED: eukaryotic initiation factor 4A-1...    313   2e-101   Brassica rapa
ref|XP_006357714.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic i...    313   2e-101   
gb|ACN40422.1|  unknown                                                 313   3e-101   Picea sitchensis
ref|XP_005644820.1|  eukaryotic initiation factor 4A-like protein       312   4e-101   Coccomyxa subellipsoidea C-169
ref|XP_011470735.1|  PREDICTED: eukaryotic initiation factor 4A-9       323   6e-101   Fragaria vesca subsp. vesca
ref|XP_006601410.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    323   1e-100   
ref|XP_002499673.1|  hypothetical protein MICPUN_106753                 311   1e-100   Micromonas commoda
ref|XP_002966250.1|  hypothetical protein SELMODRAFT_85554              311   1e-100   
gb|ACN40356.1|  unknown                                                 310   2e-100   Picea sitchensis
ref|XP_010262239.1|  PREDICTED: uncharacterized protein LOC104600806    323   3e-100   
ref|XP_009410226.1|  PREDICTED: eukaryotic initiation factor 4A-9...    310   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006595337.1|  PREDICTED: eukaryotic initiation factor 4A-14      320   6e-100   
ref|XP_010090077.1|  Eukaryotic initiation factor 4A-15                 320   2e-99    
ref|XP_003058151.1|  predicted protein                                  307   3e-99    Micromonas pusilla CCMP1545
ref|XP_002951303.1|  hypothetical protein VOLCADRAFT_120953             307   3e-99    Volvox carteri f. nagariensis
ref|XP_004508240.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    319   6e-99    
ref|XP_005845171.1|  eukaryotic initiation factor 4A (ATP-depende...    306   1e-98    Chlorella variabilis
gb|AFO68181.1|  eukaryotic initiation factor 4A                         296   2e-98    Anthurium andraeanum [flamingo-lily]
emb|CDY33073.1|  BnaC06g07060D                                          305   2e-98    Brassica napus [oilseed rape]
emb|CAN70196.1|  hypothetical protein VITISV_040309                     305   2e-98    Vitis vinifera
ref|XP_009779503.1|  PREDICTED: eukaryotic initiation factor 4A-9...    305   2e-98    Nicotiana sylvestris
ref|XP_009147530.1|  PREDICTED: eukaryotic initiation factor 4A-1       305   3e-98    Brassica rapa
emb|CDY24057.1|  BnaA06g00550D                                          305   3e-98    Brassica napus [oilseed rape]
emb|CEF98795.1|  Helicase, C-terminal                                   304   5e-98    Ostreococcus tauri
ref|XP_007513631.1|  predicted protein                                  304   6e-98    Bathycoccus prasinos
ref|XP_001418972.1|  predicted protein                                  304   6e-98    Ostreococcus lucimarinus CCE9901
ref|XP_010324046.1|  PREDICTED: eukaryotic initiation factor 4A-9...    304   7e-98    Solanum lycopersicum
gb|KDD74664.1|  DEAD/DEAH box helicase                                  303   2e-97    Helicosporidium sp. ATCC 50920
gb|ABA01152.1|  eukaryotic translation initiation factor                289   9e-96    Chlamydomonas incerta
dbj|BAB21258.1|  eukaryotic initiation factor 4A                        296   4e-95    
gb|KDP40743.1|  hypothetical protein JCGZ_24742                         296   5e-95    
ref|XP_011398174.1|  Eukaryotic initiation factor 4A-10                 296   5e-95    
ref|XP_008377701.1|  PREDICTED: eukaryotic initiation factor 4A-1...    295   2e-94    
dbj|BAH56988.1|  AT3G13920                                              292   2e-93    
gb|KJB65515.1|  hypothetical protein B456_010G098500                    291   2e-93    
gb|KJB65513.1|  hypothetical protein B456_010G098500                    291   1e-92    
emb|CDY55205.1|  BnaCnng28430D                                          286   5e-91    
ref|XP_007024536.1|  Eukaryotic translation initiation factor 4A1...    282   6e-91    
ref|NP_001030693.1|  translational initiation factor 4A-1               285   1e-90    
ref|XP_007024537.1|  Eukaryotic translation initiation factor 4A1...    282   2e-90    
emb|CDX97528.1|  BnaA05g25510D                                          285   2e-90    
emb|CDX82505.1|  BnaA03g33160D                                          284   5e-90    
emb|CDX75739.1|  BnaC03g38220D                                          284   8e-90    
ref|XP_010422963.1|  PREDICTED: eukaryotic initiation factor 4A-6...    275   3e-89    
gb|ACJ85073.1|  unknown                                                 278   2e-88    
ref|XP_002116186.1|  conserved hypothetical protein                     271   9e-88    
ref|XP_002524306.1|  dead box ATP-dependent RNA helicase, putative      275   1e-86    
gb|AGF69177.1|  eukaryotic initiation factor 4A-like protein            270   1e-86    
emb|CAA73168.1|  translation initiation factor eIF4A II                 274   4e-86    
ref|XP_005367981.1|  PREDICTED: eukaryotic initiation factor 4A-I...    268   1e-85    
emb|CCI41478.1|  unnamed protein product                                273   1e-85    
ref|XP_009036016.1|  hypothetical protein AURANDRAFT_70153              268   2e-85    
ref|XP_005834643.1|  hypothetical protein GUITHDRAFT_159541             269   3e-84    
ref|XP_004402364.1|  PREDICTED: eukaryotic initiation factor 4A-I...    268   3e-84    
ref|XP_010490377.1|  PREDICTED: eukaryotic initiation factor 4A-6...    264   4e-84    
emb|CCA22814.1|  predicted protein putative                             268   4e-84    
ref|XP_002997444.1|  ATP-dependent RNA helicase eIF4A, putative         268   4e-84    
ref|XP_008914162.1|  ATP-dependent RNA helicase eIF4A                   268   4e-84    
ref|XP_008605124.1|  ATP-dependent RNA helicase eIF4A                   268   6e-84    
emb|CCA22812.1|  predicted protein putative                             269   1e-83    
emb|CCA22813.1|  predicted protein putative                             269   1e-83    
ref|XP_008876208.1|  ATP-dependent RNA helicase eIF4A                   267   2e-83    
ref|XP_009825545.1|  ATP-dependent RNA helicase eIF4A                   266   4e-83    
emb|CBJ30606.1|  eukaryotic initiation factor 4A                        265   5e-83    
gb|EWM22954.1|  eukaryotic initiation factor 4a                         265   1e-82    
ref|XP_009517402.1|  hypothetical protein PHYSODRAFT_358814             269   2e-82    
ref|XP_002186399.1|  predicted protein                                  264   3e-82    
ref|XP_004629607.1|  PREDICTED: eukaryotic initiation factor 4A-I...    261   4e-82    
ref|XP_002293690.1|  eukaryotic translation initiation factor 4A        261   8e-82    
ref|XP_008268024.1|  PREDICTED: eukaryotic initiation factor 4A-I...    259   9e-82    
ref|XP_001952053.1|  PREDICTED: eukaryotic initiation factor 4A         262   1e-81    
gb|EJK47731.1|  hypothetical protein THAOC_33528                        261   1e-80    
emb|CDP92497.1|  Protein Bm13696, isoform c                             258   3e-80    
ref|XP_003966803.1|  PREDICTED: eukaryotic initiation factor 4A-I...    258   3e-80    
gb|EHB13760.1|  Eukaryotic initiation factor 4A-II                      251   4e-80    
dbj|BAN65202.1|  eukaryotic translation initiation factor 4A, put...    251   5e-80    
ref|XP_003137738.1|  hypothetical protein LOAG_02152                    256   2e-79    
gb|KIH55792.1|  helicase protein                                        249   2e-79    
ref|XP_002758206.2|  PREDICTED: eukaryotic initiation factor 4A-II      248   3e-79    
ref|XP_002424727.1|  eukaryotic initiation factor 4A-II, putative       257   4e-79    
ref|XP_005714120.1|  Translation initiation factor eIF4, subunit A      255   8e-79    
dbj|BAB46863.1|  hypothetical protein                                   249   8e-79    
gb|ETN68655.1|  helicase protein                                        249   1e-78    
ref|XP_003886231.1|  DEAD-box ATP-dependent RNA helicase 34, related    254   2e-78    
ref|XP_008888515.1|  eukaryotic initiation factor-4A, putative          254   2e-78    
ref|XP_002367359.1|  eukaryotic translation initiation factor 4A        254   2e-78    
gb|KHN88002.1|  Eukaryotic initiation factor 4A                         254   2e-78    
ref|XP_004647191.1|  PREDICTED: eukaryotic initiation factor 4A-I...    251   2e-78    
emb|CCF72996.1|  unnamed protein product                                254   2e-78    
ref|XP_005989463.1|  PREDICTED: eukaryotic initiation factor 4A-I...    253   3e-78    
ref|XP_005163337.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   3e-78    
ref|XP_005989464.1|  PREDICTED: eukaryotic initiation factor 4A-I...    252   4e-78    
ref|XP_005989462.1|  PREDICTED: eukaryotic initiation factor 4A-I...    253   5e-78    
ref|XP_006279086.1|  hypothetical protein CARUB_v10012714mg             253   5e-78    
gb|ERZ98750.1|  hypothetical protein GLOINDRAFT_339458                  252   6e-78    
ref|XP_004599876.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   7e-78    
ref|XP_004899728.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   8e-78    
ref|XP_008821869.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   8e-78    
ref|XP_005006926.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   8e-78    
ref|XP_003508263.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   8e-78    
dbj|BAG60234.1|  unnamed protein product                                246   9e-78    
ref|NP_001116509.1|  eukaryotic initiation factor 4A-II isoform b       249   1e-77    
ref|XP_001869798.1|  DEAD box ATP-dependent RNA helicase                246   1e-77    
ref|XP_006171517.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   1e-77    
dbj|BAK62365.1|  eukaryotic initiation factor 4A-II                     249   1e-77    
ref|XP_011484696.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   1e-77    
gb|ELV09446.1|  Eukaryotic initiation factor 4A-II                      249   1e-77    
ref|XP_006460368.1|  hypothetical protein AGABI2DRAFT_192108            251   1e-77    
gb|AAF64266.1|AF208852_1  BM-010                                        248   1e-77    
ref|XP_004473758.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   1e-77    
ref|XP_006985125.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   1e-77    
gb|KHJ83614.1|  putative eukaryotic initiation factor 4A-III            248   1e-77    
ref|XP_009922828.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-77    
ref|XP_005331053.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-77    
emb|CCX09205.1|  Similar to eukaryotic translation initiation fac...    251   2e-77    
dbj|BAN64713.1|  eukaryotic translation initiation factor 4A, put...    251   2e-77    
gb|EYB84561.1|  hypothetical protein Y032_0314g2232                     250   2e-77    
ref|XP_001612149.1|  eukaryotic translation initiation factor 4A        251   2e-77    
ref|XP_006069518.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-77    
emb|CCX34983.1|  eukaryotic translation initiation factor 4aIII         244   3e-77    
gb|EYB84565.1|  hypothetical protein Y032_0314g2232                     250   3e-77    
ref|XP_005708863.1|  ATP-dependent RNA helicase DEAD                    251   3e-77    
gb|EYB84563.1|  hypothetical protein Y032_0314g2232                     250   4e-77    
gb|KFM75183.1|  Eukaryotic initiation factor 4A-I                       251   4e-77    
emb|CAF97552.1|  unnamed protein product                                249   4e-77    
emb|CDQ62034.1|  unnamed protein product                                247   4e-77    
ref|XP_007861849.1|  DEAD-domain-containing protein                     250   5e-77    
dbj|BAE87228.1|  unnamed protein product                                245   5e-77    
ref|XP_003390551.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   5e-77    
gb|EYB84562.1|  hypothetical protein Y032_0314g2232                     249   6e-77    
gb|KIM68898.1|  hypothetical protein SCLCIDRAFT_1209115                 249   6e-77    
gb|KIK67836.1|  hypothetical protein GYMLUDRAFT_81358                   249   6e-77    
ref|XP_003766125.1|  PREDICTED: eukaryotic initiation factor 4A-II      249   6e-77    
emb|CCM05551.1|  predicted protein                                      249   6e-77    
ref|XP_006262091.1|  PREDICTED: eukaryotic initiation factor 4A-II      249   6e-77    
gb|KIL70221.1|  hypothetical protein M378DRAFT_156297                   249   7e-77    
ref|XP_003975803.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   7e-77    
gb|KIO12610.1|  hypothetical protein M404DRAFT_959197                   249   7e-77    
gb|EKV10824.1|  Eukaryotic translation initiation factor eIF-4A s...    249   7e-77    
gb|KIP10664.1|  hypothetical protein PHLGIDRAFT_18229                   249   8e-77    
gb|EPS34941.1|  hypothetical protein PDE_09906                          249   8e-77    
sp|Q2UAK1.1|FAL1_ASPOR  RecName: Full=ATP-dependent RNA helicase ...    249   8e-77    
gb|ELK28651.1|  Eukaryotic initiation factor 4A-II                      249   8e-77    
gb|KHJ87921.1|  eukaryotic initiation factor 4A-III                     248   9e-77    
gb|EMD40918.1|  hypothetical protein CERSUDRAFT_111502                  249   9e-77    
ref|NP_998616.2|  eukaryotic initiation factor 4A-II                    249   9e-77    
ref|XP_010395597.1|  PREDICTED: eukaryotic initiation factor 4A-II      249   9e-77    
ref|XP_007391832.1|  hypothetical protein PHACADRAFT_113708             249   1e-76    
gb|EJU06331.1|  DEAD-domain-containing protein                          249   1e-76    
ref|XP_005331052.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   1e-76    
gb|EYB84564.1|  hypothetical protein Y032_0314g2232                     249   1e-76    
ref|XP_009074201.1|  PREDICTED: eukaryotic initiation factor 4A-II      249   1e-76    
gb|EYE92852.1|  eukaryotic initiation factor 4A-12                      249   1e-76    
ref|XP_007250744.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   1e-76    
ref|XP_007071060.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   1e-76    
ref|XP_681285.1|  hypothetical protein AN8016.2                         249   1e-76    
ref|XP_005506650.1|  PREDICTED: eukaryotic initiation factor 4A-II      249   1e-76    
ref|XP_001276289.1|  eukaryotic translation initiation factor eIF...    249   1e-76    
ref|XP_001217828.1|  eukaryotic initiation factor 4A-12                 249   1e-76    
ref|XP_002147618.1|  eukaryotic translation initiation factor eIF...    245   1e-76    
sp|Q4WEB4.2|FAL1_ASPFU  RecName: Full=ATP-dependent RNA helicase ...    249   1e-76    
emb|CDO76554.1|  hypothetical protein BN946_scf184982.g13               249   1e-76    
ref|XP_001266288.1|  eukaryotic translation initiation factor eIF...    249   1e-76    
ref|NP_001105848.1|  putative RH2 protein                               249   1e-76    
ref|XP_002382661.1|  eukaryotic translation initiation factor eIF...    249   1e-76    
ref|XP_008291140.1|  PREDICTED: eukaryotic initiation factor 4A-I       249   1e-76    
ref|XP_003055263.1|  predicted protein                                  248   1e-76    
ref|XP_002186364.1|  predicted protein                                  248   1e-76    
dbj|BAE31038.1|  unnamed protein product                                245   2e-76    
ref|XP_008035266.1|  DEAD-domain-containing protein                     248   2e-76    
gb|KDR83911.1|  hypothetical protein GALMADRAFT_236407                  248   2e-76    
gb|AAY86964.1|  eukaryotic translation initiation factor 4A             244   2e-76    
ref|XP_008332344.1|  PREDICTED: eukaryotic initiation factor 4A-II      249   2e-76    
gb|ACF98296.1|  eIF-4A                                                  249   2e-76    
ref|XP_004278520.1|  PREDICTED: eukaryotic initiation factor 4A-II      249   2e-76    
gb|EFB26304.1|  hypothetical protein PANDA_002799                       248   2e-76    
ref|XP_010732076.1|  PREDICTED: eukaryotic initiation factor 4A-II      249   2e-76    
gb|AFR97753.2|  ATP-dependent RNA helicase FAL1                         248   2e-76    
ref|XP_004312485.1|  PREDICTED: eukaryotic initiation factor 4A-I...    246   2e-76    
ref|XP_569893.1|  hypothetical protein                                  248   2e-76    
ref|XP_006171515.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
ref|XP_009418656.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    248   2e-76    
ref|XP_006171516.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
gb|KDQ64342.1|  hypothetical protein JAAARDRAFT_27968                   248   2e-76    
ref|XP_007116335.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
ref|XP_008803953.1|  PREDICTED: eukaryotic initiation factor 4A-3       248   2e-76    
ref|XP_003256667.1|  PREDICTED: eukaryotic initiation factor 4A-II      248   2e-76    
gb|EOA97603.1|  Eukaryotic initiation factor 4A-II                      248   2e-76    
ref|XP_004473756.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
ref|NP_989880.1|  eukaryotic initiation factor 4A-II                    248   2e-76    
ref|XP_002499891.1|  predicted protein                                  248   2e-76    
ref|XP_003437851.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
ref|XP_003192635.1|  hypothetical protein CGB_C1160C                    248   2e-76    
gb|KIK29272.1|  hypothetical protein PISMIDRAFT_89866                   248   2e-76    
ref|XP_008282835.1|  PREDICTED: eukaryotic initiation factor 4A-II      248   2e-76    
ref|XP_005802438.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
ref|XP_004954515.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    248   2e-76    
ref|XP_004576025.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
ref|XP_010514906.1|  PREDICTED: eukaryotic initiation factor 4A-2...    248   2e-76    
ref|XP_004713471.1|  PREDICTED: eukaryotic initiation factor 4A-II      248   2e-76    
ref|XP_009901850.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
ref|XP_002196090.1|  PREDICTED: eukaryotic initiation factor 4A-II      248   2e-76    
gb|AAH15842.1|  Eukaryotic translation initiation factor 4A, isof...    248   2e-76    
ref|XP_005024714.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
ref|XP_008491602.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
ref|XP_005476057.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
gb|EMC85744.1|  Eukaryotic initiation factor 4A-II                      248   2e-76    
ref|XP_006637458.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
ref|XP_003412833.1|  PREDICTED: eukaryotic initiation factor 4A-II      248   2e-76    
ref|XP_005910826.1|  PREDICTED: eukaryotic initiation factor 4A-II      248   2e-76    
ref|XP_007846278.1|  eukaryotic translation initiation factor eif-4a    248   2e-76    
ref|XP_003225744.1|  PREDICTED: eukaryotic initiation factor 4A-II      248   2e-76    
ref|XP_009062985.1|  hypothetical protein LOTGIDRAFT_207101             248   2e-76    
ref|XP_005146991.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   2e-76    
gb|KFQ16858.1|  Eukaryotic initiation factor 4A-II                      248   2e-76    
ref|XP_001877056.1|  predicted protein                                  248   2e-76    
gb|KIK04633.1|  hypothetical protein K443DRAFT_675656                   248   2e-76    
ref|XP_004673341.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    248   3e-76    
ref|NP_001271641.1|  eukaryotic initiation factor 4A-II                 248   3e-76    
ref|XP_009997708.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
gb|AIC61961.1|  EIF4A2                                                  248   3e-76    
dbj|BAA06336.1|  eukaryotic initiation factor 4AII                      248   3e-76    
ref|XP_005802437.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_009901849.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_005024715.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_007071059.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|NP_001279576.1|  eukaryotic translation initiation factor 4A2       248   3e-76    
gb|KII94924.1|  hypothetical protein PLICRDRAFT_33755                   248   3e-76    
ref|XP_007302673.1|  DEAD-domain-containing protein                     248   3e-76    
ref|XP_008491601.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_006138538.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_007567896.1|  PREDICTED: eukaryotic initiation factor 4A-I       248   3e-76    
gb|AET01642.2|  DEAD-box ATP-dependent RNA helicase                     246   3e-76    
ref|XP_006752550.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    248   3e-76    
ref|XP_007315794.1|  hypothetical protein SERLADRAFT_461600             248   3e-76    
ref|XP_005051294.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_005146992.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_005807977.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_010223876.1|  PREDICTED: eukaryotic initiation factor 4A-II      248   3e-76    
ref|XP_008168912.1|  PREDICTED: eukaryotic initiation factor 4A-I...    249   3e-76    
ref|XP_009997700.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_004078949.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_008149790.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|XP_004603081.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    
ref|NP_001008336.1|  eukaryotic initiation factor 4A-II                 248   3e-76    
ref|XP_003038113.1|  hypothetical protein SCHCODRAFT_63532              248   3e-76    
dbj|BAE90010.1|  unnamed protein product                                248   3e-76    
gb|EPT03584.1|  hypothetical protein FOMPIDRAFT_1022210                 248   3e-76    
gb|KIJ20344.1|  hypothetical protein PAXINDRAFT_108322                  248   3e-76    
ref|XP_007116334.1|  PREDICTED: eukaryotic initiation factor 4A-I...    248   3e-76    



