BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021C10

Length=651
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                                300   3e-100   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          299   1e-95    Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                299   1e-95    Ipomoea batatas [batate]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      249   5e-76    Nicotiana tomentosiformis
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 245   1e-74    Elaeis guineensis
dbj|BAH20283.1|  AT1G20620                                              233   3e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 243   5e-74    Eucalyptus grandis [rose gum]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      243   7e-74    Nicotiana sylvestris
gb|AGC65520.1|  catalase                                                243   7e-74    Eriobotrya japonica [loquat]
gb|ABY19573.1|  catalase                                                236   8e-74    Manihot esculenta [manioc]
gb|AAX84671.1|  catalase CAT2                                           236   1e-73    Manihot esculenta [manioc]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                241   2e-73    Citrus sinensis [apfelsine]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      241   3e-73    Prunus mume [ume]
ref|NP_001289779.1|  catalase isozyme 1                                 241   3e-73    Nelumbo nucifera [Indian lotus]
gb|AFR42410.1|  catalase                                                230   3e-73    Eperua falcata
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             241   3e-73    Citrus clementina [clementine]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             241   4e-73    Prunus persica
emb|CAD42908.1|  catalase                                               241   5e-73    Prunus persica
gb|ABR15776.1|  catalase                                                234   6e-73    Litchi
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          240   8e-73    Avicennia marina
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      240   1e-72    Elaeis guineensis
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               240   1e-72    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    240   1e-72    Gossypium raimondii
emb|CAB56850.1|  catalase                                               238   1e-72    Prunus persica
dbj|BAF91369.1|  catalase                                               240   1e-72    Capsicum annuum
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 240   1e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      240   1e-72    Eucalyptus grandis [rose gum]
ref|XP_002306976.2|  catalase family protein                            239   1e-72    
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         239   1e-72    Tarenaya hassleriana [spider flower]
gb|AIX10947.1|  putative catalase                                       239   1e-72    Gardenia jasminoides
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 239   2e-72    Nicotiana tomentosiformis
gb|AAB88173.1|  catalase                                                234   2e-72    Glycine max [soybeans]
gb|AAM97542.1|  catalase 3                                              239   2e-72    Capsicum annuum
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      239   3e-72    
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      239   3e-72    
emb|CDP07287.1|  unnamed protein product                                239   3e-72    Coffea canephora [robusta coffee]
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    239   4e-72    Capsicum annuum
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      238   4e-72    Nelumbo nucifera [Indian lotus]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      238   4e-72    Populus euphratica
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      238   4e-72    Phoenix dactylifera
gb|KJB14249.1|  hypothetical protein B456_002G115900                    234   5e-72    Gossypium raimondii
ref|XP_010061175.1|  PREDICTED: catalase-like                           238   6e-72    Eucalyptus grandis [rose gum]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      238   6e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 238   7e-72    Nicotiana sylvestris
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 238   7e-72    Prunus mume [ume]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 238   1e-71    Phoenix dactylifera
gb|AFR42412.1|  catalase                                                226   1e-71    Eperua falcata
emb|CAI43948.1|  catalase                                               238   1e-71    Populus deltoides
ref|XP_002301920.1|  catalase family protein                            237   1e-71    Populus trichocarpa [western balsam poplar]
gb|AAA57551.1|  catalase                                                234   1e-71    Nicotiana sylvestris
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 237   2e-71    Populus euphratica
gb|ACJ11733.1|  catalase                                                237   2e-71    Gossypium hirsutum [American cotton]
gb|AIS20825.1|  CAT                                                     236   2e-71    Pyrus x bretschneideri [bai li]
ref|XP_010498496.1|  PREDICTED: catalase-3                              236   2e-71    Camelina sativa [gold-of-pleasure]
ref|XP_009110221.1|  PREDICTED: catalase-3                              236   3e-71    Brassica rapa
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           236   3e-71    
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      236   4e-71    
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           236   4e-71    Sesamum indicum [beniseed]
ref|NP_001031072.3|  catalase 3                                         233   4e-71    Arabidopsis thaliana [mouse-ear cress]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     238   4e-71    Eucalyptus grandis [rose gum]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    236   5e-71    Arabis alpina [alpine rockcress]
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          236   5e-71    Solanum melongena [aubergine]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      236   6e-71    Nicotiana tomentosiformis
gb|KHG25152.1|  Catalase isozyme 1                                      235   6e-71    Gossypium arboreum [tree cotton]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          235   6e-71    Soldanella alpina
gb|ADC95629.1|  catalase                                                235   7e-71    Bruguiera gymnorhiza [Burma mangrove]
emb|CDP07288.1|  unnamed protein product                                235   7e-71    Coffea canephora [robusta coffee]
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    235   7e-71    Nicotiana tabacum [American tobacco]
emb|CDY29519.1|  BnaA06g14510D                                          235   7e-71    Brassica napus [oilseed rape]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      235   8e-71    Nicotiana sylvestris
emb|CDY31488.1|  BnaC05g15970D                                          235   8e-71    Brassica napus [oilseed rape]
emb|CDY33636.1|  BnaC08g19360D                                          235   8e-71    Brassica napus [oilseed rape]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             235   8e-71    Prunus persica
emb|CAD42909.1|  catalase                                               235   8e-71    Prunus persica
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         235   8e-71    Brassica rapa
ref|XP_009149539.1|  PREDICTED: catalase-3                              236   1e-70    Brassica rapa
gb|AGV54297.1|  peroxisomal catalase                                    235   1e-70    Phaseolus vulgaris [French bean]
gb|AEQ30070.1|  catalase                                                234   1e-70    Litchi chinensis [litchi]
gb|AHF27428.1|  catalase                                                231   1e-70    Cucurbita moschata [ayote]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             234   1e-70    Phaseolus vulgaris [French bean]
gb|AJE26131.1|  catalase                                                234   1e-70    Salix matsudana [tortured willow]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             234   1e-70    Eutrema salsugineum [saltwater cress]
gb|AGE15298.2|  catalase 1                                              234   1e-70    Eriobotrya japonica [loquat]
dbj|BAJ33995.1|  unnamed protein product                                234   1e-70    Eutrema halophilum
gb|ACJ73905.1|  CAT1                                                    224   1e-70    Solanum nigrum
ref|NP_001268098.1|  catalase                                           234   1e-70    Vitis vinifera
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 234   2e-70    Vitis vinifera
ref|NP_001237571.1|  catalase-4                                         234   2e-70    Glycine max [soybeans]
emb|CDY01364.1|  BnaA07g11370D                                          236   2e-70    
emb|CAC04509.1|  catalase                                               227   2e-70    Digitalis lanata [Grecian foxglove]
dbj|BAH20307.1|  AT1G20620                                              233   2e-70    Arabidopsis thaliana [mouse-ear cress]
gb|AAR84578.1|  catalase 1a                                             234   2e-70    Lotus japonicus
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          234   2e-70    Amborella trichopoda
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      234   2e-70    Citrus sinensis [apfelsine]
ref|NP_001240021.1|  catalase                                           234   2e-70    Glycine max [soybeans]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             234   2e-70    Citrus clementina [clementine]
gb|ACJ76836.3|  catalase                                                234   3e-70    Dimocarpus longan [longan]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    234   3e-70    Gossypium raimondii
gb|AET97564.1|  catalase                                                234   3e-70    Ziziphus jujuba [Chinese jujube]
dbj|BAQ21275.1|  catalase                                               233   3e-70    Citrus tamurana
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      234   4e-70    
ref|NP_564120.1|  catalase 3                                            233   4e-70    Arabidopsis thaliana [mouse-ear cress]
emb|CDY31878.1|  BnaC07g15280D                                          233   4e-70    Brassica napus [oilseed rape]
dbj|BAC79443.1|  catalase                                               233   4e-70    Acacia ampliceps
ref|XP_010530333.1|  PREDICTED: catalase-2                              233   4e-70    Tarenaya hassleriana [spider flower]
gb|AAM65021.1|  unknown                                                 233   4e-70    Arabidopsis thaliana [mouse-ear cress]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 233   4e-70    Manihot esculenta [manioc]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      233   4e-70    Solanum lycopersicum
gb|AAF19965.1|AF207906_1  catalase 1                                    233   5e-70    Zantedeschia aethiopica [arum-lily]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             233   5e-70    Phaseolus vulgaris [French bean]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               233   6e-70    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      233   6e-70    Vitis vinifera
ref|XP_007018034.1|  Catalase 2                                         233   7e-70    
ref|NP_001291326.1|  catalase isozyme 1                                 233   7e-70    Sesamum indicum [beniseed]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          233   7e-70    Amborella trichopoda
gb|ACV30589.1|  catalase                                                223   8e-70    Carica papaya [mamon]
ref|NP_001237556.1|  catalase-1/2                                       233   8e-70    Glycine max [soybeans]
gb|AAG43363.1|AF151368_1  catalase                                      232   1e-69    Hevea brasiliensis [jebe]
emb|CCP37650.1|  catalase-1                                             232   1e-69    Nicotiana tabacum [American tobacco]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             232   1e-69    
gb|ACL27272.1|  catalase                                                232   1e-69    Nicotiana benthamiana
gb|ACV92695.1|  catalase                                                232   1e-69    Brassica oleracea
emb|CAA64220.1|  catalase                                               232   1e-69    Arabidopsis thaliana [mouse-ear cress]
gb|AFU48609.1|  catalase 1                                              232   1e-69    Nicotiana benthamiana
emb|CDX76313.1|  BnaA08g10870D                                          231   2e-69    
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             232   2e-69    Capsella rubella
gb|AFU90823.1|  catalase                                                230   2e-69    Populus x beijingensis
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      231   2e-69    Elaeis guineensis
gb|AAB86582.2|  catalase                                                231   2e-69    Raphanus sativus
gb|AFU90822.1|  catalase                                                231   2e-69    Populus tomentosa [Chinese white poplar]
gb|AAF71742.1|AF248491_1  catalase                                      231   2e-69    Raphanus sativus
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               231   2e-69    Gossypium hirsutum [American cotton]
ref|NP_195235.1|  catalase 2                                            231   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      231   2e-69    Cucumis melo [Oriental melon]
prf||1906388A  catalase                                                 231   2e-69 
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             231   2e-69    Capsella rubella
emb|CAA45564.1|  catalase                                               231   2e-69    Arabidopsis thaliana [mouse-ear cress]
gb|AAK96854.1|  catalase                                                231   2e-69    Arabidopsis thaliana [mouse-ear cress]
gb|AAB62892.1|  catalase-1                                              231   2e-69    Nicotiana glutinosa
gb|AIA61608.1|  catalase                                                231   3e-69    Gynostemma pentaphyllum [jiaogulan]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 231   3e-69    Solanum tuberosum [potatoes]
gb|AAD17935.1|  catalase                                                231   3e-69    Brassica juncea [brown mustard]
gb|AAB71764.1|  catalase 1                                              231   3e-69    Nicotiana tabacum [American tobacco]
emb|CDY40645.1|  BnaA03g53180D                                          231   3e-69    Brassica napus [oilseed rape]
ref|XP_009138342.1|  PREDICTED: catalase-2                              231   4e-69    Brassica rapa
gb|KFK30147.1|  catalase                                                231   5e-69    Arabis alpina [alpine rockcress]
gb|AAC48918.1|  salicylic acid binding catalase                         230   5e-69    Nicotiana tabacum [American tobacco]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               230   5e-69    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAD17936.1|  catalase                                                230   5e-69    Brassica juncea [brown mustard]
gb|AAD30292.1|AF139539_1  catalase 3                                    230   5e-69    Raphanus sativus
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               230   5e-69    Ricinus communis
gb|ABM47415.1|  catalase                                                230   5e-69    Prunus avium [gean]
gb|ACA50528.1|  putative catalase 2                                     230   5e-69    Brassica napus [oilseed rape]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               230   6e-69    Cucurbita pepo
