BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021B03

Length=646
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777618.1|  PREDICTED: probable histone-arginine methylt...    166   3e-46   Nicotiana sylvestris
ref|XP_009779154.1|  PREDICTED: probable histone-arginine methylt...    167   6e-45   Nicotiana sylvestris
ref|XP_009630322.1|  PREDICTED: probable histone-arginine methylt...    166   3e-44   Nicotiana tomentosiformis
ref|XP_009612678.1|  PREDICTED: probable histone-arginine methylt...    164   6e-44   Nicotiana tomentosiformis
ref|XP_009779155.1|  PREDICTED: probable histone-arginine methylt...    157   6e-43   Nicotiana sylvestris
ref|XP_009630323.1|  PREDICTED: probable histone-arginine methylt...    156   1e-42   Nicotiana tomentosiformis
ref|XP_009630324.1|  PREDICTED: probable histone-arginine methylt...    156   2e-42   Nicotiana tomentosiformis
ref|XP_004239813.1|  PREDICTED: probable histone-arginine methylt...    160   2e-42   Solanum lycopersicum
ref|XP_004252900.1|  PREDICTED: probable histone-arginine methylt...    153   3e-42   Solanum lycopersicum
ref|XP_006349813.1|  PREDICTED: probable histone-arginine methylt...    152   5e-42   Solanum tuberosum [potatoes]
ref|XP_006365839.1|  PREDICTED: probable histone-arginine methylt...    159   7e-42   Solanum tuberosum [potatoes]
ref|XP_004143091.1|  PREDICTED: probable histone-arginine methylt...    141   8e-39   Cucumis sativus [cucumbers]
ref|XP_008458452.1|  PREDICTED: probable histone-arginine methylt...    140   1e-38   Cucumis melo [Oriental melon]
ref|XP_010098279.1|  putative histone-arginine methyltransferase 1.4    140   2e-38   Morus notabilis
ref|XP_003609673.1|  Protein arginine N-methyltransferase               139   3e-38   Medicago truncatula
ref|XP_007035586.1|  Arginine methyltransferase 4B isoform 2            137   1e-37   
gb|KEH32288.1|  histone-arginine methyltransferase, putative            137   1e-37   Medicago truncatula
ref|XP_011090965.1|  PREDICTED: probable histone-arginine methylt...    137   1e-37   Sesamum indicum [beniseed]
ref|XP_007035585.1|  Arginine methyltransferase 4A isoform 1            135   3e-37   
ref|XP_004508215.1|  PREDICTED: probable histone-arginine methylt...    135   7e-37   Cicer arietinum [garbanzo]
ref|XP_007154284.1|  hypothetical protein PHAVU_003G105500g             134   8e-37   Phaseolus vulgaris [French bean]
ref|XP_007154285.1|  hypothetical protein PHAVU_003G105500g             134   1e-36   Phaseolus vulgaris [French bean]
ref|XP_006600355.1|  PREDICTED: probable histone-arginine methylt...    133   2e-36   Glycine max [soybeans]
ref|XP_003550276.1|  PREDICTED: probable histone-arginine methylt...    133   2e-36   Glycine max [soybeans]
ref|XP_002516920.1|  protein arginine n-methyltransferase, putative     133   2e-36   Ricinus communis
gb|EYU43947.1|  hypothetical protein MIMGU_mgv1a004608mg                133   2e-36   Erythranthe guttata [common monkey flower]
gb|KEH37263.1|  histone-arginine methyltransferase, putative            131   7e-36   Medicago truncatula
ref|XP_006600356.1|  PREDICTED: probable histone-arginine methylt...    130   1e-35   Glycine max [soybeans]
gb|KGN47178.1|  hypothetical protein Csa_6G194130                       130   1e-35   Cucumis sativus [cucumbers]
ref|XP_006584026.1|  PREDICTED: probable histone-arginine methylt...    132   2e-35   Glycine max [soybeans]
ref|XP_006584027.1|  PREDICTED: probable histone-arginine methylt...    132   2e-35   Glycine max [soybeans]
gb|KEH37264.1|  histone-arginine methyltransferase, putative            129   3e-35   Medicago truncatula