>ref|XP_010113097.1| Eukaryotic initiation factor 4A-1 [Morus notabilis]
 gb|EXC64543.1| Eukaryotic initiation factor 4A-1 [Morus notabilis]
Length=191

 Score =   330 bits (845),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  30   GIKQFHVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  89

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  90   DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  149

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDE+MLFDIQKFYNV++EELPANVADLL
Sbjct  150  RFGRKGVAINFVTRDDEKMLFDIQKFYNVVVEELPANVADLL  191



>gb|AAD20980.1| translation initiation factor 4A2 [Zea mays]
Length=215

 Score =   328 bits (840),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  54   GIKQFYVNVDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  113

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  114  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  173

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  174  RFGRKGVAINFVTRDDERMLFDIQKFYNVLIEELPANVADLL  215



>ref|XP_009784285.1| PREDICTED: eukaryotic initiation factor 4A-14 [Nicotiana sylvestris]
Length=413

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/162 (99%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVIEELPANVADLL  413



>sp|Q40467.1|IF414_TOBAC RecName: Full=Eukaryotic initiation factor 4A-14; Short=eIF-4A-14; 
AltName: Full=ATP-dependent RNA helicase eIF4A-14 [Nicotiana 
tabacum]
 emb|CAA55742.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/162 (99%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVIEELPANVADLL  413



>ref|XP_004291063.1| PREDICTED: eukaryotic initiation factor 4A-2 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/162 (99%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DM+QNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMEQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVIEELPANVADLL  413



>ref|XP_009780782.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Nicotiana 
sylvestris]
Length=413

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/162 (99%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVIEELPANVADLL  413



>gb|AFC90091.1| eukaryotic initiation factor 4A-14 [Nicotiana benthamiana]
Length=413

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/162 (99%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVIEELPANVADLL  413



>ref|XP_004245077.1| PREDICTED: eukaryotic initiation factor 4A-2 [Solanum lycopersicum]
 ref|XP_006351592.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Solanum tuberosum]
Length=413

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPANVADLL  413



>ref|XP_008220506.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Prunus mume]
Length=413

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD+RMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDDRMLFDIQKFYNVVIEELPANVADLL  413



>ref|XP_007222702.1| hypothetical protein PRUPE_ppa006409mg [Prunus persica]
 gb|EMJ23901.1| hypothetical protein PRUPE_ppa006409mg [Prunus persica]
Length=413

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD+RMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDDRMLFDIQKFYNVVIEELPANVADLL  413