prf||2104177A  catalase                                                 230   8e-69 
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         230   8e-69    Tarenaya hassleriana [spider flower]
gb|AAD30291.2|AF139538_1  catalase 2                                    230   8e-69    Raphanus sativus
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          230   8e-69    Helianthus annuus
emb|CDY17510.1|  BnaC03g65530D                                          229   8e-69    Brassica napus [oilseed rape]
emb|CDX72514.1|  BnaC07g45360D                                          229   8e-69    
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             230   9e-69    
ref|NP_001235974.1|  catalase-3                                         230   9e-69    Glycine max [soybeans]
gb|ACJ73906.1|  CAT2                                                    225   9e-69    Solanum nigrum
emb|CDP01803.1|  unnamed protein product                                230   9e-69    Coffea canephora [robusta coffee]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          230   1e-68    Vigna radiata var. radiata [golden gram]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             230   1e-68    Populus trichocarpa [western balsam poplar]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     230   1e-68    Sesamum indicum [beniseed]
ref|XP_010094556.1|  Catalase isozyme 1                                 229   1e-68    Morus notabilis
dbj|BAJ87148.1|  predicted protein                                      224   1e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAZ29552.1|  catalase-C                                              229   1e-68    Oryza sativa Indica Group [Indian rice]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      229   1e-68    Nicotiana sylvestris
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         229   2e-68    Tarenaya hassleriana [spider flower]
ref|NP_001048861.1|  Os03g0131200                                       229   2e-68    
gb|AAD37788.1|AF149283_1  catalase 1                                    228   2e-68    Phaseolus vulgaris [French bean]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              229   2e-68    
dbj|BAA34205.1|  catalase                                               229   2e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         229   2e-68    Camelina sativa [gold-of-pleasure]
gb|AAC49807.1|  catalase 3                                              229   2e-68    Arabidopsis thaliana [mouse-ear cress]
gb|AFW69584.1|  catalase1                                               225   2e-68    
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              229   2e-68    Cicer arietinum [garbanzo]
ref|XP_010437527.1|  PREDICTED: catalase-2                              229   2e-68    Camelina sativa [gold-of-pleasure]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       229   2e-68    Cucumis sativus [cucumbers]
ref|XP_009106100.1|  PREDICTED: catalase-2                              229   2e-68    Brassica rapa
ref|XP_011022275.1|  PREDICTED: catalase-like                           228   2e-68    Populus euphratica
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      229   3e-68    
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      229   3e-68    Nicotiana tomentosiformis
ref|NP_001234827.1|  catalase isozyme 1                                 228   3e-68    Solanum lycopersicum
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               228   3e-68    Gossypium hirsutum [American cotton]
gb|KHG12976.1|  Catalase isozyme 2                                      228   3e-68    Gossypium arboreum [tree cotton]
gb|AHF27433.1|  catalase                                                228   3e-68    Cucurbita maxima [Boston marrow]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              228   3e-68    Populus euphratica
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      228   3e-68    Phoenix dactylifera
gb|AAR14052.2|  catalase                                                228   4e-68    Solanum tuberosum [potatoes]
gb|AHF27430.1|  catalase                                                228   4e-68    Cucurbita moschata [ayote]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                228   4e-68    Erythranthe guttata [common monkey flower]
gb|ACB11496.1|  catalase                                                228   4e-68    Pinus sylvestris [Scotch pine]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 228   4e-68    Oryza brachyantha
ref|NP_001234186.1|  catalase isozyme 2                                 228   4e-68    
gb|AAY59707.1|  catalase                                                228   5e-68    Oryza sativa Indica Group [Indian rice]
gb|ABQ44283.1|  catalase                                                224   5e-68    Saccharum hybrid cultivar NCo 376
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          228   5e-68 
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              228   5e-68    Populus euphratica
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    228   5e-68    Oryza sativa Indica Group [Indian rice]
gb|AAC19397.1|  leaf catalase                                           228   6e-68    Mesembryanthemum crystallinum
emb|CDY52649.1|  BnaAnng11640D                                          226   7e-68    Brassica napus [oilseed rape]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               227   9e-68    Ricinus communis
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         227   1e-67    Camelina sativa [gold-of-pleasure]
gb|ACJ22771.1|  catalase 1                                              227   1e-67    Jatropha curcas
ref|XP_007046520.1|  Catalase 2                                         227   1e-67    Theobroma cacao [chocolate]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 227   1e-67    Cucumis melo [Oriental melon]
dbj|BAA34204.1|  catalase                                               227   1e-67    Oryza sativa Japonica Group [Japonica rice]
gb|AAO17721.1|  catalase                                                227   1e-67    Hypericum perforatum
dbj|BAA05494.1|  catalase                                               226   1e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      226   2e-67    Solanum tuberosum [potatoes]
ref|NP_001058635.1|  Os06g0727200                                       226   2e-67    
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         226   2e-67    Oryza brachyantha
gb|AAC17729.1|  catalase 1                                              224   2e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADZ45555.1|  catalase                                                226   2e-67    Vigna radiata [mung bean]
gb|ABC01913.1|  catalase isozyme 1-like protein                         226   2e-67    Solanum tuberosum [potatoes]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              226   3e-67    
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         226   3e-67    Jatropha curcas
gb|ABK24453.1|  unknown                                                 226   3e-67    Picea sitchensis
gb|AAF79625.1|AC027665_26  F5M15.5                                      233   4e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CAA42720.1|  catalase-1                                             225   4e-67    Zea mays [maize]
ref|NP_001241808.1|  catalase isozyme B                                 225   5e-67    Zea mays [maize]
gb|AAD17933.1|  catalase                                                225   5e-67    Brassica juncea [brown mustard]
gb|AIU99479.1|  catalase                                                225   5e-67    Saccharum arundinaceum
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      225   5e-67    Cucumis melo [Oriental melon]
gb|AAM97541.1|  catalase 2                                              225   5e-67    Capsicum annuum
gb|AHF21552.1|  catalase                                                225   6e-67    Hylocereus undatus [dragon fruit]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 225   6e-67    Tarenaya hassleriana [spider flower]
gb|AFN81243.1|  catalase 1                                              225   6e-67    Brassica rapa subsp. pekinensis [bai cai]
gb|ADZ45556.1|  catalase                                                225   7e-67    Vigna radiata [mung bean]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               225   7e-67    Cucurbita pepo
ref|NP_001274863.1|  catalase isozyme 1                                 225   7e-67    Solanum tuberosum [potatoes]
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               224   8e-67    Solanum tuberosum [potatoes]
gb|AHF27429.1|  catalase                                                224   9e-67    Cucurbita moschata [ayote]
gb|AHF27432.1|  catalase                                                224   9e-67    Cucurbita maxima [Boston marrow]
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 224   9e-67    
emb|CAG23920.1|  catalase                                               224   9e-67    Festuca arundinacea [tall fescue]
gb|ADM96039.1|  catalase                                                224   1e-66    Cucumis sativus [cucumbers]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 224   1e-66    
gb|KJB17473.1|  hypothetical protein B456_003G002800                    224   1e-66    Gossypium raimondii
gb|AIU99488.1|  catalase                                                224   1e-66    Saccharum hybrid cultivar ROC22
gb|AAR97905.1|  catalase                                                224   1e-66    Solanum tuberosum [potatoes]
gb|AIU99481.1|  catalase                                                224   1e-66    Saccharum spontaneum [fodder cane]
emb|CAA85470.1|  catalase                                               224   1e-66    Solanum tuberosum [potatoes]
gb|AIM43584.1|  catalase                                                224   1e-66    Saccharum hybrid cultivar Yacheng05-179
gb|AIU99484.1|  catalase                                                224   1e-66    Saccharum arundinaceum
gb|AIU99485.1|  catalase                                                224   2e-66    Saccharum spontaneum [fodder cane]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               224   2e-66    Solanum tuberosum [potatoes]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       224   2e-66    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003558892.1|  PREDICTED: catalase-1                              224   2e-66    Brachypodium distachyon [annual false brome]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      224   2e-66    Brachypodium distachyon [annual false brome]
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               224   2e-66    Cucurbita pepo
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          224   2e-66    
gb|EMT05040.1|  Catalase-1                                              224   2e-66    
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               224   2e-66    Hordeum vulgare [barley]
gb|AFR53082.1|  CAT                                                     224   2e-66    Anthurium andraeanum [flamingo-lily]
emb|CDX69111.1|  BnaC01g03420D                                          223   2e-66    
gb|ACL35349.1|  catalase                                                223   3e-66    Picea glauca
ref|XP_002890395.1|  F5M15.5                                            230   3e-66    
ref|NP_001105415.1|  catalase isozyme 1                                 223   3e-66    
ref|XP_002510677.1|  catalase, putative                                 230   3e-66    
emb|CDP01802.1|  unnamed protein product                                223   4e-66    Coffea canephora [robusta coffee]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       221   4e-66    Cucumis sativus [cucumbers]
gb|AAC17731.1|  catalase 1                                              223   5e-66    Arabidopsis thaliana [mouse-ear cress]
gb|AIU99480.1|  catalase                                                223   5e-66    Saccharum spontaneum [fodder cane]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         223   6e-66    Setaria italica
ref|NP_564121.1|  catalase 1                                            222   6e-66    Arabidopsis thaliana [mouse-ear cress]
gb|EPS69543.1|  catalase                                                222   7e-66    Genlisea aurea
gb|AHA50082.1|  catalase                                                222   8e-66    Eleutherococcus senticosus
dbj|BAJ90861.1|  predicted protein                                      222   8e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH36312.1|  catalase heme-binding enzyme                            222   1e-65    Medicago truncatula
gb|ACN36234.1|  unknown                                                 218   1e-65    Zea mays [maize]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                222   1e-65    Erythranthe guttata [common monkey flower]
gb|AIU99482.1|  catalase                                                221   2e-65    Saccharum hybrid cultivar ROC22
gb|AIU99486.1|  catalase                                                221   2e-65    Saccharum spontaneum [fodder cane]
ref|XP_010692546.1|  PREDICTED: catalase                                221   2e-65    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ88747.1|  predicted protein                                      222   2e-65    
gb|AIZ77475.1|  catalase                                                221   3e-65    
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 222   3e-65    
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    221   3e-65    
gb|AIU99487.1|  catalase                                                221   3e-65    
gb|AIP93616.1|  CAT1                                                    220   3e-65    
gb|AAK67359.2|AF390210_1  catalase                                      220   4e-65    
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             221   4e-65    
gb|AAF61732.1|AF243517_1  catalase 2                                    220   4e-65    
ref|XP_002521709.1|  catalase, putative                                 220   5e-65    
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    220   5e-65    
emb|CDY31877.1|  BnaC07g15270D                                          220   6e-65    
gb|AAB07026.1|  catalase 1                                              219   7e-65    
emb|CDY01363.1|  BnaA07g11360D                                          219   7e-65    
ref|XP_009103333.1|  PREDICTED: catalase-1                              219   7e-65    
ref|XP_010692544.1|  PREDICTED: catalase-like                           219   9e-65    
gb|ADU56199.1|  catalase                                                219   1e-64    
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               219   1e-64    
gb|ADU56198.1|  catalase                                                219   1e-64    
gb|AIU99483.1|  catalase                                                219   2e-64    
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         219   2e-64    
gb|AAG61140.2|AF332973_1  catalase 2                                    218   3e-64    
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      218   4e-64    
gb|AAL00886.1|  catalase                                                212   5e-64    
gb|AHB72694.1|  catalase                                                217   6e-64    
tpg|DAA43177.1|  TPA: catalase2                                         217   7e-64    
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               216   1e-63    
ref|NP_001105310.1|  catalase isozyme 2                                 216   1e-63    
prf||1803522A  catalase                                                 216   1e-63 
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             216   1e-63    
gb|ADN94253.1|  catalase                                                216   1e-63    
gb|AAF61733.1|AF243518_1  catalase 3                                    216   1e-63    