ref|XP_010259610.1|  PREDICTED: probable histone-arginine methylt...    129   3e-35   Nelumbo nucifera [Indian lotus]
emb|CAN78049.1|  hypothetical protein VITISV_015861                     128   3e-35   Vitis vinifera
ref|XP_010259609.1|  PREDICTED: probable histone-arginine methylt...    129   3e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010269509.1|  PREDICTED: probable histone-arginine methylt...    129   3e-35   Nelumbo nucifera [Indian lotus]
ref|XP_003546357.1|  PREDICTED: probable histone-arginine methylt...    132   4e-35   Glycine max [soybeans]
ref|XP_010269515.1|  PREDICTED: probable histone-arginine methylt...    129   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010269514.1|  PREDICTED: probable histone-arginine methylt...    129   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010269511.1|  PREDICTED: probable histone-arginine methylt...    129   5e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010259608.1|  PREDICTED: probable histone-arginine methylt...    129   5e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010269508.1|  PREDICTED: probable histone-arginine methylt...    129   5e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010269512.1|  PREDICTED: probable histone-arginine methylt...    129   5e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010269513.1|  PREDICTED: probable histone-arginine methylt...    129   5e-35   Nelumbo nucifera [Indian lotus]
gb|EPS70406.1|  hypothetical protein M569_04353                         128   9e-35   Genlisea aurea
ref|XP_011005087.1|  PREDICTED: probable histone-arginine methylt...    127   1e-34   Populus euphratica
gb|ABK94929.1|  unknown                                                 127   1e-34   Populus trichocarpa [western balsam poplar]
gb|AFK39038.1|  unknown                                                 127   1e-34   Lotus japonicus
ref|XP_006378073.1|  hypothetical protein POPTR_0010s01850g             127   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004508216.1|  PREDICTED: probable histone-arginine methylt...    127   1e-34   Cicer arietinum [garbanzo]
gb|KJB34628.1|  hypothetical protein B456_006G076000                    127   1e-34   Gossypium raimondii
gb|KJB34627.1|  hypothetical protein B456_006G076000                    127   2e-34   Gossypium raimondii
gb|KHG21096.1|  putative histone-arginine methyltransferase 1.3 -...    126   3e-34   Gossypium arboreum [tree cotton]
gb|KJB38603.1|  hypothetical protein B456_006G262700                    126   3e-34   Gossypium raimondii
emb|CDO98873.1|  unnamed protein product                                125   4e-34   Coffea canephora [robusta coffee]
ref|NP_001130830.1|  hypothetical protein                               125   4e-34   Zea mays [maize]
ref|XP_008650820.1|  PREDICTED: hypothetical protein isoform X1         125   4e-34   
ref|XP_002461187.1|  hypothetical protein SORBIDRAFT_02g042540          125   6e-34   
ref|XP_006419580.1|  hypothetical protein CICLE_v10004703mg             126   6e-34   Citrus clementina [clementine]
ref|XP_006419579.1|  hypothetical protein CICLE_v10004703mg             126   6e-34   Citrus clementina [clementine]
gb|KDO71644.1|  hypothetical protein CISIN_1g015038mg                   126   9e-34   Citrus sinensis [apfelsine]
ref|XP_004296838.1|  PREDICTED: probable histone-arginine methylt...    127   1e-33   Fragaria vesca subsp. vesca
ref|XP_007138912.1|  hypothetical protein PHAVU_009G248200g             127   1e-33   Phaseolus vulgaris [French bean]
ref|XP_011462720.1|  PREDICTED: probable histone-arginine methylt...    127   1e-33   Fragaria vesca subsp. vesca