>gb|AAO17729.1| translation initition factor eIF4A [Apium graveolens Dulce Group]
Length=180

 Score =   324 bits (831),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  737  SVMS*H*RGIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRD  558
            +VMS   +GI QF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRD
Sbjct  14   NVMSFTLKGIXQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRD  73

Query  557  HTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENY  378
            HTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENY
Sbjct  74   HTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENY  133

Query  377  LHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVA  237
            LHRIGRSGRFGRKGVAINFVTKDD+RMLFDIQKFYNV++EELPANVA
Sbjct  134  LHRIGRSGRFGRKGVAINFVTKDDDRMLFDIQKFYNVVVEELPANVA  180



>sp|Q40469.1|IF4A6_TOBAC RecName: Full=Eukaryotic initiation factor 4A-6; Short=eIF-4A-6; 
AltName: Full=ATP-dependent RNA helicase eIF4A-6, partial 
[Nicotiana tabacum]
 emb|CAA55740.1| unnamed protein product [Nicotiana tabacum]
Length=253

 Score =   327 bits (838),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/161 (98%), Positives = 160/161 (99%), Gaps = 0/161 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  93   GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  152

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  153  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  212

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADL  231
            RFGRKGV+INFVTKDDERMLFDIQKFYNV+IEELPANVADL
Sbjct  213  RFGRKGVSINFVTKDDERMLFDIQKFYNVVIEELPANVADL  253



>ref|XP_006453067.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 ref|XP_006453068.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 ref|XP_006474428.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Citrus sinensis]
 gb|ESR66307.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 gb|ESR66308.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 gb|KDO73513.1| hypothetical protein CISIN_1g015158mg [Citrus sinensis]
 gb|KDO73514.1| hypothetical protein CISIN_1g015158mg [Citrus sinensis]
Length=412

 Score =   332 bits (852),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFHVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPANVADLL  412



>gb|KDO65152.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65153.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65154.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
Length=286

 Score =   328 bits (841),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  125  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  184

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  185  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  244

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  245  RFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL  286



>ref|XP_008337727.1| PREDICTED: eukaryotic initiation factor 4A-11 [Malus domestica]
Length=412

 Score =   332 bits (852),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_007202168.1| hypothetical protein PRUPE_ppa006450mg [Prunus persica]
 gb|EMJ03367.1| hypothetical protein PRUPE_ppa006450mg [Prunus persica]
Length=411

 Score =   332 bits (851),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  250  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  309

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  310  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  369

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  370  RFGRKGVAINFVTKDDERMLFDIQKFYNVLVEELPSNVADLL  411



>ref|XP_004253093.1| PREDICTED: eukaryotic initiation factor 4A-2 [Solanum lycopersicum]
Length=413

 Score =   332 bits (851),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVIEELPANVADLL  413



>ref|XP_002277703.1| PREDICTED: eukaryotic initiation factor 4A-8 [Vitis vinifera]
Length=413

 Score =   332 bits (851),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>ref|XP_004253094.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum lycopersicum]
Length=410

 Score =   332 bits (851),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  249  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  308

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  309  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  368

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  369  RFGRKGVAINFVTKDDERMLFDIQKFYNVVIEELPANVADLL  410



>ref|XP_007012776.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 ref|XP_007012777.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY30395.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY30396.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
Length=413

 Score =   332 bits (851),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFV +DDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVIRDDERMLFDIQKFYNVIIEELPANVADLL  413



>ref|XP_006342504.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum tuberosum]
Length=413

 Score =   332 bits (850),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPANVADLL  413



>ref|XP_006342502.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum tuberosum]
Length=410

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  249  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  308

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  309  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  368

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELPANVADLL
Sbjct  369  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPANVADLL  410



>ref|XP_011010150.1| PREDICTED: eukaryotic initiation factor 4A-8 [Populus euphratica]
Length=413

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DD+RMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDDRMLFDIQKFYNVIIEELPSNVADLL  413



>ref|XP_002304104.1| translation initiation factor 4A family protein [Populus trichocarpa]
 ref|XP_002304185.2| hypothetical protein POPTR_0003s04150g [Populus trichocarpa]
 gb|ABK94270.1| unknown [Populus trichocarpa]
 gb|EEE79083.1| translation initiation factor 4A family protein [Populus trichocarpa]
 gb|EEE79164.2| hypothetical protein POPTR_0003s04150g [Populus trichocarpa]
Length=413

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DD+RMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDDRMLFDIQKFYNVVIEELPSNVADLL  413



>gb|EYU29343.1| hypothetical protein MIMGU_mgv1a007274mg [Erythranthe guttata]
Length=413

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKLETLCDLYETLAITQSVIF+NTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEDWKLETLCDLYETLAITQSVIFINTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPANVADLL  413



>ref|XP_009604178.1| PREDICTED: eukaryotic initiation factor 4A-6-like [Nicotiana 
tomentosiformis]
Length=228

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  67   GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  126

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  127  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  186

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGV+INFVT DDERML DIQ+FYNV+IEELPANVADLL
Sbjct  187  RFGRKGVSINFVTNDDERMLSDIQRFYNVVIEELPANVADLL  228



>emb|CDP08290.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPANVADLL  414



>ref|XP_010033764.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Eucalyptus 
grandis]
 gb|KCW53567.1| hypothetical protein EUGRSUZ_J028421 [Eucalyptus grandis]
Length=412

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGR G
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRGG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_009602748.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nicotiana tomentosiformis]
 ref|XP_009791873.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nicotiana sylvestris]
Length=413

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGV+INFVTKDDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVSINFVTKDDERMLFDIQKFYNVVIEELPANVADLL  413



>gb|KDO65151.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
Length=369

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  208  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  267

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  268  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  327

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  328  RFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL  369



>dbj|BAH20394.1| AT3G13920 [Arabidopsis thaliana]
Length=237

 Score =   324 bits (831),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  76   GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  135

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  136  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  195

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAIN VT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  196  RFGRKGVAINLVTRDDERMLFDIQKFYNVVVEELPSNVADLL  237



>ref|XP_009604758.1| PREDICTED: eukaryotic initiation factor 4A-10 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLSDIQKFYNVVIEELPANVADLL  413



>sp|P41382.1|IF410_TOBAC RecName: Full=Eukaryotic initiation factor 4A-10; Short=eIF-4A-10; 
AltName: Full=ATP-dependent RNA helicase eIF4A-10 [Nicotiana 
tabacum]
 emb|CAA55642.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
 emb|CAA55641.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
Length=413

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLSDIQKFYNVVIEELPANVADLL  413



>sp|P41379.1|IF4A2_NICPL RecName: Full=Eukaryotic initiation factor 4A-2; Short=eIF-4A-2; 
AltName: Full=ATP-dependent RNA helicase eIF4A-2 [Nicotiana 
plumbaginifolia]
 emb|CAA43513.1| nicotiana eukaryotic translation initiation factor 4A [Nicotiana 
plumbaginifolia]
Length=413

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAIN VTKDDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINSVTKDDERMLFDIQKFYNVVIEELPANVADLL  413



>ref|XP_002278119.1| PREDICTED: eukaryotic initiation factor 4A-11 [Vitis vinifera]
 emb|CBI20640.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQ+FYNV++EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQRFYNVVVEELPSNVADLL  413



>ref|XP_009624937.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X2 [Nicotiana 
tomentosiformis]
Length=400

 Score =   330 bits (846),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  239  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  298

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  299  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  358

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  359  RFGRKGVAINFVTTDDERMLFDIQKFYNVIIEELPSNVADLL  400



>emb|CAN61608.1| hypothetical protein VITISV_040122 [Vitis vinifera]
Length=413

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQ+FYNV++EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQRFYNVVVEELPSNVADLL  413



>ref|XP_009372398.1| PREDICTED: eukaryotic initiation factor 4A-8 [Pyrus x bretschneideri]
 ref|XP_009340681.1| PREDICTED: eukaryotic initiation factor 4A-8 [Pyrus x bretschneideri]
Length=413

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML+DIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLYDIQRFYNVVIEELPSNVADLL  413



>ref|XP_011100200.1| PREDICTED: eukaryotic initiation factor 4A-14 [Sesamum indicum]
Length=413

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD+RMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDDRMLFDIQKFYNVVIEELPANVADLL  413



>ref|XP_004141688.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus]
 ref|XP_004155930.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus]
 gb|KGN45514.1| hypothetical protein Csa_7G450710 [Cucumis sativus]
Length=413

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTNDDERMLFDIQKFYNVVIEELPANVADLL  413



>ref|XP_010322839.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X2 [Solanum 
lycopersicum]
Length=413

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTTDDERMLFDIQKFYNVVIEELPSNVADLL  413



>ref|XP_008392378.1| PREDICTED: eukaryotic initiation factor 4A-8 [Malus domestica]
Length=413

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML+DIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLYDIQRFYNVVIEELPSNVADLL  413



>ref|XP_010322836.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322837.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322838.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
Length=416

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  255  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  314

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  315  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  374

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  375  RFGRKGVAINFVTTDDERMLFDIQKFYNVVIEELPSNVADLL  416



>ref|XP_009624936.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTTDDERMLFDIQKFYNVIIEELPSNVADLL  413



>ref|XP_006357392.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Solanum tuberosum]
Length=413

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTTDDERMLFDIQKFYNVVIEELPSNVADLL  413



>ref|XP_009798256.1| PREDICTED: eukaryotic initiation factor 4A-8 [Nicotiana sylvestris]
Length=413

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTTDDERMLFDIQKFYNVIIEELPSNVADLL  413



>gb|AFW69337.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=411

 Score =   330 bits (845),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  250  GIKQFYVNVDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  309

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  310  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  369

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  370  RFGRKGVAINFVTRDDERMLFDIQKFYNVLIEELPANVADLL  411



>ref|XP_010087709.1| Eukaryotic initiation factor 4A-8 [Morus notabilis]
 gb|EXB29697.1| Eukaryotic initiation factor 4A-8 [Morus notabilis]
Length=423

 Score =   330 bits (846),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  262  GIKQFHVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  321

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  322  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  381

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DERMLFDIQKFYNV++EELP+NVADLL
Sbjct  382  RFGRKGVAINFVTREDERMLFDIQKFYNVVVEELPSNVADLL  423



>gb|EYU29345.1| hypothetical protein MIMGU_mgv1a007246mg [Erythranthe guttata]
Length=413

 Score =   330 bits (845),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPANVADLL  413



>gb|AFW75865.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
1 [Zea mays]
 gb|AFW75866.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
2 [Zea mays]
Length=414

 Score =   330 bits (845),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDDERMLFDIQKFYNVLIEELPANVADLL  414



>ref|XP_007215455.1| hypothetical protein PRUPE_ppa006399mg [Prunus persica]
 ref|XP_008228255.1| PREDICTED: eukaryotic initiation factor 4A-11 [Prunus mume]
 ref|XP_008228256.1| PREDICTED: eukaryotic initiation factor 4A-11 [Prunus mume]
 gb|ADB07168.1| DEAD-box RNA helicase-like protein [Prunus persica]
 gb|ADB07169.1| DEAD-box RNA helicase-like protein [Prunus persica]
 gb|EMJ16654.1| hypothetical protein PRUPE_ppa006399mg [Prunus persica]
Length=413

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML+DIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLYDIQRFYNVVIEELPSNVADLL  413



>gb|ACN34609.1| unknown [Zea mays]
 gb|AFW69338.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=414

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDDERMLFDIQKFYNVLIEELPANVADLL  414



>ref|XP_010501104.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=369

 Score =   328 bits (841),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  208  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  267

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  268  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  327

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  328  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  369



>ref|XP_009389913.1| PREDICTED: eukaryotic initiation factor 4A-11 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADL+
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLI  413