emb|CAE82295.1|  catalase                                               216   2e-63    
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 222   2e-63    
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      216   2e-63    
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             216   2e-63    
gb|ABB72796.1|  catalase isozyme 1-like protein                         215   5e-63    
gb|AAC19398.1|  root catalase                                           215   5e-63    
tpg|DAA43178.1|  TPA: catalase2                                         215   7e-63    
gb|AAF61734.1|AF243519_1  catalase 4                                    214   7e-63    
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             214   1e-62    
gb|ABY21704.1|  catalase-1 precursor                                    214   1e-62    
gb|ABV55108.1|  catalase 2                                              214   1e-62    
gb|KHG21219.1|  Catalase isozyme 1                                      212   2e-62    
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      213   2e-62    
ref|NP_001031073.1|  catalase 3                                         213   3e-62    
gb|ADK25939.1|  catalase                                                205   3e-62    
gb|ACH63223.1|  catalase                                                213   3e-62    
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             213   4e-62    
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      212   7e-62    
dbj|BAH37035.1|  catalase 1                                             211   1e-61    
gb|AFD29285.1|  catalase                                                211   1e-61    
dbj|BAA34714.1|  catalase                                               210   2e-61    
emb|CAA10286.1|  catalase                                               199   4e-61    
dbj|BAD07937.1|  catalase catA-like protein                             199   5e-61    
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   210   3e-60    
emb|CDY31490.1|  BnaC05g15990D                                          207   3e-60    
emb|CDY29518.1|  BnaA06g14520D                                          207   3e-60    
ref|XP_009149540.1|  PREDICTED: catalase-1                              207   4e-60    
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            207   5e-60    
gb|AJF34884.1|  catalase                                                206   1e-59    
gb|ACL81498.1|  catalase                                                206   1e-59    
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         206   1e-59    
gb|AFI48111.1|  catalase isozyme B                                      193   4e-59    
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         204   4e-59    
gb|ABY68162.1|  catalase                                                192   8e-59    
gb|ABY68164.1|  catalase                                                192   1e-58    
gb|ABY68159.1|  catalase                                                192   1e-58    
ref|XP_010477308.1|  PREDICTED: catalase-1                              203   1e-58    
gb|ABY68158.1|  catalase                                                192   1e-58    
ref|XP_001779509.1|  predicted protein                                  203   1e-58    
gb|AFI48054.1|  catalase isozyme B                                      191   4e-58    
gb|ABY68160.1|  catalase                                                191   4e-58    
gb|ABY68161.1|  catalase                                                190   6e-58    
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              201   9e-58    
gb|AFI48068.1|  catalase isozyme B                                      189   1e-57    
dbj|BAH56915.1|  AT1G20620                                              201   1e-57    
gb|AFI48101.1|  catalase isozyme B                                      189   2e-57    
gb|AAC17730.1|  catalase 2                                              197   3e-57    
dbj|BAH19523.1|  AT4G35090                                              199   3e-57    
ref|NP_001031791.1|  catalase 2                                         199   3e-57    
dbj|BAJ92414.1|  predicted protein                                      199   4e-57    
ref|XP_010105996.1|  Catalase isozyme 1                                 196   4e-57    
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             200   4e-57    
gb|AAX88799.1|  catalase                                                199   6e-57    
emb|CAH61266.1|  catalase                                               199   8e-57    
gb|ADY02963.1|  catalase                                                198   9e-57    
gb|EMS51034.1|  Catalase isozyme 2                                      199   1e-56    
gb|AFI48131.1|  catalase isozyme B                                      187   1e-56    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               198   1e-56    
ref|NP_001045673.1|  Os02g0115700                                       198   1e-56    
ref|XP_001752315.1|  predicted protein                                  197   2e-56    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          198   2e-56    
gb|ABN71233.2|  catalase                                                197   2e-56    
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 197   2e-56    
gb|AFI48098.1|  catalase isozyme B                                      186   2e-56    
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      195   1e-55    
gb|EMS61345.1|  Catalase isozyme 1                                      197   2e-55    
ref|XP_001784759.1|  predicted protein                                  195   2e-55    
gb|AFI48130.1|  catalase isozyme B                                      184   2e-55    
gb|ABK24449.1|  unknown                                                 195   2e-55    
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      194   2e-55    
gb|ADQ28492.1|  catalase                                                194   3e-55    
gb|EMT06167.1|  Catalase isozyme 2                                      197   4e-55    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      194   5e-55    
gb|AGI65617.1|  catalase                                                191   3e-54    
ref|XP_005645077.1|  catalase                                           191   7e-54    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          190   7e-54    
emb|CBI29556.3|  unnamed protein product                                179   2e-53    
gb|AGT16203.1|  catalase                                                189   4e-53    
gb|AII23739.1|  catalase                                                188   5e-53    
gb|ABR16304.1|  unknown                                                 188   5e-53    
gb|ABK24543.1|  unknown                                                 188   7e-53    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           187   9e-53 
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    188   1e-52    
emb|CAA43814.1|  catalase                                               187   1e-52    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          187   2e-52    
gb|ABK41476.1|  catalase                                                185   1e-51    
gb|AFK46618.1|  unknown                                                 171   2e-50    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              181   3e-50    
gb|AGT15888.1|  catalase                                                179   1e-49    
gb|KIY96954.1|  catalase                                                176   1e-49    
gb|AGT16188.1|  catalase                                                179   1e-49    
gb|AGT16054.1|  catalase                                                179   1e-49    
gb|AFW66787.1|  catalase3                                               179   1e-49    
gb|AGT16310.1|  catalase                                                179   1e-49    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               179   1e-49    
gb|AID50071.1|  catalase                                                169   2e-49    
dbj|BAD94702.1|  catalase                                               168   2e-49    
gb|AHZ13843.1|  catalase                                                179   3e-49    
gb|ABY68163.1|  catalase                                                166   2e-48    
gb|AFW66785.1|  catalase3 isoform 1                                     179   2e-48    
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     175   3e-48    
gb|EMS35721.1|  Catalase isozyme 1                                      167   6e-47    
ref|XP_002950455.1|  catalase                                           171   2e-46    
gb|AEY70510.1|  catalase                                                165   5e-46    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      169   7e-46    
ref|XP_011396830.1|  Catalase isozyme 2                                 168   2e-45    
ref|XP_001696763.1|  catalase/peroxidase                                167   4e-45    
ref|NP_001105416.1|  catalase isozyme 3                                 167   8e-45    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        166   9e-45    
ref|XP_005708279.1|  catalase                                           164   5e-44    
emb|CAA73663.1|  catalase                                               164   6e-44    
gb|AAB70006.1|  catalase                                                164   9e-44    
gb|AFW66789.1|  catalase3                                               158   2e-43    
gb|AFW66788.1|  catalase3                                               158   9e-42    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             155   8e-41    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            155   1e-40 
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              152   1e-39    
gb|AAR84577.1|  catalase 1b                                             151   2e-39    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    150   3e-39    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      148   5e-38    
gb|ABS72010.1|  putative catalase                                       138   5e-38    
gb|ABB88582.1|  catalase                                                147   7e-38    
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             140   1e-37    
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like                 137   3e-37    
gb|KJB17474.1|  hypothetical protein B456_003G002800                    143   1e-36    
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like                 135   2e-36    
gb|KDD77132.1|  catalase                                                142   4e-36    
emb|CAA42026.1|  catalase                                               132   2e-35    
gb|AAO16182.1|  catalase-1                                              127   3e-33    
ref|XP_005536240.1|  catalase                                           130   1e-31    
gb|AAP57673.1|  catalase                                                125   5e-31    
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333             120   8e-31    
emb|CDY43951.1|  BnaC04g21590D                                          122   2e-30    
emb|CDY31866.1|  BnaC07g15160D                                          122   3e-30    
gb|ABB51561.1|  truncated catalase 2                                    124   1e-29    
gb|AFH53190.1|  catalase                                                120   2e-29    
gb|AFH53189.1|  catalase                                                120   2e-29    
gb|AFH53187.1|  catalase                                                120   2e-29    
gb|AGS17821.1|  catalase 2                                              122   4e-29    
ref|XP_005712277.1|  unnamed protein product                            122   8e-29    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      117   2e-27    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             116   7e-27    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 115   9e-27    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 115   9e-27    
emb|CDP22058.1|  unnamed protein product                                108   6e-26    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             113   7e-26    
ref|XP_004366029.2|  catalase isozyme 2                                 111   7e-25    
gb|KJE89728.1|  catalase isozyme 2                                      112   7e-25    
gb|ACU23083.1|  unknown                                                 107   1e-24    
gb|AFN85536.1|  catalase                                                100   8e-24    
ref|NP_973873.1|  catalase 3                                            106   2e-23    
gb|ABR25882.1|  catalase isozyme b                                    98.6    6e-23    
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     103   7e-23    
gb|AAY34915.1|  catalase                                              96.7    2e-22    
gb|KEH36313.1|  catalase heme-binding enzyme                            102   5e-22    
ref|XP_005644653.1|  catalase-domain-containing protein                 103   7e-22    
ref|XP_005647994.1|  catalase-domain-containing protein                 102   1e-21    
gb|AEA86295.1|  putative catalase                                     97.4    2e-21    
gb|ABS89000.1|  catalase                                              95.5    8e-21    
gb|AFA36510.1|  catalase                                              94.0    1e-19    
ref|XP_002963082.1|  hypothetical protein SELMODRAFT_79329            90.1    1e-19    
gb|AAR25790.1|  catalase                                              90.1    2e-19    
ref|XP_005642928.1|  catalase                                         95.9    2e-19    
ref|WP_043830984.1|  catalase                                         92.4    4e-18    
gb|ADR01107.1|  catalase 3                                            89.7    9e-18    
gb|AHB35639.1|  catalase                                              87.4    1e-17    
ref|WP_044037961.1|  catalase                                         90.5    2e-17    
ref|WP_026826608.1|  catalase                                         89.7    3e-17    
ref|WP_037277190.1|  catalase                                         89.7    3e-17    
ref|WP_015881004.1|  catalase                                         89.0    5e-17    
ref|WP_029723487.1|  catalase                                         88.6    6e-17    
emb|CCQ26769.2|  perixode catalase                                    82.0    6e-17    
ref|WP_016429054.1|  hypothetical protein                             88.6    6e-17    
ref|WP_032664185.1|  catalase                                         88.6    9e-17    
ref|WP_034418237.1|  catalase                                         88.2    1e-16    
ref|WP_032632526.1|  catalase                                         87.8    1e-16    
gb|ACJ71245.1|  catalase 2                                            87.0    1e-16    
gb|KIQ35234.1|  catalase                                              87.4    2e-16    
ref|WP_043304355.1|  catalase                                         87.4    2e-16    
ref|WP_026673818.1|  catalase                                         87.4    3e-16    
ref|WP_004887231.1|  catalase                                         87.0    3e-16    
ref|WP_032610664.1|  catalase                                         86.7    4e-16    
ref|WP_003355010.1|  catalase                                         86.3    5e-16    
ref|WP_033543820.1|  catalase                                         85.9    6e-16    
ref|WP_031421259.1|  catalase                                         85.9    6e-16    
ref|WP_032884665.1|  catalase                                         85.9    6e-16    
ref|WP_027605312.1|  catalase                                         85.5    8e-16    
ref|WP_043193175.1|  catalase                                         85.5    9e-16    
gb|EXU30623.1|  catalase family protein                               81.6    9e-16    