gb|AGT17201.1|  hypothetical protein SHCRBa_098_E22_R_290               124   2e-33   Saccharum hybrid cultivar R570
ref|XP_010037469.1|  PREDICTED: probable histone-arginine methylt...    135   2e-33   Eucalyptus grandis [rose gum]
ref|XP_011011651.1|  PREDICTED: probable histone-arginine methylt...    123   2e-33   Populus euphratica
gb|KDP27795.1|  hypothetical protein JCGZ_18875                         123   2e-33   Jatropha curcas
gb|KHG28804.1|  putative histone-arginine methyltransferase 1.4         125   3e-33   Gossypium arboreum [tree cotton]
gb|KJB72683.1|  hypothetical protein B456_011G190400                    125   3e-33   Gossypium raimondii
gb|KJB72681.1|  hypothetical protein B456_011G190400                    125   3e-33   Gossypium raimondii
emb|CDY24659.1|  BnaA05g30580D                                          124   3e-33   Brassica napus [oilseed rape]
ref|XP_009147121.1|  PREDICTED: probable histone-arginine methylt...    124   3e-33   Brassica rapa
gb|KJB72682.1|  hypothetical protein B456_011G190400                    124   3e-33   Gossypium raimondii
ref|NP_850528.1|  arginine methyltransferase 4B                         124   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150868.1|  histone-arginine methyltransferase CARM1           122   3e-33   Zea mays [maize]
gb|AAO42127.1|  putative arginine methyltransferase                     124   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004958628.1|  PREDICTED: probable histone-arginine methylt...    122   4e-33   Setaria italica
ref|XP_004958629.1|  PREDICTED: probable histone-arginine methylt...    122   4e-33   Setaria italica
ref|XP_008668082.1|  PREDICTED: histone-arginine methyltransferas...    122   4e-33   Zea mays [maize]
emb|CDY05299.1|  BnaC05g45040D                                          124   4e-33   
ref|XP_010446281.1|  PREDICTED: probable histone-arginine methylt...    123   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008340814.1|  PREDICTED: probable histone-arginine methylt...    123   5e-33   
emb|CAN77729.1|  hypothetical protein VITISV_027411                     122   5e-33   Vitis vinifera
ref|XP_002884615.1|  arginine N-methyltransferase family protein        124   5e-33   
ref|XP_010446228.1|  PREDICTED: probable histone-arginine methylt...    123   5e-33   Camelina sativa [gold-of-pleasure]
gb|KHG28805.1|  putative histone-arginine methyltransferase 1.3         124   6e-33   Gossypium arboreum [tree cotton]
ref|XP_010464286.1|  PREDICTED: probable histone-arginine methylt...    123   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010486223.1|  PREDICTED: probable histone-arginine methylt...    123   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010464285.1|  PREDICTED: probable histone-arginine methylt...    123   6e-33   Camelina sativa [gold-of-pleasure]
dbj|BAF00156.1|  arginine methyltransferase like protein                123   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486222.1|  PREDICTED: probable histone-arginine methylt...    123   6e-33   Camelina sativa [gold-of-pleasure]
ref|NP_187349.2|  arginine methyltransferase 4B                         123   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002273923.1|  PREDICTED: probable histone-arginine methylt...    121   7e-33   Vitis vinifera
tpg|DAA41721.1|  TPA: hypothetical protein ZEAMMB73_688738              121   8e-33   
ref|XP_008367146.1|  PREDICTED: probable histone-arginine methylt...    123   8e-33   
ref|XP_006299916.1|  hypothetical protein CARUB_v10016125mg             122   1e-32   Capsella rubella