>ref|XP_006426587.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 ref|XP_006426588.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 ref|XP_006465995.1| PREDICTED: eukaryotic initiation factor 4A-8-like isoform X1 
[Citrus sinensis]
 ref|XP_006465996.1| PREDICTED: eukaryotic initiation factor 4A-8-like isoform X2 
[Citrus sinensis]
 gb|ESR39827.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 gb|ESR39828.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 gb|KDO65148.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65149.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65150.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
Length=413

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL  413



>ref|XP_010533343.1| PREDICTED: eukaryotic initiation factor 4A-1-like, partial [Tarenaya 
hassleriana]
Length=359

 Score =   327 bits (839),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  198  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  257

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  258  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  317

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  318  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  359



>ref|XP_011046150.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Populus euphratica]
 ref|XP_011046151.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Populus euphratica]
Length=413

 Score =   329 bits (844),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD+RMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTSDDDRMLFDIQKFYNVLIEELPSNVADLL  413



>emb|CAC43286.1| translation initiation factor eIF-4A1 [Arabidopsis thaliana]
Length=369

 Score =   328 bits (840),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  208  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  267

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  268  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  327

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  328  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  369



>emb|CDY08220.1| BnaA05g13990D [Brassica napus]
Length=412

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_007024535.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY27157.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
Length=413

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  413



>ref|XP_003533770.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoformX1 
[Glycine max]
 ref|XP_003533771.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoformX2 
[Glycine max]
 ref|XP_006587022.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X3 
[Glycine max]
 gb|KHN35869.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDE+MLFDIQKFYNV+IEELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTKDDEKMLFDIQKFYNVVIEELPSNVAELL  413



>ref|XP_008379513.1| PREDICTED: eukaryotic initiation factor 4A-8 [Malus domestica]
Length=413

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML+DIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLYDIQRFYNVVIEELPSNVADLL  413



>sp|Q40465.1|IF411_TOBAC RecName: Full=Eukaryotic initiation factor 4A-11; Short=eIF-4A-11; 
AltName: Full=ATP-dependent RNA helicase eIF4A-11 [Nicotiana 
tabacum]
 emb|CAA55737.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIG SG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGHSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGV+INFVTKDDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVSINFVTKDDERMLFDIQKFYNVVIEELPANVADLL  413



>sp|P41381.1|IF4A8_TOBAC RecName: Full=Eukaryotic initiation factor 4A-8; Short=eIF-4A-8; 
AltName: Full=ATP-dependent RNA helicase eIF4A-8 [Nicotiana 
tabacum]
 emb|CAA55639.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
 emb|CAA55640.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
Length=413

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR+RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRTRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTTDDERMLFDIQKFYNVIIEELPSNVADLL  413



>ref|XP_008798133.1| PREDICTED: eukaryotic initiation factor 4A-14 [Phoenix dactylifera]
 ref|XP_008798134.1| PREDICTED: eukaryotic initiation factor 4A-14 [Phoenix dactylifera]
Length=413

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>ref|XP_006338111.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X2 
[Solanum tuberosum]
 ref|XP_006338112.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X3 
[Solanum tuberosum]
Length=414

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTKDDERMLSDIQRFYNVVIEELPANVADLL  414



>ref|XP_010552227.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=369

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  208  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  267

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  268  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  327

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  328  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  369



>emb|CBI27885.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>ref|XP_006338110.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X1 
[Solanum tuberosum]
Length=416

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  255  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  314

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  315  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  374

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV+IEELPANVADLL
Sbjct  375  RFGRKGVAINFVTKDDERMLSDIQRFYNVVIEELPANVADLL  416



>ref|XP_002521376.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF41044.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=413

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGR G
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRGG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL  413



>ref|XP_008447621.1| PREDICTED: eukaryotic initiation factor 4A-8 [Cucumis melo]
 gb|ADN33729.1| helicase [Cucumis melo subsp. melo]
Length=413

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT +DERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTTEDERMLFDIQKFYNVIIEELPANVADLL  413



>ref|XP_004303662.1| PREDICTED: eukaryotic initiation factor 4A-8 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQN RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNQRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>ref|XP_004146811.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Cucumis sativus]
 ref|XP_004154791.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Cucumis sativus]
 gb|KGN59802.1| hypothetical protein Csa_3G848120 [Cucumis sativus]
Length=413

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT +DERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTTEDERMLFDIQKFYNVVIEELPANVADLL  413



>gb|KJB70132.1| hypothetical protein B456_011G063400 [Gossypium raimondii]
 gb|KJB70133.1| hypothetical protein B456_011G063400 [Gossypium raimondii]
Length=413

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRD+IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTTDDERMLFDIQKFYNVVIEELPSNVADLL  413



>ref|XP_010501441.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
 ref|XP_010465264.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
 ref|XP_010487172.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
Length=412

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_007012323.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
 gb|EOY29942.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
Length=412

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADL+
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLI  412



>gb|KDP33852.1| hypothetical protein JCGZ_07423 [Jatropha curcas]
Length=413

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGR G
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRGG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD+RMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKDDDRMLFDIQRFYNVVIEELPSNVADLL  413



>ref|NP_001105396.1| translational initiation factor eIF-4A [Zea mays]
 gb|AAB67607.1| translational initiation factor eIF-4A [Zea mays]
Length=414

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+D+ERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDNERMLFDIQKFYNVLIEELPANVADLL  414



>ref|NP_001189885.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 gb|AEE75441.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=407

 Score =   328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  246  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  305

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  306  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  365

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  366  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  407



>ref|NP_001078148.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 gb|AEE75440.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=402

 Score =   328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  241  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  300

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  301  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  360

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  361  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  402



>ref|XP_010915249.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Elaeis guineensis]
Length=413

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>sp|Q40468.1|IF415_TOBAC RecName: Full=Eukaryotic initiation factor 4A-15; Short=eIF-4A-15; 
AltName: Full=ATP-dependent RNA helicase eIF4A-15 [Nicotiana 
tabacum]
 emb|CAA55739.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLSDIQRFYNVVIEELPANVADLL  413



>ref|XP_006297793.1| hypothetical protein CARUB_v10013828mg [Capsella rubella]
 gb|EOA30691.1| hypothetical protein CARUB_v10013828mg [Capsella rubella]
Length=412

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>gb|KHN28839.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDE+MLFDIQKFYNV+IEELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTRDDEKMLFDIQKFYNVIIEELPSNVAELL  413



>ref|XP_002438954.1| hypothetical protein SORBIDRAFT_10g028940 [Sorghum bicolor]
 gb|EER90321.1| hypothetical protein SORBIDRAFT_10g028940 [Sorghum bicolor]
Length=414

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVEKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPANVADLL  414



>ref|XP_010480021.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=412

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>dbj|BAE98559.1| eukaryotic protein synthesis initiation factor 4A [Arabidopsis 
thaliana]
Length=412

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|NP_566469.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 sp|P41376.1|IF4A1_ARATH RecName: Full=Eukaryotic initiation factor 4A-1; Short=eIF-4A-1; 
AltName: Full=ATP-dependent RNA helicase eIF4A-1; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 4 [Arabidopsis thaliana]
 emb|CAA46188.1| eukaryotic translation initiation factor 4A-1 [Arabidopsis thaliana]
 dbj|BAB02322.1| eukaryotic translation initiation factor; RNA helicase [Arabidopsis 
thaliana]
 emb|CAC43288.1| translation initiation factor eIF-4A1 [Arabidopsis thaliana]
 gb|AAK93634.1| putative Eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAK96536.1| AT3g13920/MDC16_4 [Arabidopsis thaliana]
 gb|AAM14243.1| putative eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAM19972.1| AT3g13920/MDC16_4 [Arabidopsis thaliana]
 gb|AAM98124.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31802.1| putative eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AEE75438.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=412

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_006392695.1| hypothetical protein EUTSA_v10011528mg [Eutrema salsugineum]
 gb|ESQ29981.1| hypothetical protein EUTSA_v10011528mg [Eutrema salsugineum]
Length=412

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>gb|AAL91176.1| eukaryotic translation initiation factor [Arabidopsis thaliana]
Length=412

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_006307670.1| hypothetical protein CARUB_v10009297mg [Capsella rubella]
 gb|EOA40568.1| hypothetical protein CARUB_v10009297mg [Capsella rubella]
Length=412

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>gb|KJB56903.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
 gb|KJB56904.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
Length=413

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERML+DIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTNDDERMLYDIQKFYNVIIEELPSNVADLL  413



>ref|NP_001242064.1| uncharacterized protein LOC100786735 [Glycine max]
 gb|ACU18275.1| unknown [Glycine max]
Length=413

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDE+MLFDIQKFYNV+IEELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTRDDEKMLFDIQKFYNVIIEELPSNVAELL  413



>ref|XP_009764703.1| PREDICTED: eukaryotic initiation factor 4A-15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764704.1| PREDICTED: eukaryotic initiation factor 4A-15 isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLSDIQRFYNVVIEELPANVADLL  413



>ref|XP_010929386.1| PREDICTED: eukaryotic initiation factor 4A-2 [Elaeis guineensis]
Length=413

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV++EEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEREEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>ref|XP_009597977.1| PREDICTED: eukaryotic initiation factor 4A-15 [Nicotiana tomentosiformis]
Length=413

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLSDIQRFYNVVIEELPANVADLL  413



>ref|XP_010462344.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=412

 Score =   327 bits (839),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_008801403.1| PREDICTED: eukaryotic initiation factor 4A-15 [Phoenix dactylifera]
 ref|XP_008801404.1| PREDICTED: eukaryotic initiation factor 4A-15 [Phoenix dactylifera]
Length=413

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV++EEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEREEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>ref|XP_011081667.1| PREDICTED: eukaryotic initiation factor 4A-2 [Sesamum indicum]
Length=413

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD+RML DIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDDRMLVDIQKFYNVVIEELPANVADLL  413



>ref|XP_010534921.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=412

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_009135344.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  251  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_009106914.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X1 
[Brassica rapa]
 ref|XP_009106915.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X2 
[Brassica rapa]
Length=412

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_003522265.1| PREDICTED: eukaryotic initiation factor 4A-11 [Glycine max]
 gb|KHN29706.1| Eukaryotic initiation factor 4A-11 [Glycine soja]
Length=413

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF VNVDKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFFVNVDKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV IEELPANVADL+
Sbjct  372  RFGRKGVAINFVTGDDERMLFDIQKFYNVQIEELPANVADLI  413



>emb|CDY10607.1| BnaC03g70070D [Brassica napus]
Length=411

 Score =   327 bits (838),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  250  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  309

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  310  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  369

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  370  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  411



>ref|XP_009764706.1| PREDICTED: eukaryotic initiation factor 4A-6 isoform X2 [Nicotiana 
sylvestris]
Length=380

 Score =   326 bits (836),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  219  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  278

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  279  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  338

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV+IEELPANVADLL
Sbjct  339  RFGRKGVAINFVTKDDERMLSDIQRFYNVVIEELPANVADLL  380



>emb|CDY02469.1| BnaA08g00760D [Brassica napus]
Length=412

 Score =   327 bits (838),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_002891805.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68064.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFITRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>emb|CDY39079.1| BnaA01g29770D [Brassica napus]
Length=412

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  251  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_006407149.1| hypothetical protein EUTSA_v10020824mg [Eutrema salsugineum]
 gb|ESQ48602.1| hypothetical protein EUTSA_v10020824mg [Eutrema salsugineum]
Length=412

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRD+IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_009117360.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  251  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_009334736.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X5 
[Pyrus x bretschneideri]
Length=407

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  246  GIKQFHVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  305

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  306  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  365

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD+R L+DIQKFYNV+IEELPANVADLL
Sbjct  366  RFGRKGVAINFVTKDDDRTLYDIQKFYNVVIEELPANVADLL  407



>ref|XP_009334735.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X4 
[Pyrus x bretschneideri]
Length=412