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   300 bits (768),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/144 (98%), Positives = 144/144 (100%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADTHRHRLGPNYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT
Sbjct  30   ADTHRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  89

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            PLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWI
Sbjct  90   PLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWI  149

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYLTQADRSLGQKVASRLNIRPTM
Sbjct  150  SYLTQADRSLGQKVASRLNIRPTM  173



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/144 (98%), Positives = 144/144 (100%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADTHRHRLGPNYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT
Sbjct  349  ADTHRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            PLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWI
Sbjct  409  PLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYLTQADRSLGQKVASRLNIRPTM
Sbjct  469  SYLTQADRSLGQKVASRLNIRPTM  492



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/144 (98%), Positives = 144/144 (100%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADTHRHRLGPNYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT
Sbjct  349  ADTHRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            PLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWI
Sbjct  409  PLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYLTQADRSLGQKVASRLNIRPTM
Sbjct  469  SYLTQADRSLGQKVASRLNIRPTM  492



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            PLR++TG+RDKC++EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PLRVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLNIRPTM
Sbjct  469  SYWSQADKSLGQKIASRLNIRPTM  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP 
Sbjct  349  ADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI+TGRR+KCVI KENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT+EIR+ WI
Sbjct  409  PFRILTGRREKCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q DRSLGQK+A+RLN++P+M
Sbjct  469  SYWSQCDRSLGQKIATRLNVKPSM  492



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score =   233 bits (594),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PT
Sbjct  2    GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPT  61

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WI
Sbjct  62   PTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWI  121

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  122  SYWSQADRSLGQKLASRLNVRPSI  145



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DTHR+RLGPNY+ LPVNAPKCA+HNN +DG+MN +HRDEE++YFPSKFD  R+AER+P 
Sbjct  349  SDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +IVTG+R+K +IEKENNFKQPG+RYRSWAPDRQ+RFINRW+K+L+EPRVTHE RS WI
Sbjct  409  PSQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQAD+SLGQK+ASRL+ RP+M
Sbjct  469  SYWTQADKSLGQKLASRLSARPSM  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPRVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD++LGQK+ASRLN+RPTM
Sbjct  469  SYWSQADKTLGQKIASRLNVRPTM  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS++   R+AE FP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVT+EIRS WI
Sbjct  409  PSNIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRS GQK+A+RLN+RP++
Sbjct  469  SYWSQADRSFGQKLATRLNVRPSI  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   236 bits (601),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY +LPVNAPKC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P 
Sbjct  118  ADTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPL  177

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+
Sbjct  178  PHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWV  237

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D+SLGQK+ASRLN+RP  
Sbjct  238  SYWSQCDKSLGQKLASRLNVRPNF  261



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY +LPVNAPKC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P 
Sbjct  127  ADTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPL  186

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+
Sbjct  187  PHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWV  246

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D+SLGQK+ASRLN+RP  
Sbjct  247  SYWSQCDKSLGQKLASRLNVRPNF  270



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY++LPVNAPKC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P 
Sbjct  334  GDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPI  393

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+
Sbjct  394  PSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWV  453

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  454  SYWSQADRSLGQKLASRLNVRPSI  477



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  RNAERFP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+LLP NAPKCA+HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WI
Sbjct  409  PPQICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN++P+M
Sbjct  469  SYWSQADKSLGQKLASRLNVKPSM  492



>gb|AFR42410.1| catalase, partial [Eperua falcata]
Length=135

 Score =   230 bits (586),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  622  PNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRR  443
            PN++ LPVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS+FD  R+A+RFP P  IVTG+R
Sbjct  1    PNHLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRFDPVRHAKRFPIPPAIVTGKR  60

Query  442  DKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRS  263
            ++C+IEKEN+FKQPG+RYRSWAPDRQDRF+ RWV+ L++PRVTHEIRS WISYL+QADRS
Sbjct  61   ERCIIEKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWISYLSQADRS  120

Query  262  LGQKVASRLNIRPTM  218
            LGQKVAS LN+RP++
Sbjct  121  LGQKVASHLNMRPSI  135



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY++LPVNAPKC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P 
Sbjct  350  GDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPI  409

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+
Sbjct  410  PSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWV  469

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  470  SYWSQADRSLGQKLASRLNVRPSI  493



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WI
Sbjct  409  PPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WI
Sbjct  409  PPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   234 bits (598),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP 
Sbjct  148  GDTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPI  207

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+
Sbjct  208  PGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWV  267

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP +
Sbjct  268  SYWSQADKSLGQKIASRLNVRPNI  291



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+LLPVNAPKCAYHNN YDG+MNF+HRDEEVDYFPSK+D TR+AER P 
Sbjct  349  GDTQRHRLGPNYLLLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSKYDPTRHAERHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TGRRD+ VIEKE+NFKQ GDRYRSWAPDRQ+RF+ RWV +LS+PR+T EIRS W+
Sbjct  409  PNAVITGRRDRRVIEKEDNFKQAGDRYRSWAPDRQERFLRRWVDALSDPRLTLEIRSIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+S GQK+ASRLN+RPTM
Sbjct  469  SYWSQADKSFGQKLASRLNVRPTM  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP 
Sbjct  349  ADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI+TGRR+KCVI KENNFKQPG+RYRSW P+RQ+RFI RWV++LS+PRVTHEI+S WI
Sbjct  409  PSRILTGRREKCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D+SLGQK+A+RLN++P M
Sbjct  469  SYWSQCDKSLGQKIATRLNVKPCM  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +D  RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P 
Sbjct  349  SDAQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS W 
Sbjct  409  PPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWF  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD++LGQK+ASRLN+RPTM
Sbjct  469  SYWSQADKTLGQKIASRLNVRPTM  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D +R+AERFP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFINRWV ++S+PRVTHEIRS WI
Sbjct  409  PPALCTGKREKCIIEKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            +Y +QAD+SLGQK+ASRLN+RP++
Sbjct  469  TYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P 
Sbjct  280  SDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPI  339

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WI
Sbjct  340  PSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWI  399

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  400  SYWSQADKSLGQKLASRLNVRPSI  423



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PRVTHEIRS WI
Sbjct  409  PSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP 
Sbjct  349  SDTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  +VTGRR+K +I KENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVTHEIR  WI
Sbjct  409  PSSVVTGRREKSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D+SLGQK+A+RLN++PTM
Sbjct  469  SYWSQCDKSLGQKIATRLNVKPTM  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DTHR+RLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEE++YFPSKFD  R+AER+P 
Sbjct  349  SDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +IVTG+R++ +IEKENNFKQ G+RYRSWAPDRQ+RFINRW+K+LSEPRVTHE RS WI
Sbjct  409  PSQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQAD+S+GQK+AS L+ RP+M
Sbjct  469  SYWTQADKSIGQKLASSLSARPSM  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WI
Sbjct  409  PSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+AS LN+RP++
Sbjct  469  SYWSQADKSLGQKLASHLNVRPSV  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AERFP+
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPS  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV++LS+ R THEIRS WI
Sbjct  409  PPAICSGRREKCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP+ 
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSF  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DTHRHRLGPNY+ LPVNAPKCA+HNN YDGYMN +HRDEE+DYFPS++D  R+AER P 
Sbjct  349  SDTHRHRLGPNYLQLPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TGRR++ VIEKENNFKQP +RYRSWAPDRQ+RF+ RWV +LS+PR+THEIRS WI
Sbjct  409  PTRVLTGRRERRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+A RLN+RPTM
Sbjct  469  SYWSQADKSLGQKIAFRLNVRPTM  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AE++P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEI + WI
Sbjct  409  PPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLG+K+ASRLN+RPTM
Sbjct  469  SYWSQADKSLGEKIASRLNVRPTM  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  165  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPI  224