gb|AAF26997.1|AC016827_8  putative arginine methyltransferase           122   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001060600.1|  Os07g0671700                                       120   1e-32   
ref|XP_006840515.1|  hypothetical protein AMTR_s00045p00203910          123   2e-32   Amborella trichopoda
ref|XP_007223076.1|  hypothetical protein PRUPE_ppa003751mg             121   2e-32   Prunus persica
ref|XP_008223183.1|  PREDICTED: probable histone-arginine methylt...    121   2e-32   
ref|XP_006407889.1|  hypothetical protein EUTSA_v10020486mg             121   2e-32   Eutrema salsugineum [saltwater cress]
gb|ADE77041.1|  unknown                                                 121   3e-32   Picea sitchensis
ref|XP_007223075.1|  hypothetical protein PRUPE_ppa003751mg             121   3e-32   Prunus persica
ref|XP_003562471.1|  PREDICTED: probable histone-arginine methylt...    121   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_010524707.1|  PREDICTED: probable histone-arginine methylt...    119   5e-32   Tarenaya hassleriana [spider flower]
ref|XP_009352259.1|  PREDICTED: probable histone-arginine methylt...    120   6e-32   Pyrus x bretschneideri [bai li]
ref|XP_009151707.1|  PREDICTED: probable histone-arginine methylt...    121   7e-32   Brassica rapa
emb|CDX86257.1|  BnaA06g29740D                                          121   8e-32   
ref|XP_003533368.1|  PREDICTED: probable histone-arginine methylt...    121   8e-32   Glycine max [soybeans]
emb|CDY33934.1|  BnaA02g30530D                                          121   1e-31   Brassica napus [oilseed rape]
ref|XP_009129755.1|  PREDICTED: probable histone-arginine methylt...    120   1e-31   Brassica rapa
ref|XP_006395101.1|  hypothetical protein EUTSA_v10003986mg             120   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_006658954.1|  PREDICTED: probable histone-arginine methylt...    117   1e-31   Oryza brachyantha
gb|KHG10436.1|  putative histone-arginine methyltransferase 1.3 -...    117   2e-31   Gossypium arboreum [tree cotton]
ref|XP_010666576.1|  PREDICTED: probable histone-arginine methylt...    117   2e-31   
ref|XP_010547029.1|  PREDICTED: probable histone-arginine methylt...    116   2e-31   Tarenaya hassleriana [spider flower]
ref|XP_010666575.1|  PREDICTED: probable histone-arginine methylt...    117   3e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008390660.1|  PREDICTED: probable histone-arginine methylt...    117   4e-31   
ref|XP_008351193.1|  PREDICTED: probable histone-arginine methylt...    117   4e-31   
gb|KFK38084.1|  hypothetical protein AALP_AA3G067500                    117   5e-31   Arabis alpina [alpine rockcress]
emb|CDY05647.1|  BnaC02g38900D                                          118   7e-31   
ref|XP_008786718.1|  PREDICTED: probable histone-arginine methylt...    115   8e-31   
ref|XP_008786717.1|  PREDICTED: probable histone-arginine methylt...    115   8e-31   Phoenix dactylifera
ref|XP_002863948.1|  arginine N-methyltransferase family protein        117   1e-30   
gb|KHN26555.1|  Putative histone-arginine methyltransferase 1.4         117   1e-30   Glycine soja [wild soybean]
ref|XP_010921814.1|  PREDICTED: probable histone-arginine methylt...    117   1e-30   Elaeis guineensis
ref|XP_010921815.1|  PREDICTED: probable histone-arginine methylt...    117   1e-30   Elaeis guineensis
ref|XP_009383901.1|  PREDICTED: probable histone-arginine methylt...    115   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010442362.1|  PREDICTED: probable histone-arginine methylt...    117   1e-30   Camelina sativa [gold-of-pleasure]