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFHVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD+R L+DIQKFYNV+IEELPANVADLL
Sbjct  371  RFGRKGVAINFVTKDDDRTLYDIQKFYNVVIEELPANVADLL  412



>ref|XP_002884997.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61256.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTHDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_009334733.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X2 
[Pyrus x bretschneideri]
Length=413

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD+R L+DIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDDRTLYDIQKFYNVVIEELPANVADLL  413



>ref|XP_009334732.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X1 
[Pyrus x bretschneideri]
Length=414

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFHVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD+R L+DIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTKDDDRTLYDIQKFYNVVIEELPANVADLL  414



>gb|KJB34989.1| hypothetical protein B456_006G095400 [Gossypium raimondii]
 gb|KJB34990.1| hypothetical protein B456_006G095400 [Gossypium raimondii]
Length=413

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRD+IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTVDDERMLFDIQKFYNVVIEELPSNVADLL  413



>ref|XP_010062659.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Eucalyptus 
grandis]
 gb|KCW69788.1| hypothetical protein EUGRSUZ_F03152 [Eucalyptus grandis]
Length=412

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVDKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFV +DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVNRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_008462340.1| PREDICTED: eukaryotic initiation factor 4A-11 [Cucumis melo]
Length=413

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVD+E+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTD MRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDREDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDNMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTNDDERMLFDIQKFYNVVIEELPANVADLL  413



>ref|XP_009334734.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X3 
[Pyrus x bretschneideri]
Length=413

 Score =   327 bits (838),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFHVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD+R L+DIQKFYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDDRTLYDIQKFYNVVIEELPANVADLL  413



>ref|XP_009604756.1| PREDICTED: eukaryotic initiation factor 4A-7 [Nicotiana tomentosiformis]
 ref|XP_009604757.1| PREDICTED: eukaryotic initiation factor 4A-7 [Nicotiana tomentosiformis]
 ref|XP_009604759.1| PREDICTED: eukaryotic initiation factor 4A-7 isoform X2 [Nicotiana 
tomentosiformis]
Length=413

 Score =   327 bits (838),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFV KDDERML DIQ+FYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVIKDDERMLSDIQRFYNVVIEELPANVADLL  413



>ref|XP_003526019.1| PREDICTED: eukaryotic initiation factor 4A-11 [Glycine max]
 gb|KHN32198.1| Eukaryotic initiation factor 4A-11 [Glycine soja]
Length=413

 Score =   327 bits (838),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 157/162 (97%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF VNVDKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFFVNVDKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQKFYNV IEELPANVADL+
Sbjct  372  RFGRKGVAINFVTGDDERMLFDIQKFYNVQIEELPANVADLI  413



>ref|XP_010929385.1| PREDICTED: eukaryotic initiation factor 4A-15 [Elaeis guineensis]
Length=413

 Score =   327 bits (838),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VN+++EEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNIEREEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>ref|XP_009415521.1| PREDICTED: eukaryotic initiation factor 4A-15 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   327 bits (837),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELP+NVADL+
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLI  413



>ref|XP_006369263.1| hypothetical protein POPTR_0001s20480g [Populus trichocarpa]
 ref|XP_006369264.1| translation initiation factor 4A family protein [Populus trichocarpa]
 gb|ABK93256.1| unknown [Populus trichocarpa]
 gb|ERP65832.1| hypothetical protein POPTR_0001s20480g [Populus trichocarpa]
 gb|ERP65833.1| translation initiation factor 4A family protein [Populus trichocarpa]
Length=413

 Score =   327 bits (837),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD+RMLFDIQKFYNV++EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTSDDDRMLFDIQKFYNVVVEELPSNVADLL  413



>gb|AAN74635.1| DEAD box RNA helicase [Pisum sativum]
 gb|AAR97917.1| DEAD box RNA helicase [Pisum sativum]
Length=413

 Score =   327 bits (837),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQKFYNV+IEELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTKDDERMLGDIQKFYNVLIEELPSNVAELL  413



>ref|XP_004951905.1| PREDICTED: eukaryotic initiation factor 4A-like [Setaria italica]
Length=410

 Score =   327 bits (837),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  249  GIKQFYVNVEKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  308

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  309  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  368

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV +EELPANVADLL
Sbjct  369  RFGRKGVAINFVTRDDERMLFDIQKFYNVTVEELPANVADLL  410



>ref|XP_010242273.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nelumbo nucifera]
Length=413

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR+RDHTVSATHG
Sbjct  252  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRNRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL  413



>ref|XP_008782542.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
 ref|XP_008782543.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
Length=413

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQN RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNARDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>ref|XP_004966111.1| PREDICTED: eukaryotic initiation factor 4A-3-like [Setaria italica]
Length=414

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVEKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPANVADLL  414



>gb|AFK46989.1| unknown [Lotus japonicus]
Length=229

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  68   GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  127

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENY HRIGRSG
Sbjct  128  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYFHRIGRSG  187

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RMLFDIQKFYNV +EELP+NVADLL
Sbjct  188  RFGRKGVAINFVTLDDSRMLFDIQKFYNVTVEELPSNVADLL  229



>ref|NP_001104874.1| translation initiation factor [Zea mays]
 gb|AAB64289.1| translation initiation factor [Zea mays]
Length=414

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDER++FDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDDERIVFDIQKFYNVLIEELPANVADLL  414



>dbj|BAJ96964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTREDERMLFDIQKFYNVVIEELPANVADLL  414



>dbj|BAJ89461.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT12089.1| Eukaryotic initiation factor 4A [Aegilops tauschii]
Length=414

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTREDERMLFDIQKFYNVVIEELPANVADLL  414



>ref|XP_003574572.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brachypodium 
distachyon]
Length=414

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTREDERMLFDIQKFYNVVIEELPANVADLL  414



>ref|XP_009399791.1| PREDICTED: eukaryotic initiation factor 4A-8 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERMLFDIQ+FYNV+IEELP+NVADL+
Sbjct  372  RFGRKGVAINFVTVDDERMLFDIQRFYNVVIEELPSNVADLI  413



>ref|XP_011038130.1| PREDICTED: eukaryotic initiation factor 4A-15 [Populus euphratica]
Length=413

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLSDIQRFYNVTVEELPSNVADLL  413



>ref|XP_003563508.1| PREDICTED: eukaryotic initiation factor 4A [Brachypodium distachyon]
 ref|XP_010227424.1| PREDICTED: eukaryotic initiation factor 4A [Brachypodium distachyon]
Length=414

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTREDERMLFDIQKFYNVVIEELPANVADLL  414



>ref|NP_001151064.1| LOC100284697 [Zea mays]
 gb|ACF79496.1| unknown [Zea mays]
 gb|ACG41480.1| eukaryotic initiation factor 4A [Zea mays]
Length=410

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VN+DKE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  249  GIKQFYVNIDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  308

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  309  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  368

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV +EELPANVADLL
Sbjct  369  RFGRKGVAINFVTRDDERMLFDIQRFYNVTVEELPANVADLL  410



>ref|NP_001058481.1| Os06g0701100 [Oryza sativa Japonica Group]
 sp|P35683.2|IF4A1_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-1; Short=eIF-4A-1; 
AltName: Full=ATP-dependent RNA helicase eIF4A-1; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 4 [Oryza sativa 
Japonica Group]
 dbj|BAD54014.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAD53769.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAF20395.1| Os06g0701100 [Oryza sativa Japonica Group]
 gb|EAZ38180.1| hypothetical protein OsJ_22532 [Oryza sativa Japonica Group]
 dbj|BAG94357.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99594.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPANVADLL  414



>ref|XP_009107078.1| PREDICTED: eukaryotic initiation factor 4A-1 [Brassica rapa]
Length=412

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMRE RSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREVRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_006656443.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X1 
[Oryza brachyantha]
 ref|XP_006656444.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X2 
[Oryza brachyantha]
Length=414

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPANVADLL  414



>ref|XP_010542416.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=412

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML+DIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLYDIQKFYNVVVEELPSNVADLL  412



>ref|XP_002324737.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
 gb|ABK92554.1| unknown [Populus trichocarpa]
 gb|EEF03302.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
Length=413

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLSDIQRFYNVTVEELPSNVADLL  413



>gb|EMS68416.1| Eukaryotic initiation factor 4A-1 [Triticum urartu]
 gb|EMT30822.1| Eukaryotic initiation factor 4A-1 [Aegilops tauschii]
Length=414

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTREDERMLFDIQKFYNVVIEELPANVADLL  414



>ref|XP_004513437.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X1 
[Cicer arietinum]
 ref|XP_004513438.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X2 
[Cicer arietinum]
Length=413

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQKFYNV+IEELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTKDDERMLGDIQKFYNVIIEELPSNVAELL  413



>sp|Q40470.1|IF4A7_TOBAC RecName: Full=Eukaryotic initiation factor 4A-7; Short=eIF-4A-7; 
AltName: Full=ATP-dependent RNA helicase eIF4A-7 [Nicotiana 
tabacum]
 emb|CAA55738.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR+RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRTRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFV KDDERML DIQ+FYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVIKDDERMLSDIQRFYNVVIEELPANVADLL  413



>sp|Q40471.1|IF4A9_TOBAC RecName: Full=Eukaryotic initiation factor 4A-9; Short=eIF-4A-9; 
AltName: Full=ATP-dependent RNA helicase eIF4A-9 [Nicotiana 
tabacum]
 emb|CAA55736.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGV+INFVT DDERML DIQ+FYNV+IEELPANVADLL
Sbjct  372  RFGRKGVSINFVTSDDERMLSDIQRFYNVVIEELPANVADLL  413



>ref|XP_010927213.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Elaeis guineensis]
Length=413

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VN+++EEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNIEREEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADL+
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLI  413



>ref|XP_009757031.1| PREDICTED: eukaryotic initiation factor 4A-9 [Nicotiana sylvestris]
Length=413

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGV+INFVT DDERML DIQ+FYNV+IEELPANVADLL
Sbjct  372  RFGRKGVSINFVTSDDERMLSDIQRFYNVVIEELPANVADLL  413



>ref|XP_002451536.1| hypothetical protein SORBIDRAFT_04g003390 [Sorghum bicolor]
 gb|EES04512.1| hypothetical protein SORBIDRAFT_04g003390 [Sorghum bicolor]
Length=410

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  249  GIKQFYVNVEKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  308

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  309  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  368

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV IEELPANVADLL
Sbjct  369  RFGRKGVAINFVTRDDERMLFDIQRFYNVTIEELPANVADLL  410



>gb|AAF19805.1| EIF4A protein [Brassica oleracea]
Length=354

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  193  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  252

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  253  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  312

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T DDERML DIQKFYNV++EELP+NVADLL
Sbjct  313  RFGRKGVAINFMTTDDERMLSDIQKFYNVVVEELPSNVADLL  354



>ref|XP_009385793.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADL+
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLI  413



>gb|AAM63951.1| Eukaryotic initiation factor 4A, putative [Arabidopsis thaliana]
Length=412

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRK DWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKXDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_010927212.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Elaeis guineensis]
Length=413

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VN+++EEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNIEREEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>ref|XP_010049453.1| PREDICTED: eukaryotic initiation factor 4A-15 [Eucalyptus grandis]
 gb|KCW82050.1| hypothetical protein EUGRSUZ_C03418 [Eucalyptus grandis]
Length=413

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGR G
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRGG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLSDIQRFYNVVIEELPANVADLL  413



>ref|XP_007154632.1| hypothetical protein PHAVU_003G134800g [Phaseolus vulgaris]
 gb|ESW26626.1| hypothetical protein PHAVU_003G134800g [Phaseolus vulgaris]
Length=413

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD++MLFDIQKFYNV++EELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTKDDDKMLFDIQKFYNVVVEELPSNVAELL  413