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WI
Sbjct  225  PPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWI  284

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRL++RP +
Sbjct  285  SYWSQADRSLGQKIASRLSMRPNI  308



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P 
Sbjct  349  ADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++ G+RD+C+I+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LSEPRVTHEIR+ W+
Sbjct  409  PPRVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWL  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN++PTM
Sbjct  469  SYWSQADKSLGQKLASRLNVKPTM  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WI
Sbjct  409  PSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRS GQK+ASRLN+RP++
Sbjct  469  SYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WI
Sbjct  409  PSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRS GQK+ASRLN+RP++
Sbjct  469  SYWSQADRSFGQKLASRLNVRPSI  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  +++G+RDKCVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+ RVTHEIRS WI
Sbjct  409  PPPVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+A+RLN+RPTM
Sbjct  469  SYWSQADKSLGQKIATRLNVRPTM  492



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PR THEIRS WI
Sbjct  409  PSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRATHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP 
Sbjct  349  SDTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI TG+R+KCVIEKENNFKQPG+RYRS+ PDRQ+RFI RW  +LS+PRVTHEIRS WI
Sbjct  409  PPRICTGKREKCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+A+RLN++P+M
Sbjct  469  SYWSQADKSLGQKLATRLNVKPSM  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WI
Sbjct  409  PSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+AS LN+RP++
Sbjct  469  SYWSQADKSLGQKLASHLNVRPSI  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  349  ADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TGRR+KCVI KENNFKQPG+RYRSWAPDRQ RFI RWV++LS+PRVT+EIRS WI
Sbjct  409  PSCVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q DRSLGQK+A+RLN++P+M
Sbjct  469  SYWSQCDRSLGQKIATRLNVKPSM  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   234 bits (596),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP 
Sbjct  201  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPI  260

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  261  PPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWI  320

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+S+GQK+ASRLN+RP++
Sbjct  321  SYWSQADKSVGQKLASRLNVRPSI  344



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WI
Sbjct  409  PPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQAD+SLGQK+AS LN+RP+M
Sbjct  469  SYWTQADKSLGQKIASCLNVRPSM  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY++LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  R+AERFP 
Sbjct  349  SDTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG+R+KC+I KENNFKQPG+RYRS++PDRQ+RFI RWV++LS+P+VTHEIRS WI
Sbjct  409  PTRVLTGKREKCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D+SL QK+A+RL+++P+M
Sbjct  469  SYWSQCDKSLSQKLATRLSVKPSM  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   238 bits (607),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKCA+HNN ++G MNF++RDEEV+YFPS+FD  R+AE++P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEIR  WI
Sbjct  409  PPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLG+K+ASRLN+RPTM
Sbjct  469  SYWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   238 bits (607),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I+ G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PSNILYGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P 
Sbjct  349  ADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI+TGRR+KCVI+KENNFKQPG+RYRSW PDRQ RFI RWV++LS+PRVTHEI+S WI
Sbjct  409  PSRILTGRREKCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D+SLG+K+A+RLN++P+M
Sbjct  469  SYWSQCDKSLGRKIATRLNVKPSM  492



>gb|AFR42412.1| catalase, partial [Eperua falcata]
Length=131

 Score =   226 bits (576),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -3

Query  607  LPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  428
            LPVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS+FD  R+AERFP P  IVTG+R++C+I
Sbjct  2    LPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRFDPVRHAERFPIPPAIVTGKRERCII  61

Query  427  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  248
            EKEN+FKQPG+RYRSWAPDRQDRF+ RWV+ L++PRVTHEIRS WISYL+QADRSLGQKV
Sbjct  62   EKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKV  121

Query  247  ASRLNIRPTM  218
            AS LN+RP++
Sbjct  122  ASHLNMRPSI  131



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P 
Sbjct  240  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPI  299

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI
Sbjct  300  PSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWI  359

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  360  SYLSQADKSCGQKVASRLTLKPTM  383



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++LS+PRVTHEIRS WI
Sbjct  409  PPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WI
Sbjct  409  PSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRS GQK+ASRLN+RP++
Sbjct  469  SYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WI
Sbjct  409  PTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WI
Sbjct  409  PTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+
Sbjct  409  PPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP M
Sbjct  469  SYWSQADKSLGQKLASRLNVRPAM  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WI
Sbjct  409  PSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRS GQK+ASRLN+RP++
Sbjct  469  SYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+
Sbjct  409  PPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+AS LN+RPTM
Sbjct  469  SYWSQADKSLGQKLASHLNVRPTM  492



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PT
Sbjct  234  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPT  293

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WI
Sbjct  294  PTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWI  353

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  354  SYWSQADRSLGQKLASRLNVRPSI  377



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP 
Sbjct  441  ADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPI  500

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WI
Sbjct  501  PPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWI  560

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQAD+SLGQK+AS LN+RP+M
Sbjct  561  SYWTQADKSLGQKIASCLNVRPSM  584



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPV  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KCVI+KENNFKQPGDRYRSWAPDRQDRFI RWV+ LSEPR+THEIR  WI
Sbjct  409  PSKSYTGIRTKCVIKKENNFKQPGDRYRSWAPDRQDRFIKRWVEILSEPRLTHEIRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WI
Sbjct  409  PSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLLVKPTM  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI
Sbjct  409  PSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTVKPTM  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++ S+PRVTHEIRS WI
Sbjct  409  PPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G MNF+HRDEEV+YFPS+FD  R+AER P 
Sbjct  349  ADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TG+RD+C+IEKENNFKQPG+RYR++APDRQ+RF+ RWV +LS+PRVTHEIRS WI
Sbjct  409  PPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQAD+SLGQK+ASRLN+RPTM
Sbjct  469  SYWTQADKSLGQKLASRLNVRPTM  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+Y PS+FD  R+AERFP 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TGRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF +RWV++LS+PRVTHEI S WI
Sbjct  409  PPAVCTGRREKCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQ D+ LGQK+A+RLN+RP++
Sbjct  469  SYWTQCDKFLGQKLATRLNVRPSI  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNYM LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS+FD  R+A R P 
Sbjct  349  GDTQRHRLGPNYMQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ G+RD+CVI KENNFKQ G+RYRSWAPDRQ+RFI RWV  LS+ RVTHEIRS WI
Sbjct  409  PSTVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+A+RLN+RPTM
Sbjct  469  SYWSQADKSLGQKMATRLNVRPTM  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI
Sbjct  409  PSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTLKPTM  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WI
Sbjct  409  PNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI
Sbjct  409  PSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTLKPTM  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  357  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  416

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WI
Sbjct  417  PNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWI  476

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  477  SYWSQADRSLGQKLASRLNVRPSI  500



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WI
Sbjct  409  PNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ SRLN+RP++
Sbjct  469  SYWSQADKSLGQKLLSRLNVRPSI  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ SRLN+RP++
Sbjct  469  SYWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WI
Sbjct  409  PNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  400  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  459

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WI
Sbjct  460  PNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWI  519

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  520  SYWSQADRSLGQKLASRLNVRPSI  543



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN+RP +
Sbjct  469  SYWSQADRSLGQKIASHLNMRPNI  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP 
Sbjct  344  GDTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPI  403

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+
Sbjct  404  PGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWV  463

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP +
Sbjct  464  SYWSQADKSLGQKIASRLNVRPNI  487



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P 
Sbjct  201  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPH  260

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WI
Sbjct  261  PPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWI  320

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN+RP++
Sbjct  321  SYWSQADRSLGQKLASHLNVRPSI  344



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN+RP +
Sbjct  469  SYWSQADRSLGQKIASHLNMRPNI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PR THEIRS WI
Sbjct  409  PPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS++   R+AE FP 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSE RVT+EIRS WI
Sbjct  409  PSSIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRS GQK+A+RLN+RP++
Sbjct  469  SYWSQADRSFGQKLATRLNVRPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P 
Sbjct  25   SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEIYPI  84

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P ++ +G+R+KC+I+KENNFKQ G+RYR++ PDRQ+RF+ RWV+ LS+PR+T+EIRS WI
Sbjct  85   PSKVCSGKREKCIIQKENNFKQAGERYRTFTPDRQERFVRRWVEPLSDPRITYEIRSIWI  144

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  145  SYWSQADKSLGQKLASRLNVRPSI  168



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKCA+HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WI
Sbjct  409  PSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRP  224
            SY +QADRSLGQK+ASRLN++P
Sbjct  469  SYWSQADRSLGQKLASRLNVKP  490



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKCA+HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WI
Sbjct  409  PSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRP  224
            SY +QADRSLGQK+ASRLN++P
Sbjct  469  SYWSQADRSLGQKLASRLNVKP  490



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS L+ RP +
Sbjct  469  SYWSQADRSLGQKIASHLSTRPNI  492



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  413  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  472

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WI
Sbjct  473  PNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWI  532

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  533  SYWSQADRSLGQKLASRLNVRPSI  556



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP 
Sbjct  122  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPH  181

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   + G+RD+  IEKENNFKQPG++YRS+ PDRQ+RFI RWV +LS+PR+THEIRS W+
Sbjct  182  PPVALNGKRDRICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWV  241

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQAD+SLGQK+ASRLNIRPTM
Sbjct  242  SYWTQADKSLGQKLASRLNIRPTM  265



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PT
Sbjct  315  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPT  374

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WI
Sbjct  375  PTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWI  434

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  435  SYWSQADRSLGQKLASRLNVRPSI  458