ref|NP_974913.1|  protein arginine methyltransferase 4A                 117   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199713.2|  protein arginine methyltransferase 4A                 117   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442359.1|  PREDICTED: probable histone-arginine methylt...    117   2e-30   Camelina sativa [gold-of-pleasure]
emb|CDX85389.1|  BnaC07g27000D                                          117   2e-30   
ref|XP_010442360.1|  PREDICTED: probable histone-arginine methylt...    117   2e-30   
dbj|BAB10326.1|  arginine methyltransferase-like protein                117   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280207.1|  hypothetical protein CARUB_v10026115mg             116   2e-30   Capsella rubella
gb|AAO22781.1|  putative arginine methyltransferase                     116   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129756.1|  PREDICTED: probable histone-arginine methylt...    115   4e-30   Brassica rapa
ref|XP_009384405.1|  PREDICTED: probable histone-arginine methylt...    113   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001759700.1|  protein arginine N-methyltransferase               105   1e-27   
ref|XP_002973896.1|  hypothetical protein SELMODRAFT_149478             103   3e-26   
ref|XP_002969165.1|  hypothetical protein SELMODRAFT_410045             102   4e-26   
gb|AFK44531.1|  unknown                                                 104   1e-24   Medicago truncatula
ref|XP_007035587.1|  Arginine methyltransferase 4B isoform 3          88.2    6e-23   
ref|XP_010914428.1|  PREDICTED: probable histone-arginine methylt...  86.7    3e-21   Elaeis guineensis
ref|XP_005645466.1|  S-adenosyl-L-methionine-dependent methyltran...  86.3    3e-20   Coccomyxa subellipsoidea C-169
gb|EMT08864.1|  Putative histone-arginine methyltransferase CARM1     96.3    1e-19   
ref|XP_006489087.1|  PREDICTED: probable histone-arginine methylt...  90.5    2e-19   Citrus sinensis [apfelsine]
gb|EMS50330.1|  putative histone-arginine methyltransferase CARM1     96.3    2e-19   Triticum urartu
ref|XP_001753890.1|  protein arginine N-methyltransferase             94.4    2e-19   
ref|XP_002958435.1|  hypothetical protein VOLCADRAFT_69442            79.3    9e-16   Volvox carteri f. nagariensis
ref|XP_011398151.1|  putative histone-arginine methyltransferase ...  68.2    1e-14   Auxenochlorella protothecoides
ref|XP_011153280.1|  PREDICTED: histone-arginine methyltransferas...  72.4    2e-13   
ref|XP_011068467.1|  PREDICTED: histone-arginine methyltransferas...  72.0    2e-13   Acromyrmex echinatior
ref|XP_011153278.1|  PREDICTED: histone-arginine methyltransferas...  72.0    2e-13   
ref|XP_011153279.1|  PREDICTED: histone-arginine methyltransferas...  72.0    2e-13   
ref|XP_011171805.1|  PREDICTED: histone-arginine methyltransferas...  72.0    2e-13   Solenopsis invicta [imported red fire ant]
ref|XP_011171800.1|  PREDICTED: histone-arginine methyltransferas...  72.0    3e-13   Solenopsis invicta [imported red fire ant]
ref|XP_003699948.1|  PREDICTED: histone-arginine methyltransferas...  71.6    3e-13   Megachile rotundata
ref|XP_003699947.1|  PREDICTED: histone-arginine methyltransferas...  71.6    3e-13   Megachile rotundata
ref|XP_011171796.1|  PREDICTED: histone-arginine methyltransferas...  72.0    3e-13   Solenopsis invicta [imported red fire ant]
ref|XP_011171789.1|  PREDICTED: histone-arginine methyltransferas...  71.6    3e-13   Solenopsis invicta [imported red fire ant]
ref|XP_011171780.1|  PREDICTED: histone-arginine methyltransferas...  71.6    3e-13   Solenopsis invicta [imported red fire ant]
ref|XP_011068465.1|  PREDICTED: histone-arginine methyltransferas...  71.6    3e-13   Acromyrmex echinatior