>ref|XP_006597014.1| PREDICTED: uncharacterized protein LOC100786735 isoform X1 [Glycine 
max]
 ref|XP_006597015.1| PREDICTED: uncharacterized protein LOC100786735 isoform X2 [Glycine 
max]
 ref|XP_006597016.1| PREDICTED: uncharacterized protein LOC100786735 isoform X3 [Glycine 
max]
Length=457

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  296  GIKQFHVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  355

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  356  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  415

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDE+MLFDIQKFYNV+IEELP+NVA+LL
Sbjct  416  RFGRKGVAINFVTRDDEKMLFDIQKFYNVIIEELPSNVAELL  457



>ref|XP_011019413.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Populus euphratica]
 ref|XP_011019414.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Populus euphratica]
Length=413

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML DIQ+FYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLSDIQRFYNVTVEELPSNVADLL  413



>ref|XP_002308545.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
 gb|EEE92068.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
Length=413

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML DIQ+FYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLSDIQRFYNVTVEELPSNVADLL  413



>ref|NP_001045878.1| Os02g0146600 [Oryza sativa Japonica Group]
 sp|Q6Z2Z4.1|IF4A3_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-3; Short=eIF-4A-3; 
AltName: Full=ATP-dependent RNA helicase eIF4A-3; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 23; AltName: Full=eIF4A-2 
[Oryza sativa Japonica Group]
 dbj|BAD13081.1| putative translational initiation factor eIF-4A [Oryza sativa 
Japonica Group]
 dbj|BAF07792.1| Os02g0146600 [Oryza sativa Japonica Group]
 gb|EAY84464.1| hypothetical protein OsI_05839 [Oryza sativa Indica Group]
 dbj|BAG93556.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56296.1| hypothetical protein OsJ_05367 [Oryza sativa Japonica Group]
 gb|AGT42311.1| eucaryotic initiation factor [Oryza sativa Japonica Group]
Length=414

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVEKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDDERMLFDIQRFYNVTIEELPANVADLL  414



>ref|XP_008798130.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
 ref|XP_008798131.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
 ref|XP_008798132.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
Length=413

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV++EEWKLETLCDLYETLAITQSVIFVNTRRKVDWL DKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEREEWKLETLCDLYETLAITQSVIFVNTRRKVDWLADKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>ref|XP_010925445.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Elaeis guineensis]
Length=413

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQN RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNARDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  413



>gb|AAK74073.1| eukaryotic translation initiation factor 4A-1 [Elaeis oleifera]
Length=170

 Score =   316 bits (810),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 158/159 (99%), Gaps = 0/159 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VN+++EEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDK+RSRDHTVSATHG
Sbjct  12   GIKQFYVNIEREEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKLRSRDHTVSATHG  71

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQN RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  72   DMDQNARDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  131

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVA  237
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVA
Sbjct  132  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVA  170



>gb|AFC88837.1| initiation factor 4A-3-like protein, partial [Miscanthus sinensis]
Length=377

 Score =   324 bits (830),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  216  GIKQFYVNVDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  275

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  276  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  335

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML DIQ+FYNV+IEELPANVADLL
Sbjct  336  RFGRKGVAINFVTRDDERMLSDIQRFYNVVIEELPANVADLL  377



>dbj|BAJ85348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMR+FRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMRQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTREDERMLFDIQKFYNVVIEELPANVADLL  414



>gb|AIZ68204.1| eukaryotic initiation factor 4A-14 [Ornithogalum saundersiae]
Length=413

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DERMLFDIQ+FY+V+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTREDERMLFDIQRFYDVVIEELPSNVADLL  413



>ref|XP_007136846.1| hypothetical protein PHAVU_009G079100g [Phaseolus vulgaris]
 gb|ESW08840.1| hypothetical protein PHAVU_009G079100g [Phaseolus vulgaris]
Length=413

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR+RDHTVSATHG
Sbjct  252  GIKQFFVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRNRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD+RML DIQKFYNVM+EELPANVADL+
Sbjct  372  RFGRKGVAINFVTSDDDRMLLDIQKFYNVMVEELPANVADLI  413



>emb|CDP03140.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFFVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML DIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLSDIQRFYNVVIEELPSNVADLL  413



>ref|XP_009146433.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WK ETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  251  GIKQFYVNVEKEDWKPETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_003595233.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|ABN09109.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES65484.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERML DIQKFYNV+IEELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTTDDERMLSDIQKFYNVLIEELPSNVAELL  413



>ref|XP_006646878.1| PREDICTED: eukaryotic initiation factor 4A-3-like isoform X1 
[Oryza brachyantha]
 ref|XP_006646879.1| PREDICTED: eukaryotic initiation factor 4A-3-like isoform X2 
[Oryza brachyantha]
Length=414

 Score =   325 bits (832),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVEKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV +EELPANVADLL
Sbjct  373  RFGRKGVAINFVTRDDERMLFDIQRFYNVTVEELPANVADLL  414



>gb|KHN17683.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   324 bits (831),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDE+MLFDIQKFYNV +EELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTKDDEKMLFDIQKFYNVQVEELPSNVAELL  413



>ref|XP_007138709.1| hypothetical protein PHAVU_009G230600g [Phaseolus vulgaris]
 gb|ESW10703.1| hypothetical protein PHAVU_009G230600g [Phaseolus vulgaris]
Length=413

 Score =   324 bits (831),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDD++MLFDIQKFYNV++EELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTKDDDKMLFDIQKFYNVVVEELPSNVAELL  413



>ref|XP_009127949.1| PREDICTED: eukaryotic initiation factor 4A-3 isoform X2 [Brassica 
rapa]
Length=411

 Score =   324 bits (831),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  250  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  309

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  310  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  369

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T DDERML DIQKFYNV++EELP+NVADLL
Sbjct  370  RFGRKGVAINFMTTDDERMLSDIQKFYNVVVEELPSNVADLL  411



>ref|XP_010536184.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Tarenaya hassleriana]
Length=412

 Score =   324 bits (831),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTD+MR+RDHTVSATHG
Sbjct  251  GIKQFYVNVDKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDQMRARDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML DIQKFYNV+IEELPANVADL+
Sbjct  371  RFGRKGVAINFVTRDDERMLADIQKFYNVVIEELPANVADLI  412



>ref|XP_009127948.1| PREDICTED: eukaryotic initiation factor 4A-3 isoform X1 [Brassica 
rapa]
Length=414

 Score =   324 bits (831),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T DDERML DIQKFYNV++EELP+NVADLL
Sbjct  373  RFGRKGVAINFMTTDDERMLSDIQKFYNVVVEELPSNVADLL  414



>gb|ACJ84921.1| unknown [Medicago truncatula]
 gb|AFK40621.1| unknown [Medicago truncatula]
Length=413

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKL+TLCDLYETLAITQSV+FVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLDTLCDLYETLAITQSVVFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERML DIQKFYNV+IEELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTTDDERMLSDIQKFYNVLIEELPSNVAELL  413



>ref|XP_006390626.1| hypothetical protein EUTSA_v10018626mg [Eutrema salsugineum]
 gb|ESQ27912.1| hypothetical protein EUTSA_v10018626mg [Eutrema salsugineum]
Length=414

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T DDERML DIQKFYNV++EELP+NVADLL
Sbjct  373  RFGRKGVAINFMTTDDERMLSDIQKFYNVVVEELPSNVADLL  414



>gb|KJB54655.1| hypothetical protein B456_009G043400 [Gossypium raimondii]
 gb|KJB54656.1| hypothetical protein B456_009G043400 [Gossypium raimondii]
Length=412

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQN RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNARDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDERML+DIQ+FYNV+IEELP+NVADL+
Sbjct  371  RFGRKGVAINFVTTDDERMLYDIQRFYNVVIEELPSNVADLI  412



>dbj|BAH20352.1| AT1G54270 [Arabidopsis thaliana]
Length=328

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDK+RSRDHTVSATHG
Sbjct  167  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKVRSRDHTVSATHG  226

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  227  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  286

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD+RMLFDIQKFYNV++EELP+NVADLL
Sbjct  287  RFGRKGVAINFVTLDDQRMLFDIQKFYNVVVEELPSNVADLL  328



>sp|P41378.1|IF4A_WHEAT RecName: Full=Eukaryotic initiation factor 4A; Short=eIF-4A; 
AltName: Full=ATP-dependent RNA helicase eIF4A [Triticum aestivum]
Length=414

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENY HRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYQHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DERMLFDIQKFYNV+IEELPANVADLL
Sbjct  373  RFGRKGVAINFVTREDERMLFDIQKFYNVVIEELPANVADLL  414



>gb|ABK93239.1| unknown [Populus trichocarpa]
Length=413

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGI+VQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGINVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML DIQ+FYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLSDIQRFYNVTVEELPSNVADLL  413



>ref|XP_008793233.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
 ref|XP_008793234.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
Length=413

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DERML DIQ+FYNV++EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTREDERMLSDIQRFYNVLVEELPSNVADLL  413



>ref|XP_011079970.1| PREDICTED: eukaryotic initiation factor 4A-8 [Sesamum indicum]
Length=413

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGV+INF+TKDDERML DIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVSINFLTKDDERMLHDIQKFYNVVIEELPSNVADLL  413



>ref|XP_006302320.1| hypothetical protein CARUB_v10020373mg [Capsella rubella]
 gb|EOA35218.1| hypothetical protein CARUB_v10020373mg [Capsella rubella]
Length=414

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T DDERM+ DIQKFYNV++EELP+NVADLL
Sbjct  373  RFGRKGVAINFMTTDDERMMSDIQKFYNVVVEELPSNVADLL  414



>gb|EPS63850.1| hypothetical protein M569_10933 [Genlisea aurea]
Length=413

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+V++ KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTD+MR RDHTVSATHG
Sbjct  252  GIKQFYVDIAKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDRMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRD+IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLFDIQKFYNVVIEELPSNVADLL  413



>emb|CDY49861.1| BnaA02g16100D [Brassica napus]
Length=427

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  266  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  325

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  326  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  385

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T DDERML DIQKFYNV++EELP+NVADLL
Sbjct  386  RFGRKGVAINFMTTDDERMLSDIQKFYNVVVEELPSNVADLL  427



>ref|NP_001185220.1| eukaryotic initiation factor 4A-2 [Arabidopsis thaliana]
 gb|AEE33074.1| translation initiation factor 4A-2 [Arabidopsis thaliana]
Length=407

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  246  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  305

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  306  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  365

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD+RMLFDIQKFYNV++EELP+NVADLL
Sbjct  366  RFGRKGVAINFVTLDDQRMLFDIQKFYNVVVEELPSNVADLL  407



>ref|NP_175829.1| eukaryotic initiation factor 4A-2 [Arabidopsis thaliana]
 sp|P41377.1|IF4A2_ARATH RecName: Full=Eukaryotic initiation factor 4A-2; Short=eIF-4A-2; 
AltName: Full=ATP-dependent RNA helicase eIF4A-2; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 19 [Arabidopsis 
thaliana]
 gb|AAD25605.1|AC005287_7 Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AAK62368.1|AF386923_1 Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AAL16231.1|AF428462_1 At1g54270/F20D21_52 [Arabidopsis thaliana]
 emb|CAA46189.1| eukaryotic translation initiation factor 4A-2 [Arabidopsis thaliana]
 gb|AAM65512.1| eukaryotic translation initiation factor 4A, putative [Arabidopsis 
thaliana]
 gb|AAP37863.1| At1g54270 [Arabidopsis thaliana]
 dbj|BAE98493.1| Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AEE33073.1| translation initiation factor 4A-2 [Arabidopsis thaliana]
Length=412

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD+RMLFDIQKFYNV++EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTLDDQRMLFDIQKFYNVVVEELPSNVADLL  412



>ref|XP_006853908.1| hypothetical protein AMTR_s00036p00181640 [Amborella trichopoda]
 gb|ERN15375.1| hypothetical protein AMTR_s00036p00181640 [Amborella trichopoda]
Length=412