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TG R++C IEKENNFKQPG+RYRS+APDRQDRF+ RWV +LS+PRVTHEIRSTWI
Sbjct  409  PPAICTGSRERCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN+RP++
Sbjct  469  SYWSQADRSLGQKIASHLNLRPSI  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY++LPVNAPKCA+HNN YDG+MNF HRDEEVDYFPS+FD  R+AER P 
Sbjct  349  GDTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPL  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P ++V+G+R++CVIEKENNFKQPGDRYRS+APDRQ+RF+ R V +LS+ RVTHEIRS WI
Sbjct  409  PPQLVSGKRERCVIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D+SLGQK+A+RLNI+P M
Sbjct  469  SYWSQCDKSLGQKIATRLNIKPHM  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WI
Sbjct  409  PPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QA +SLGQK+ASRLN+RP +
Sbjct  469  SYWSQACKSLGQKLASRLNVRPNI  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRL++RP +
Sbjct  469  SYWSQADRSLGQKIASRLSMRPNI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WI
Sbjct  409  PPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QA +SLGQK+ASRLN+RP +
Sbjct  469  SYWSQACKSLGQKLASRLNVRPNI  492



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP 
Sbjct  349  GDTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT E+RS W+
Sbjct  409  PSRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP +
Sbjct  469  SYWSQADKSLGQKIASRLNVRPNI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+S+GQK+ASRLN+RP++
Sbjct  469  SYWSQADKSVGQKLASRLNVRPSI  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I  G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WI
Sbjct  409  PSAIFNGKREKCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PT
Sbjct  333  ADTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPT  392

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIR  WI
Sbjct  393  PPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWI  452

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QA +SLGQK+ +RLN+RP++
Sbjct  453  SYWSQACKSLGQKLTARLNVRPSI  476



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PT
Sbjct  369  ADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPT  428

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WI
Sbjct  429  PPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWI  488

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QA +SLGQK+ASRLN+RP +
Sbjct  489  SYWSQACKSLGQKLASRLNVRPNI  512



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PT
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WI
Sbjct  409  PTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WI
Sbjct  409  PNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHR+GPNY+ LPVNAPKCA+HNN YDG MNF+HRDEEVDYFPS++D  R+AE+FP 
Sbjct  349  GDTQRHRIGPNYLQLPVNAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRYDTARHAEKFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   + GRRD+ +IEKENNFKQPGD YR+WAPDRQ+RFI RW+  LS+P+VTHE+RS WI
Sbjct  409  PPVNLIGRRDRRIIEKENNFKQPGDLYRTWAPDRQERFIRRWIGVLSDPKVTHEVRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QADRSLGQKVAS LN+RP++
Sbjct  469  SYLSQADRSLGQKVASHLNMRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR++C+IEKENNFKQPG+RYRS+ PDRQ+RFI RW+++LS+PR+THEIRS WI
Sbjct  409  PPVICSGRRERCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADQSLGQKLASRLNVRPSI  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PT
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WI
Sbjct  409  PTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY +LPVNAPKCAYHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P 
Sbjct  349  ADTQRHRLGPNYKMLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERSPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+ R V +LSEPR+T EIRS W+
Sbjct  409  PNAICSGRREKCVIEKENNFKQPGERYRSWAPDRQERFLCRLVNALSEPRITFEIRSIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY ++ D SLGQK+ASRLN+RP +
Sbjct  469  SYWSKCDASLGQKLASRLNVRPNI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G MNF+HRDEEV+Y PS+ D  R+AE++P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG+R+K +IEKENNFKQPG+ YRSWAPDRQ+RF+ RWV +LS+PR THEIRS WI
Sbjct  409  PPRVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLNIRPTM
Sbjct  469  SYWSQADKSLGQKLASRLNIRPTM  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  349  ADTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI+ G R+KC I+KENNFKQPG++YRSWAPDRQ+RFI RW+ +LS+PRVTHEIR+ WI
Sbjct  409  PPRILNGGREKCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            +Y +Q D+ LGQK+ASRLNI+PT+
Sbjct  469  TYWSQCDKFLGQKLASRLNIKPTL  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+ +P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P 
Sbjct  349  ADSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPV  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WI
Sbjct  409  PPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN++P++
Sbjct  469  SYWSQADRSLGQKIASHLNLKPSI  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++ GRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI
Sbjct  409  PSRVLNGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTLKPTM  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I+TGRR+KC+I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WI
Sbjct  409  PPAILTGRREKCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AERFP 
Sbjct  349  ADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            +Y +QA +SLGQK+ASRLN++P +
Sbjct  469  TYWSQACKSLGQKLASRLNVKPNI  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D TR++E +P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  +++G+R+K  IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PR+THEIRS WI
Sbjct  409  PPVVLSGKREKRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RPTM
Sbjct  469  SYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY++LP NAPKCA+HNN YDG+MNF HRDEEVDYFPS+FD  R+AE+FP 
Sbjct  349  SDTQRHRLGPNYLMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPM  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +I +G+R+KC+IEKENNFKQPG+RYRS+A DRQ+RFI RWV +LS+PRVTHEI S WI
Sbjct  409  PPQICSGKREKCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D+SLGQK+A+ LN++P M
Sbjct  469  SYWSQCDKSLGQKLATHLNLKPNM  492



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score =   223 bits (567),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  646  DTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPN+M LPVNAPKCA+ NN +DGYMNF+HRDEEV+Y PSKFD   NAER+P P
Sbjct  27   DTQRHRLGPNFMQLPVNAPKCAHRNNHFDGYMNFMHRDEEVNYHPSKFDPVTNAERYPIP  86

Query  466  LRIVTG-RRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
             ++ +  +R+KC+IEK+N+FKQPG+RYR++ PDRQ+RFINRWVK+LSEPR+THEIRS WI
Sbjct  87   TKVYSACKREKCIIEKQNDFKQPGERYRTFEPDRQERFINRWVKALSEPRITHEIRSIWI  146

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
             +L++AD SLG+KVA RLNIRP++
Sbjct  147  DWLSRADESLGRKVAMRLNIRPSI  170



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   233 bits (593),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPV  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI+ G+R+KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WI
Sbjct  409  PPRILGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN++P++
Sbjct  469  SYWSQADRSLGQKIASHLNLKPSI  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLG NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R++ERFP 
Sbjct  349  SDTQRHRLGSNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRRDKCVIEKENNF+QPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+RS WI
Sbjct  409  PSTICSGRRDKCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQ DRSLGQK+A RLN+RP++
Sbjct  469  SYWTQCDRSLGQKLAFRLNVRPSI  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WI
Sbjct  409  PSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WI
Sbjct  409  PSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P 
Sbjct  348  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  407

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WI
Sbjct  408  PSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  467

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  468  SYWSQADKSLGQKLASRLNVRPSI  491



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  334  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  393

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WI
Sbjct  394  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWI  453

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD++LGQK+ASRLN+RP++
Sbjct  454  SYWSQADKTLGQKLASRLNVRPSI  477



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WI
Sbjct  409  PTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  307  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  366

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  367  PPAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  426

Query  289  SYLTQADRSLGQKVASRLNI  230
            SY +QAD+SLGQK+ASRLN+
Sbjct  427  SYWSQADKSLGQKLASRLNV  446



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPL  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG+R+KCVI KENNFKQPG+RYRS+ P RQ+RF++RWV++LS+ RVTHEIR  WI
Sbjct  409  PPRVLTGKREKCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            +Y +Q D+SLGQK+A+RLN+RP+M
Sbjct  469  TYWSQCDKSLGQKLATRLNMRPSM  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  348  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  407

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  408  PPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  467

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  468  SYWSQADKSLGQKLASRLNVRPSI  491



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP 
Sbjct  348  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPI  407

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  408  PPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWI  467

Query  289  SYLTQADRSLGQKVASRLNI  230
            SY +QAD+SLGQK+ASRLN+
Sbjct  468  SYWSQADKSLGQKLASRLNV  487



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+S+GQK+AS LN+RP++
Sbjct  469  SYWSQADKSVGQKLASLLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPH  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRS+GQK+AS LN+RP++
Sbjct  469  SYWSQADRSVGQKLASHLNVRPSI  492



>prf||1906388A catalase
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R+KCVI KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+THEIRS WI
Sbjct  409  PSTMCTGKREKCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPH  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R++CVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAVCTGKRERCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRS+GQK+AS LN+RP++
Sbjct  469  SYWSQADRSVGQKLASHLNMRPSI  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AE++P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG+R+K +IEKENNFKQPG+ YRSWAP RQ+RF+ RWV +LS+ R THEIRS WI
Sbjct  409  PPRVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLNIRPTM
Sbjct  469  SYWSQADKSLGQKLASRLNIRPTM  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD++LGQK+ASRLN+RP++
Sbjct  469  SYWSQADKTLGQKLASRLNVRPSI  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIR+ WI
Sbjct  409  PSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  342  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  401

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  402  PPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  461

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP +
Sbjct  462  SYWSQADKSLGQKLASRLNVRPNI  485



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP +
Sbjct  469  SYWSQADKSLGQKLASRLNVRPNI  492



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPA  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P 
Sbjct  346  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPI  405

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI
Sbjct  406  PSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWI  465

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
              L+QAD+S GQKVASRL ++PTM
Sbjct  466  CSLSQADKSCGQKVASRLTLKPTM  489



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P 
Sbjct  342  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  401

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R+KCVI+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WI
Sbjct  402  PSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWI  461

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  462  SYWSQADKSLGQKLASRLNVRPSI  485



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAICSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+A+RLN+RP++
Sbjct  469  SYWSQADKSLGQKLANRLNVRPSI  492



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KC+I+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WI
Sbjct  409  PNKSYTGIRTKCIIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADASLGQKLASRLNVRPSI  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  RNAE FP 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPV  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+R+ WI
Sbjct  409  PSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY  Q D+SLGQK+A+RLN++P++
Sbjct  469  SYWIQCDKSLGQKLATRLNVKPSI  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNYM LPVNAPKC +HNN  DG+MNF+HRDEEV+YFPS++D  R+AERFP 
Sbjct  349  SDTQRHRLGPNYMQLPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I+TG+R++ VIEKENNFKQPG+RYRSWAPDRQ+RFI R V +LS+PRV+HEIRS WI
Sbjct  409  PSNILTGKRERRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+A+RLN+RP++
Sbjct  469  SYWSQADKSLGQKIATRLNVRPSI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNF+QPG+RYRSW  DRQ+RF+ R+V++L+EPRVTHEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRP  224
            SY TQAD+SLGQK+ASRLN+RP
Sbjct  469  SYWTQADKSLGQKLASRLNVRP  490



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPH  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WI
Sbjct  409  PPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN+RP++
Sbjct  469  SYWSQADRSLGQKLASHLNVRPSI  492



>prf||2104177A catalase
Length=492

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+
Sbjct  409  PPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRP  224
            SY +QAD+SLGQK+ASRLN++P
Sbjct  469  SYWSQADKSLGQKIASRLNVKP  490



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPV  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +GRR++C+IEKENNFKQPG+RYRS+ PDR++RFI RW+++LS+PR+THEIRS WI
Sbjct  409  PSVVCSGRRERCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASR+N+RP +
Sbjct  469  SYWSQADQSLGQKLASRMNVRPNI  492



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P 
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P +  TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSE R+THEIRS WI
Sbjct  409  PSKSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSELRLTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+
Sbjct  409  PPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRP  224
            SY +QAD+SLGQK+ASRLN++P
Sbjct  469  SYWSQADKSLGQKIASRLNVKP  490



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  334  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  393

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WI
Sbjct  394  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWI  453

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD++LGQK+AS LN+RP++
Sbjct  454  SYWSQADKTLGQKLASHLNVRPSI  477



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MN +HRDEEV+YFPS++D  R+AE++PT
Sbjct  337  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPT  396

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  397  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  456

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  457  SYWSQADKSLGQKLASRLNVRPSI  480



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P 
Sbjct  347  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  406

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WI
Sbjct  407  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  466

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+AS LN+RP++
Sbjct  467  SYWSQADKSLGQKLASHLNMRPSI  490



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP N+PKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P 
Sbjct  349  ADTQRHRLGPNYLQLPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPV  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R + G+R+KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WI
Sbjct  409  PPRTLGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN++P++
Sbjct  469  SYWSQADRSLGQKIASHLNLKPSI  492



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   225 bits (573),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNNS DG MNF+HRDEEVDY PS+FD  R AE++P 
Sbjct  172  ADTQRHRIGPNYMQLPVNAPKCAHHNNSRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPI  231

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ G R  CV  KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEI S WI
Sbjct  232  PSCVLNGPRTMCVTPKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIPSIWI  291

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++P M
Sbjct  292  SYLSQADKSCGQKVASRLTVKPPM  315



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEVDYFPS++D  R+AE  P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TGRR+K +I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WI
Sbjct  409  PSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLNIRP++
Sbjct  469  SYWSQADKSLGQKLASRLNIRPSI  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  349  ADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN+RP +
Sbjct  469  SYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WI
Sbjct  409  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+AS LN+RP++
Sbjct  469  SYWSQADKSLGQKLASHLNMRPSI  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNY+ LPVNAPKC +HNN +DG MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  370  ADTQRHRIGPNYLQLPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPI  429

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  +++G+R K VIEKENNFKQPGDRYRSWAPDRQ+RFI RW+ +LS+PR+T EIRS W+
Sbjct  430  PPVVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWV  489

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQAD+SLGQK+ASRLN+RP M
Sbjct  490  SYWTQADKSLGQKLASRLNVRPAM  513



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TGRR++ VI+KENNFKQPG+RYRS++PDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PSAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP++
Sbjct  469  SYWSQADRSLGQKLASRLNVRPSI  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P 
Sbjct  159  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPM  218

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R+++G R+KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+
Sbjct  219  PPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWV  278

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRL I+P M
Sbjct  279  SYWSQCDASLGQKLASRLKIKPNM  302



>gb|AAZ29552.1| catalase-C [Oryza sativa Indica Group]
Length=500

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P 
Sbjct  357  SDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPI  416

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS PR+THEIRS W+
Sbjct  417  PSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSGPRLTHEIRSIWL  476

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRL+ +P+M
Sbjct  477  SYWSQADRSLGQKLASRLSAKPSM  500



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R+KCVI+KENNFKQ GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WI
Sbjct  409  PSTMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT R+RLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P 
Sbjct  349  GDTQRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +G R KCVIEKENNFKQPGDRYRSWAPDRQ+R+ NRWV++LS+ RVT EIR  WI
Sbjct  409  PSAICSGERVKCVIEKENNFKQPGDRYRSWAPDRQERYANRWVEALSDARVTDEIRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  469  SYLSQSDKSLGMKVANRLNVRPSF  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P 
Sbjct  349  SDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+
Sbjct  409  PSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWL  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRL+ +P+M
Sbjct  469  SYWSQADRSLGQKLASRLSAKPSM  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+ +P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P 
Sbjct  290  ADSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPV  349

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WI
Sbjct  350  PPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWI  409

Query  289  SYLTQADRSLGQKVASRLN  233
            SY +QADRSLGQK+AS LN
Sbjct  410  SYWSQADRSLGQKIASHLN  428



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPT
Sbjct  350  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPT  409

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WI
Sbjct  410  PPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWI  469

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN+RP++
Sbjct  470  SYWSQADRSLGQKIASHLNMRPSI  493



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P 
Sbjct  349  SDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+
Sbjct  409  PSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWL  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRL+ +P+M
Sbjct  469  SYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPA  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PT
Sbjct  349  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  W 
Sbjct  409  PTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWT  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY  +ADRSLGQK+ASRLN+RP++
Sbjct  469  SYWLKADRSLGQKLASRLNVRPSI  492



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  210  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  269

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WI
Sbjct  270  PPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWI  329

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D +LGQK+ASRLN++P+M
Sbjct  330  SYWSQCDAALGQKLASRLNLKPSM  353



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPT
Sbjct  349  ADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WI
Sbjct  409  PPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS LN+RP++
Sbjct  469  SYWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPA  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPH  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            +Y +QADRS+GQK+AS LN+RP++
Sbjct  469  TYWSQADRSVGQKLASHLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVN+PKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP +
Sbjct  469  SYWSQADKSLGQKLASRLNVRPNI  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P 
Sbjct  333  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  392

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WI
Sbjct  393  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  452

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+AS LN+RP +
Sbjct  453  SYWSQADKSLGQKLASHLNMRPGI  476



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT R+RLGPNY++LPVNAPKCA+HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP 
Sbjct  349  ADTQRYRLGPNYLMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI
Sbjct  409  PSRVVTGKREKIVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            +YLTQ D SLGQKVA+RLN++P+M
Sbjct  469  TYLTQCDVSLGQKVANRLNVKPSM  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R+KCVI+KENNF QPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WI
Sbjct  409  PSTMCTGKREKCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ GRR  CVI KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEIRS WI
Sbjct  409  PSCVLNGRRTNCVIPKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTVKPTM  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WI
Sbjct  409  PSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKIASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WI
Sbjct  409  PSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKIASRLNVRPSI  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  348  ADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPM  407

Query  469  PLRIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTW  293
            P  ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ W
Sbjct  408  PPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIW  467

Query  292  ISYLTQADRSLGQKVASRLNIRPTM  218
            ISY +QADRSLGQK+ASRLN+RP +
Sbjct  468  ISYWSQADRSLGQKIASRLNVRPNI  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P 
Sbjct  349  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WI
Sbjct  409  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+AS LN+RP +
Sbjct  469  SYWSQADKSLGQKLASHLNMRPGI  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT R+RLGPNY++LPVNAPKCA+HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP 
Sbjct  349  ADTQRYRLGPNYLMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI
Sbjct  409  PSRVVTGKREKTVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            +YLTQ D SLGQKVA+RLN++P+M
Sbjct  469  TYLTQCDVSLGQKVANRLNVKPSM  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P 
Sbjct  332  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPI  391

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WI
Sbjct  392  PSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWI  451

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  452  SYWSQADKSLGQKLASRLNVRPSI  475



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  348  ADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPM  407

Query  469  PLRIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTW  293
            P  ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ W
Sbjct  408  PPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIW  467

Query  292  ISYLTQADRSLGQKVASRLNIRPTM  218
            ISY +QADRSLGQK+ASRLN+RP +
Sbjct  468  ISYWSQADRSLGQKIASRLNVRPNI  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +D+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P 
Sbjct  349  SDSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  +++G+RD+C IEKENNFKQPG+RYR+++PDRQ+RFI RWV +LS+PR+THEIRS WI
Sbjct  409  PPVVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RPTM
Sbjct  469  SYWSQADKSLGQKLASRLNVRPTM  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP 
Sbjct  349  SDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P    TG+R+KCVIEKENNFKQPG+RYRS+AP+RQ+RF+ RWV +LS+PRVTHEI S WI
Sbjct  409  PSHTHTGKREKCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D+SLGQK+A+RLN++  M
Sbjct  469  SYWSQCDKSLGQKIAARLNMKANM  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPV  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KCVI KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PR+THE+R  WI
Sbjct  409  PPRVLTGCREKCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R+KC+I+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WI
Sbjct  409  PSTVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            +Y +QAD+SLGQK+ASRLN+RP++
Sbjct  469  TYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WI
Sbjct  409  PPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  +NA R+P 
Sbjct  196  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPI  255

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   +TGRRDK VI KENNFKQPG+RYR+  P RQ+RFI RWV +LS+PR+THEIRS W+
Sbjct  256  PTVHITGRRDKTVIAKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWL  315

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            S  +QADRSLGQK+ASRL+ +P+M
Sbjct  316  SNWSQADRSLGQKLASRLSAKPSM  339



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS+FD  R AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WI
Sbjct  409  PSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRL  236
            SYL+QAD+S GQKVASRL
Sbjct  469  SYLSQADKSCGQKVASRL  486



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P 
Sbjct  368  ADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPN  427

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WI
Sbjct  428  PSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWI  487

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+AS LN+RP +
Sbjct  488  SYWSQADKSLGQKLASHLNMRPGI  511



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WI
Sbjct  409  PPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN YDG MNF+HRD+EVDYFPS++D  R+AER+P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ G RD+ +I+KENNFKQPG+RYRSW P RQ+RFI RWV +LS+PR+THEIR+ WI
Sbjct  409  PPNVLNGNRDRQIIQKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+S+G K+ASRLN+RPTM
Sbjct  469  SYWSQADKSVGMKLASRLNVRPTM  492



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVN+PKC++HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  306  ADTQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  365

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+R +RFI RW+ +LS+PR+THEIRS WI
Sbjct  366  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERLERFIGRWIDALSDPRITHEIRSIWI  425

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP +
Sbjct  426  SYWSQADKSLGQKLASRLNVRPNI  449



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLG NY+ LPVNAPKC YHNN YDG+MNF+HRDEEVDYF S++D  R+AE+ P 
Sbjct  349  SDTQRHRLGTNYLQLPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR+KCVIEKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LSEPR+THEIRS W+
Sbjct  409  PNAICSGRREKCVIEKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            S+ TQ D+SLGQK+ASRLN+RP +
Sbjct  469  SWWTQCDKSLGQKLASRLNVRPNI  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPA  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WI
Sbjct  409  PPAVCSGTRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNYM LPVNAPKC +HNN YDG+MNF+HRDEE+DYF S++D  R+AER+P 
Sbjct  349  SDTQRHRLGPNYMQLPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I++GRR+KCVI KENNFKQPG+RYRSW PDRQ+RF+ R V +LS+PR+THEIR  W+
Sbjct  409  PNAIISGRREKCVIPKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D+SLGQK+ASRLN+RP +
Sbjct  469  SYWSQCDQSLGQKLASRLNVRPNI  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +G+R+KC+I+KENNF+QPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WI
Sbjct  409  PTAICSGKREKCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY ++AD+SLGQK+ASRL++RP++
Sbjct  469  SYWSKADKSLGQKLASRLSVRPSI  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D   +AER+P 
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQ  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + TG+R++CVIEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WI
Sbjct  409  PPAVYTGKRERCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWI  468