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV++EEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  251  GIKQFYVNVEREEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRD+IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML DIQ+FYNV+IEELP+NVADLL
Sbjct  371  RFGRKGVAINFVTRDDERMLLDIQRFYNVVIEELPSNVADLL  412



>ref|XP_010688701.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTD+MR+RDHTVSATHG
Sbjct  252  GIKQFYVNVNKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDQMRARDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDE+MLFDIQKFYNV+IEELPANVADL+
Sbjct  372  RFGRKGVAINFVTADDEKMLFDIQKFYNVVIEELPANVADLI  413



>ref|XP_006453066.1| hypothetical protein CICLE_v10008460mg [Citrus clementina]
 gb|ESR66306.1| hypothetical protein CICLE_v10008460mg [Citrus clementina]
 gb|KDO73515.1| hypothetical protein CISIN_1g0150931mg [Citrus sinensis]
Length=413

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNVDKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTD+MRSRDHTVSATHG
Sbjct  252  GIKQFHVNVDKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDQMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQN+RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNSRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DD+RML DIQ+FYNV+IEELPANVADL+
Sbjct  372  RFGRKGVAINFVTRDDDRMLADIQRFYNVVIEELPANVADLI  413



>ref|XP_006474427.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Citrus sinensis]
Length=413

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNVDKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTD+MRSRDHTVSATHG
Sbjct  252  GIKQFHVNVDKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDQMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQN+RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNSRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DD+RML DIQ+FYNV+IEELPANVADL+
Sbjct  372  RFGRKGVAINFVTRDDDRMLTDIQRFYNVVIEELPANVADLI  413



>sp|Q41741.1|IF4A_MAIZE RecName: Full=Eukaryotic initiation factor 4A; Short=eIF-4A; 
AltName: Full=ATP-dependent RNA helicase eIF4A [Zea mays]
 gb|AAA82736.1| translation initiation factor eIF-4A [Zea mays]
Length=410

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VN+DKE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  249  GIKQFYVNIDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  308

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  309  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  368

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDER++FD+Q+FYNV +EELPANVADLL
Sbjct  369  RFGRKGVAINFVTRDDERIVFDVQRFYNVTVEELPANVADLL  410



>ref|XP_010416036.1| PREDICTED: eukaryotic initiation factor 4A-3 [Camelina sativa]
 ref|XP_010428171.1| PREDICTED: eukaryotic initiation factor 4A-3 [Camelina sativa]
 ref|XP_010471304.1| PREDICTED: eukaryotic initiation factor 4A-3 [Camelina sativa]
Length=414

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T +DERML DIQKFYNV++EELP+NVADLL
Sbjct  373  RFGRKGVAINFMTTEDERMLSDIQKFYNVVVEELPSNVADLL  414



>ref|XP_010669372.1| PREDICTED: eukaryotic initiation factor 4A-9 [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTD+MR+RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDQMRARDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT  D+RMLFDIQKFYNV IEELPANVADL+
Sbjct  372  RFGRKGVAINFVTSTDDRMLFDIQKFYNVTIEELPANVADLI  413



>emb|CDO97887.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTD+MR RDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDQMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSR+LITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRILITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT++DE+MLFDIQKFYNV++EELP NVADLL
Sbjct  372  RFGRKGVAINFVTREDEKMLFDIQKFYNVVVEELPQNVADLL  413



>gb|AAR23806.1| initiation factor eIF4A-15 [Helianthus annuus]
Length=413

 Score =   322 bits (825),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DDE+ML DIQKFYNV++EELP+NVADL+
Sbjct  372  RFGRKGVAINFVTLDDEKMLGDIQKFYNVVVEELPSNVADLI  413



>ref|XP_009105938.1| PREDICTED: eukaryotic initiation factor 4A-3 [Brassica rapa]
Length=414

 Score =   322 bits (824),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T DDERM+ DIQKFYNV++EELP NVADLL
Sbjct  373  RFGRKGVAINFMTTDDERMMSDIQKFYNVVVEELPNNVADLL  414



>ref|XP_008242400.1| PREDICTED: eukaryotic initiation factor 4A-2 [Prunus mume]
Length=806

 Score =   333 bits (853),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  645  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  704

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  705  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  764

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  765  RFGRKGVAINFVTKDDERMLFDIQKFYNVLVEELPSNVADLL  806



>ref|XP_007135520.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 ref|XP_007135521.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 gb|ESW07514.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 gb|ESW07515.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
Length=413

 Score =   322 bits (824),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTTDDSRMLSDIQKFYNVTVEELPSNVADLL  413



>ref|XP_002888890.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65149.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=414

 Score =   322 bits (824),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T +DERML DIQ+FYNV++EELP+NVADLL
Sbjct  373  RFGRKGVAINFMTTEDERMLADIQRFYNVVVEELPSNVADLL  414



>ref|XP_003627168.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|AET01644.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGV+INFVT +D RML DIQKFYNV IEELP+NVADLL
Sbjct  372  RFGRKGVSINFVTGEDARMLADIQKFYNVTIEELPSNVADLL  413



>gb|ACU21478.1| unknown [Glycine max]
Length=413

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTADDSRMLSDIQKFYNVTVEELPSNVADLL  413



>gb|KHN06630.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV++E+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEREDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDE+MLFDIQKFYNV +EELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTKDDEKMLFDIQKFYNVQVEELPSNVAELL  413



>ref|NP_177417.1| eukaryotic initiation factor 4A-3 [Arabidopsis thaliana]
 sp|Q9CAI7.1|IF4A3_ARATH RecName: Full=Eukaryotic initiation factor 4A-3; Short=eIF-4A-3; 
AltName: Full=ATP-dependent RNA helicase eIF4A-3; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 23 [Arabidopsis 
thaliana]
 gb|AAG51861.1|AC010926_24 putative Eukaryotic initiation factor 4A; 30924-32477 [Arabidopsis 
thaliana]
 gb|AAL31217.1| At1g72730/F28P22_8 [Arabidopsis thaliana]
 gb|AAM65719.1| putative Eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAM98330.1| At1g72730/F28P22_8 [Arabidopsis thaliana]
 gb|AEE35365.1| translation initiation factor 4A-3 [Arabidopsis thaliana]
Length=414

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T +DERM+ DIQ+FYNV++EELP+NVADLL
Sbjct  373  RFGRKGVAINFMTSEDERMMADIQRFYNVVVEELPSNVADLL  414



>ref|XP_003531602.1| PREDICTED: eukaryotic initiation factor 4A-10 [Glycine max]
 gb|KHN11260.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTTDDSRMLSDIQKFYNVTVEELPSNVADLL  413



>ref|XP_004510408.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Cicer arietinum]
Length=413

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RML DIQKFYNV IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTMDDTRMLADIQKFYNVSIEELPSNVADLL  413



>ref|XP_007012324.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
 gb|EOY29943.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
Length=413

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTD++RSRDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDQLRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DD+RML DIQ+FYNV+IEELPANVADL+
Sbjct  372  RFGRKGVAINFVTRDDDRMLTDIQRFYNVVIEELPANVADLI  413



>gb|KEH39505.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=397

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  236  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  295

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  296  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  355

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT +D RML DIQKFYNV++EELP+NVADLL
Sbjct  356  RFGRKGVAINFVTLEDARMLADIQKFYNVIVEELPSNVADLL  397



>ref|XP_011072546.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Sesamum indicum]
Length=412

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  251  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T+DDE+ML DIQKFYNV+IEELP+NVADLL
Sbjct  371  RFGRKGVAINFLTRDDEKMLHDIQKFYNVIIEELPSNVADLL  412



>ref|XP_003597562.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|AES67813.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT +D RML DIQKFYNV++EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTLEDARMLADIQKFYNVIVEELPSNVADLL  413



>gb|ABR18348.1| unknown [Picea sitchensis]
 gb|ACN39814.1| unknown [Picea sitchensis]
 gb|ACN40764.1| unknown [Picea sitchensis]
Length=413

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR+RDHTVSATHG
Sbjct  252  GIKQFYVNVEKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRARDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV++EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKDDERMLQDIQRFYNVVVEELPSNVADLL  413



>emb|CAA09211.1| RNA helicase [Arabidopsis thaliana]
Length=441

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  280  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  339

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  340  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  399

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+T +DERM+ DIQ+FYNV++EELP+NVADLL
Sbjct  400  RFGRKGVAINFMTSEDERMMADIQRFYNVVVEELPSNVADLL  441



>ref|XP_007150491.1| hypothetical protein PHAVU_005G157100g [Phaseolus vulgaris]
 gb|ESW22485.1| hypothetical protein PHAVU_005G157100g [Phaseolus vulgaris]
Length=413

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTFDDSRMLSDIQKFYNVTVEELPSNVADLL  413



>ref|XP_006583001.1| PREDICTED: eukaryotic initiation factor 4A-10 [Glycine max]
Length=413

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGV+INFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  372  RFGRKGVSINFVTTDDARMLSDIQKFYNVTVEELPSNVADLL  413



>ref|XP_001758216.1| predicted protein [Physcomitrella patens]
 gb|EDQ77038.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVD+EEWKL+TLCDLYETLAITQSVIF+NTRRKVDWLTDKMR+RDHTVSATHG
Sbjct  253  GIKQFYVNVDREEWKLDTLCDLYETLAITQSVIFINTRRKVDWLTDKMRARDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DD+RML DIQKFYN +IEELP+NVADLL
Sbjct  373  RFGRKGVAINFVTRDDDRMLQDIQKFYNTVIEELPSNVADLL  414



>dbj|BAA02152.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAB21260.1| eukaryotic initiation factor 4A [Oryza sativa]
Length=413

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 160/162 (99%), Gaps = 1/162 (1%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTR KVDWLTDKMR RDHTVSATHG
Sbjct  253  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTR-KVDWLTDKMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELPANVADLL
Sbjct  372  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPANVADLL  413



>ref|XP_001783934.1| predicted protein [Physcomitrella patens]
 gb|EDQ51244.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVD+EEWKL+TLCDLYETLAITQSVIF+NTRRKVDWLTDKMR+RDHTVSATHG
Sbjct  252  GIKQFYVNVDREEWKLDTLCDLYETLAITQSVIFINTRRKVDWLTDKMRARDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTK+DERML DIQ+FYN +IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKEDERMLQDIQRFYNTVIEELPSNVADLL  413



>ref|XP_009361722.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=868

 Score =   332 bits (852),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  707  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  766

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  767  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  826

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  827  RFGRKGVAINFVTKDDERMLFDIQKFYNVVVEELPSNVADLL  868



>gb|KHN39326.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   319 bits (818),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGV+INFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  372  RFGRKGVSINFVTMDDARMLSDIQKFYNVTVEELPSNVADLL  413



>ref|XP_002514133.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF48087.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=764

 Score =   329 bits (844),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQFHVNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  603  GIKQFHVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  662

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGR G
Sbjct  663  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRGG  722

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQKFYNV++EELP+NVADLL
Sbjct  723  RFGRKGVAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL  764



>ref|XP_001765568.1| predicted protein [Physcomitrella patens]
 gb|EDQ69618.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   319 bits (818),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVD+EEWKL+TLCDLYETLAITQSVIF+NTRRKVDWLTDKMR+RDHTVSATHG
Sbjct  252  GIKQFYVNVDREEWKLDTLCDLYETLAITQSVIFINTRRKVDWLTDKMRARDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTK+DERML DIQ+FYN ++EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTKEDERMLQDIQRFYNTVVEELPSNVADLL  413



>gb|EYU21355.1| hypothetical protein MIMGU_mgv1a0072631mg [Erythranthe guttata]
Length=413

 Score =   319 bits (817),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+ ++DE+ML DIQKFYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFLVREDEKMLQDIQKFYNVVIEELPSNVADLL  413