Query  289  SYLTQADRSLGQKVASRLNIR  227
            SY +QAD+SLGQK+ASRLN++
Sbjct  469  SYWSQADKSLGQKLASRLNVK  489



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WI
Sbjct  409  PPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LPVNAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P 
Sbjct  349  SDTQRHRLGPNYLQLPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ GRR+KC+I KENNFKQPG+RYRS++PDRQ+RF+NRW+ SLS+PRVTHEIR+ W+
Sbjct  409  PPVVLNGRREKCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            +Y  QAD+SLGQK+ASRLN+RP M
Sbjct  469  TYWYQADKSLGQKLASRLNVRPNM  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WI
Sbjct  409  PPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P 
Sbjct  349  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WI
Sbjct  409  PSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            +Y +QAD+SLGQK+ASRLN+RP++
Sbjct  469  TYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WI
Sbjct  409  PPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P   +TGRR+K VI KENNFKQPG+RYRSW P RQ+RFI RW+ +LS+PR+THEIRS W+
Sbjct  409  PSVNLTGRREKTVIPKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWL  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRL+ +P+M
Sbjct  469  SYWSQADRSLGQKLASRLSAKPSM  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P 
Sbjct  255  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPM  314

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R+++G R+KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+
Sbjct  315  PPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWV  374

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRL I+P M
Sbjct  375  SYWSQCDASLGQKLASRLKIKPNM  398



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD+ RHRLGPNY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  349  ADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS L++RP +
Sbjct  469  SYWSQADRSLGQKIASHLSMRPNI  492



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WI
Sbjct  409  PACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 131/148 (89%), Gaps = 4/148 (3%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIR  302
            P  + +G+R++CVIEKENNFK+PG RYRS+ PD    RQ+RFI RW+++LS+PR+THEIR
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIR  468

Query  301  STWISYLTQADRSLGQKVASRLNIRPTM  218
            S WISY +QAD++LGQK+ASRLN+RP++
Sbjct  469  SIWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P 
Sbjct  349  SDTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++TGRR+K VI KENNFKQPG+RYRS+ PDR+DRFI RWV++LS+PRVT+EIRS WI
Sbjct  409  PPPVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+AS LN+RPTM
Sbjct  469  SYWSQADKSLGQKIASHLNMRPTM  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP 
Sbjct  349  SDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P    +G R+KCVIEKENNFKQPG+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WI
Sbjct  409  PSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q+D+SLGQK+A+RLN++  M
Sbjct  469  SYWSQSDKSLGQKIAARLNMKANM  492



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PT
Sbjct  388  GDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPT  447

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WI
Sbjct  448  PTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWI  507

Query  289  SYLTQADRSLGQKVASRLNIRPT  221
            SY +QADRSLGQK+ASRLN+RP+
Sbjct  508  SYWSQADRSLGQKLASRLNVRPS  530


 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649   ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             AD+ RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+ D  R+AE++PT
Sbjct  870   ADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPT  929

Query  469   PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
                + +G R+KC I KENNFKQPG+RYRSW  DRQ+RF+ R+V++LSEPRVTHEIRS WI
Sbjct  930   TPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWI  989

Query  289   SYLTQADRSLGQKVASRLNIRPTM  218
             SY +QAD+SLGQK+A+RLN+RP  
Sbjct  990   SYWSQADKSLGQKLATRLNVRPNF  1013



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WI
Sbjct  409  PPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D +LGQK+ASRLN++P+M
Sbjct  469  SYWSQCDAALGQKLASRLNLKPSM  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WI
Sbjct  409  PPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D +LGQK+ASRLN++P+M
Sbjct  469  SYWSQCDAALGQKLASRLNLKPSM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 132/148 (89%), Gaps = 4/148 (3%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIR  302
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+    RQ+RFI RW+++LS+PR+THEIR
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIR  468

Query  301  STWISYLTQADRSLGQKVASRLNIRPTM  218
            S WISY +QAD++LGQK+ASRLN+RP++
Sbjct  469  SIWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WI
Sbjct  409  PSRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 130/145 (90%), Gaps = 1/145 (1%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  348  ADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPM  407

Query  469  PLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTW  293
            P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ W
Sbjct  408  PPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIW  467

Query  292  ISYLTQADRSLGQKVASRLNIRPTM  218
            ISY +QADRSLGQK+ASR+N+RP++
Sbjct  468  ISYWSQADRSLGQKIASRMNVRPSI  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P 
Sbjct  341  SDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPI  400

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R+KC+I+KENNF+QPG+RYRS++ DRQ+RFI RWV++LS+PR+T+EIRS WI
Sbjct  401  PTTVCSGKREKCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEIRSIWI  460

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  461  SYWSQADKSLGQKLASRLNVRPSI  484



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             D  R+RLG NYM+LPVNAPKCA+HNN YDG MNF+HRDEE+DYFPSKFD  R AE++P 
Sbjct  349  GDAQRYRLGANYMMLPVNAPKCAHHNNQYDGVMNFMHRDEEIDYFPSKFDPARQAEKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              ++ TG+R+K VI KENNFKQPGDRYRSW P RQ+RF+ RWV  LS+PRVT E+RS W+
Sbjct  409  LTKVYTGKREKTVIPKENNFKQPGDRYRSWDPARQERFVKRWVDVLSDPRVTLELRSIWV  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+Q DRSLG KVA+RLN+RPTM
Sbjct  469  SYLSQCDRSLGMKVATRLNMRPTM  492



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
             DT R+RLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P 
Sbjct  349  GDTQRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G R KCVIEKENNFKQPG+RYRSWAPDRQ+R+  RWV++LS+ RVT EIR  WI
Sbjct  409  PSAVCSGERIKCVIEKENNFKQPGERYRSWAPDRQERYAKRWVEALSDARVTDEIRGVWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  469  SYLSQSDKSLGMKVANRLNVRPSF  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PT
Sbjct  349  ADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPT  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++L +PR+THEIRS WI
Sbjct  409  PPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
             Y +QAD++ GQK+ASRLN+RP++
Sbjct  469  FYWSQADKTFGQKLASRLNVRPSI  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            AD  RHRLGPNY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  349  ADPQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WI
Sbjct  409  PPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+AS L++RP +
Sbjct  469  SYWSQADRSLGQKIASHLSMRPNI  492



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  348  ADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPM  407

Query  469  PLRIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTW  293
            P  ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVT E+R+ W
Sbjct  408  PPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTDEVRNIW  467

Query  292  ISYLTQADRSLGQKVASRLNIRPTM  218
            ISY +QADRSLGQK+ASRLN+RP +
Sbjct  468  ISYWSQADRSLGQKIASRLNVRPNI  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ GRR  CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WI
Sbjct  409  PACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTVKPTM  492



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ GRR  CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WI
Sbjct  409  PACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTVKPTM  492



>gb|AHF27429.1| catalase, partial [Cucurbita moschata]
Length=461

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P 
Sbjct  317  ADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDACRHAEKYPM  376

Query  469  PLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTW  293
            P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +VTHE+R+ W
Sbjct  377  PPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIW  436

Query  292  ISYLTQADRSLGQKVASRLNIRPTM  218
            ISY TQADRSLGQK+ASR+N RP M
Sbjct  437  ISYWTQADRSLGQKIASRMNARPNM  461



>gb|AHF27432.1| catalase, partial [Cucurbita maxima]
Length=461

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P 
Sbjct  317  ADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDACRHAEKYPM  376

Query  469  PLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTW  293
            P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +VTHE+R+ W
Sbjct  377  PPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIW  436

Query  292  ISYLTQADRSLGQKVASRLNIRPTM  218
            ISY TQADRSLGQK+ASR+N RP M
Sbjct  437  ISYWTQADRSLGQKIASRMNARPNM  461



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  339  ADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPM  398

Query  469  PLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTW  293
            P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ W
Sbjct  399  PPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIW  458

Query  292  ISYLTQADRSLGQKVASRLNIRPTM  218
            ISY +QADRSLGQK+ASR+N+RP +
Sbjct  459  ISYWSQADRSLGQKIASRMNVRPNI  483



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+LLP NAPKC++HNN YDG MNF+HRDEEVDYFPS+FD   +A R+P 
Sbjct  349  SDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R + GRR+K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+
Sbjct  409  PSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWL  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+A RL+++P+M
Sbjct  469  SYWSQADRSLGQKLAGRLSVKPSM  492



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  348  ADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPM  407

Query  469  PLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTW  293
            P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ W
Sbjct  408  PPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIW  467

Query  292  ISYLTQADRSLGQKVASRLNIRPTM  218
            ISY +QADRSLGQK+ASR+N+RP +
Sbjct  468  ISYWSQADRSLGQKIASRMNVRPNI  492



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP 
Sbjct  348  ADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPM  407

Query  469  PLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTW  293
            P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ W
Sbjct  408  PPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIW  467

Query  292  ISYLTQADRSLGQKVASRLNIRPTM  218
            ISY +QADRSLGQK+ASR+N+RP +
Sbjct  468  ISYWSQADRSLGQKIASRMNVRPNI  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            +DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P 
Sbjct  349  SDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  + +G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+ RVTHEIRS WI
Sbjct  409  PSTVYSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QAD+SLGQK+ASRLN+RP++
Sbjct  469  SYWSQADKSLGQKIASRLNVRPSI  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVGALSDPRVTHEHHTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P 
Sbjct  349  ADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WI
Sbjct  409  PACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  469  SYLSQADKSCGQKVASRLTVKPTM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P 
Sbjct  348  ADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPI  407

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WI
Sbjct  408  PACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWI  467

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SYL+QAD+S GQKVASRL ++PTM
Sbjct  468  SYLSQADKSCGQKVASRLTVKPTM  491



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -3

Query  649  ADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPT  470
            ADT RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P 
Sbjct  349  ADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPI  408

Query  469  PLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
            P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WI
Sbjct  409  PTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +Q D SLGQK+ASRLN++P M
Sbjct  469  SYWSQCDASLGQKLASRLNLKPNM  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250