>gb|EAZ02256.1| hypothetical protein OsI_24355 [Oryza sativa Indica Group]
Length=426

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 158/159 (99%), Gaps = 0/159 (0%)
 Frame = -3

Query  704  QFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMD  525
            +F+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMD
Sbjct  268  EFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMD  327

Query  524  QNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFG  345
            QNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFG
Sbjct  328  QNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFG  387

Query  344  RKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RKGVAINFVT+DDERMLFDIQ+FYNV+IEELPANVADLL
Sbjct  388  RKGVAINFVTRDDERMLFDIQRFYNVVIEELPANVADLL  426



>ref|XP_004486853.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Cicer arietinum]
Length=412

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR  DHTVSATHG
Sbjct  251  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGNDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  371  RFGRKGVAINFVTLDDARMLSDIQKFYNVTVEELPSNVADLL  412



>gb|AFK44355.1| unknown [Medicago truncatula]
Length=286

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  125  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  184

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  185  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  244

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTK+DE ML DIQKFYNV++EELP+NVA+L 
Sbjct  245  RFGRKGVAINFVTKEDEGMLRDIQKFYNVLVEELPSNVAELF  286



>gb|KHN30068.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVDKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTLDDARMLSDIQKFYNVTVEELPSNVADLL  413



>gb|KHN32709.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVDKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTLDDARMLSDIQKFYNVTVEELPSNVADLL  413



>ref|XP_003543580.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Glycine max]
 ref|XP_003546753.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X1 
[Glycine max]
 ref|XP_006597198.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X2 
[Glycine max]
Length=413

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVDKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTLDDARMLSDIQKFYNVTVEELPSNVADLL  413



>ref|XP_001691452.1| eukaryotic initiation factor 4A-like protein [Chlamydomonas reinhardtii]
 gb|EDP05185.1| eukaryotic initiation factor 4A-like protein [Chlamydomonas reinhardtii]
Length=413

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKL+TLCDLYETLAITQSVIF NTRRKVDWLTDKMR RDHTVSATHG
Sbjct  252  GIKQFYVNVDKEEWKLDTLCDLYETLAITQSVIFANTRRKVDWLTDKMRERDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRD+IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYN +IEELP+NVADL+
Sbjct  372  RFGRKGVAINFVTKDDERMLQDIQRFYNTVIEELPSNVADLI  413



>gb|AFK40852.1| unknown [Lotus japonicus]
Length=413

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS DHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARG+DVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGVDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT DD RML DIQKFYNV +EELP+NVADLL
Sbjct  372  RFGRKGVAINFVTLDDSRMLSDIQKFYNVTVEELPSNVADLL  413



>gb|AAY33860.1| eukaryotic initiation factor 4A [Cenchrus americanus]
Length=414

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  253  GIKQFYVNVEKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  312

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  313  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  372

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DD+RM FDIQ+FY+V+IEELP NVADLL
Sbjct  373  RFGRKGVAINFVTRDDDRMQFDIQRFYSVVIEELPTNVADLL  414



>gb|ACJ84369.1| unknown [Medicago truncatula]
Length=242

 Score =   312 bits (800),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  81   GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  140

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQV LVIN+DLPTQPENYLHRIGRSG
Sbjct  141  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVFLVINFDLPTQPENYLHRIGRSG  200

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTK+DE ML DIQKFYNV++EELP+NVA+L 
Sbjct  201  RFGRKGVAINFVTKEDEGMLRDIQKFYNVLVEELPSNVAELF  242



>ref|XP_001771324.1| predicted protein [Physcomitrella patens]
 gb|EDQ63884.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVD+EEWKL+TLCDLYETLAITQSVIF+NTRRKVDWLTDKMR+RDHTVSATHG
Sbjct  252  GIKQFYVNVDREEWKLDTLCDLYETLAITQSVIFINTRRKVDWLTDKMRARDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DD+RML DIQ+FYN +IEELP+NVADLL
Sbjct  372  RFGRKGVAINFVTRDDDRMLQDIQRFYNTVIEELPSNVADLL  413



>ref|XP_009403035.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   317 bits (813),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GI+QF+VNV+KEEWKL+TLCDLYE L ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIRQFYVNVEKEEWKLDTLCDLYEALTITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVL+TTDLLARGIDVQQVS+VINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLVTTDLLARGIDVQQVSMVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKG AINFVT+DDERMLFDIQ+FYNV+IEELP+NVADL+
Sbjct  372  RFGRKGSAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLI  413



>gb|KEH32495.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   317 bits (813),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTK+DE ML DIQKFYNV++EELP+NVA+LL
Sbjct  372  RFGRKGVAINFVTKEDEGMLRDIQKFYNVLVEELPSNVAELL  413



>gb|EYU45869.1| hypothetical protein MIMGU_mgv1a007331mg [Erythranthe guttata]
Length=410

 Score =   317 bits (812),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVSATHG
Sbjct  249  GIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHG  308

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  309  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  368

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGV+INF+T +DE+ML DIQKFYNV+IEELP+NVADLL
Sbjct  369  RFGRKGVSINFLTTEDEKMLGDIQKFYNVVIEELPSNVADLL  410



>gb|KEH32494.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=430

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  269  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  328

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  329  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  388

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTK+DE ML DIQKFYNV++EELP+NVA+LL
Sbjct  389  RFGRKGVAINFVTKEDEGMLRDIQKFYNVLVEELPSNVAELL  430



>ref|XP_002982302.1| hypothetical protein SELMODRAFT_228839 [Selaginella moellendorffii]
 gb|EFJ16547.1| hypothetical protein SELMODRAFT_228839 [Selaginella moellendorffii]
Length=412

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV++E+WKL+TLCDLYETLAITQSVIF NTRRKVDWLTDK+RSRDHTVSATHG
Sbjct  251  GIKQFYVNVEREDWKLDTLCDLYETLAITQSVIFCNTRRKVDWLTDKLRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+TKDDE+MLFDIQKFYN +IEELP+NVADL+
Sbjct  371  RFGRKGVAINFLTKDDEKMLFDIQKFYNTVIEELPSNVADLI  412



>ref|XP_002966232.1| hypothetical protein SELMODRAFT_143895 [Selaginella moellendorffii]
 gb|EFJ32259.1| hypothetical protein SELMODRAFT_143895 [Selaginella moellendorffii]
Length=412

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV++E+WKL+TLCDLYETLAITQSVIF NTRRKVDWLTDK+RSRDHTVSATHG
Sbjct  251  GIKQFYVNVEREDWKLDTLCDLYETLAITQSVIFCNTRRKVDWLTDKLRSRDHTVSATHG  310

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  311  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  370

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+TKDDE+MLFDIQKFYN +IEELP+NVADL+
Sbjct  371  RFGRKGVAINFLTKDDEKMLFDIQKFYNTVIEELPSNVADLI  412



>ref|XP_010656491.1| PREDICTED: uncharacterized protein LOC100244028 [Vitis vinifera]
Length=827

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/162 (96%), Positives = 162/162 (100%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  666  GIKQFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  725

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  726  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  785

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERMLFDIQ+FYNV+IEELP+NVADLL
Sbjct  786  RFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPSNVADLL  827



>gb|AAN74636.1| DEAD box RNA helicase [Pisum sativum]
Length=413

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFV K+DE ML DIQKFYNV++EELP+NVA+LL
Sbjct  372  RFGRKGVAINFVNKEDEAMLQDIQKFYNVLVEELPSNVAELL  413



>gb|ACN40838.1| unknown [Picea sitchensis]
Length=411

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV++E+WKL+TLCDLYETLAITQSVIF+NTRRKVDWLTD+MR+RDHTVSATHG
Sbjct  250  GIKQFYVNVEREDWKLDTLCDLYETLAITQSVIFINTRRKVDWLTDQMRARDHTVSATHG  309

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  310  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  369

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVTKDDERML DIQ+FYNV+IEELP NVADL+
Sbjct  370  RFGRKGVAINFVTKDDERMLQDIQRFYNVVIEELPNNVADLI  411



>ref|XP_006858971.1| hypothetical protein AMTR_s00068p00116790 [Amborella trichopoda]
 gb|ERN20438.1| hypothetical protein AMTR_s00068p00116790 [Amborella trichopoda]
Length=286

 Score =   310 bits (795),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV++E++KL+TLCDLYETLAITQSVIFVNTRRKVDWLTDK+RSRDHTVSATHG
Sbjct  125  GIKQFYVNVNREDFKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKLRSRDHTVSATHG  184

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  185  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  244

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT +DERML DIQ+FYNV++EELP+NVADLL
Sbjct  245  RFGRKGVAINFVTGEDERMLTDIQRFYNVVVEELPSNVADLL  286



>ref|XP_009381599.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   314 bits (805),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GI QF+VNV+KEEWKLETLCD+YETL ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GINQFYVNVEKEEWKLETLCDIYETLTITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRD+IMREFRSGSSRVLITTDLLARGIDVQQVS+VINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDVIMREFRSGSSRVLITTDLLARGIDVQQVSMVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKG AINFVT DD+RMLFDIQ+FYNV+I+ELP+NVADL+
Sbjct  372  RFGRKGNAINFVTSDDDRMLFDIQRFYNVVIQELPSNVADLI  413



>gb|KIZ04417.1| Eukaryotic initiation factor 4A-3 [Monoraphidium neglectum]
Length=451

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV+KE+WKL+TLCDLYETLAITQSVIF NTRRKVDWLTDKMR RDHTVSATHG
Sbjct  290  GIKQFYVNVEKEDWKLDTLCDLYETLAITQSVIFANTRRKVDWLTDKMRERDHTVSATHG  349

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRD+IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  350  DMDQNTRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  409

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINFVT+DDERML DIQ+FYN +IEELP+NVADL+
Sbjct  410  RFGRKGVAINFVTRDDERMLQDIQRFYNTVIEELPSNVADLI  451



>emb|CDY32586.1| BnaC03g15540D [Brassica napus]
Length=378

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GI+QF+V+VDKEEWK ETLCDLYETLAITQSVIFVNTRRKVDWLT+KMRSRDHTVSATHG
Sbjct  217  GIRQFYVDVDKEEWKFETLCDLYETLAITQSVIFVNTRRKVDWLTEKMRSRDHTVSATHG  276

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQP NYLHRIGRSG
Sbjct  277  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPANYLHRIGRSG  336

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKG AINFVT+DDE+ML DIQKFYN+++EELP+N+ADLL
Sbjct  337  RFGRKGAAINFVTRDDEKMLADIQKFYNMVVEELPSNLADLL  378



>gb|EPS65096.1| hypothetical protein M569_09681 [Genlisea aurea]
Length=413

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+V++ +E++KL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG
Sbjct  252  GIKQFYVDIGREDYKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  311

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRD+IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  312  DMDQNTRDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  371

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+TKDDERML DIQ+FYNV+IEELP+NVADLL
Sbjct  372  RFGRKGVAINFMTKDDERMLADIQRFYNVVIEELPSNVADLL  413



>gb|ABR16834.1| unknown [Picea sitchensis]
Length=286

 Score =   309 bits (792),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  713  GIKQFHVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHG  534
            GIKQF+VNV++E+WKL+TLCDLYETLAITQSVIF+NTRRKVD LTD+MR+RDHTVSATHG
Sbjct  125  GIKQFYVNVEREDWKLDTLCDLYETLAITQSVIFINTRRKVDMLTDQMRARDHTVSATHG  184

Query  533  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  354
            DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG
Sbjct  185  DMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSG  244

Query  353  RFGRKGVAINFVTKDDERMLFDIQKFYNVMIEELPANVADLL  228
            RFGRKGVAINF+TKDDERML DIQ+FYNV++EELP NVADL+
Sbjct  245  RFGRKGVAINFITKDDERMLQDIQRFYNVVVEELPNNVADLI  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210