ref|XP_011068466.1|  PREDICTED: histone-arginine methyltransferas...  71.6    3e-13   Acromyrmex echinatior
ref|XP_011171773.1|  PREDICTED: histone-arginine methyltransferas...  72.0    3e-13   Solenopsis invicta [imported red fire ant]
ref|XP_011171786.1|  PREDICTED: histone-arginine methyltransferas...  71.6    3e-13   Solenopsis invicta [imported red fire ant]
ref|XP_011334337.1|  PREDICTED: histone-arginine methyltransferas...  71.6    3e-13   Ooceraea biroi
ref|XP_006619600.1|  PREDICTED: histone-arginine methyltransferas...  71.6    3e-13   Apis dorsata [rock honeybee]
ref|XP_006619599.1|  PREDICTED: histone-arginine methyltransferas...  71.6    3e-13   Apis dorsata [rock honeybee]
ref|XP_003250875.1|  PREDICTED: histone-arginine methyltransferas...  71.6    4e-13   Apis mellifera [bee]
ref|XP_003691819.1|  PREDICTED: histone-arginine methyltransferas...  71.6    4e-13   
ref|XP_011171813.1|  PREDICTED: histone-arginine methyltransferas...  71.6    4e-13   Solenopsis invicta [imported red fire ant]
ref|XP_011259471.1|  PREDICTED: histone-arginine methyltransferas...  71.2    4e-13   
ref|XP_011334328.1|  PREDICTED: histone-arginine methyltransferas...  71.2    4e-13   Ooceraea biroi
ref|XP_003691820.1|  PREDICTED: histone-arginine methyltransferas...  71.6    4e-13   Apis florea [dwarf honeybee]
ref|XP_003489685.1|  PREDICTED: histone-arginine methyltransferas...  71.2    4e-13   Bombus impatiens
ref|XP_011334319.1|  PREDICTED: histone-arginine methyltransferas...  71.2    4e-13   Ooceraea biroi
ref|XP_003398778.1|  PREDICTED: histone-arginine methyltransferas...  71.2    4e-13   Bombus terrestris [large earth bumblebee]
ref|XP_011304798.1|  PREDICTED: histone-arginine methyltransferas...  71.2    4e-13   Fopius arisanus
ref|XP_011304799.1|  PREDICTED: histone-arginine methyltransferas...  70.9    4e-13   Fopius arisanus
ref|XP_008543719.1|  PREDICTED: probable histone-arginine methylt...  70.9    5e-13   Microplitis demolitor
ref|XP_008543720.1|  PREDICTED: histone-arginine methyltransferas...  70.9    5e-13   Microplitis demolitor
gb|EHJ77473.1|  hypothetical protein KGM_04110                        67.8    2e-12   
ref|XP_011502373.1|  PREDICTED: histone-arginine methyltransferas...  67.8    4e-12   Ceratosolen solmsi marchali
ref|XP_008200759.1|  PREDICTED: histone-arginine methyltransferas...  71.2    6e-12   Tribolium castaneum [rust-red flour beetle]
ref|XP_008200758.1|  PREDICTED: histone-arginine methyltransferas...  71.2    7e-12   Tribolium castaneum [rust-red flour beetle]
ref|XP_008200757.1|  PREDICTED: histone-arginine methyltransferas...  71.2    7e-12   Tribolium castaneum [rust-red flour beetle]
ref|XP_008200760.1|  PREDICTED: histone-arginine methyltransferas...  70.5    9e-12   Tribolium castaneum [rust-red flour beetle]
ref|XP_001995856.1|  GH14177                                          67.4    9e-12   Drosophila grimshawi
ref|XP_002500316.1|  protein arginine methyltransferase               61.6    1e-11   Micromonas commoda
ref|XP_004926170.1|  PREDICTED: histone-arginine methyltransferas...  67.4    1e-11   
ref|XP_002428291.1|  histone-arginine methyltransferase CARM1, pu...  66.6    2e-11   Pediculus humanus corporis [human body lice]
ref|XP_001953607.1|  GF17144                                          67.4    2e-11   Drosophila ananassae
ref|XP_002001237.1|  GI22087                                          67.4    2e-11   Drosophila mojavensis
ref|XP_002054013.1|  GJ24202                                          67.4    2e-11   Drosophila virilis
ref|XP_001980730.1|  GG17314                                          67.0    3e-11   Drosophila erecta
ref|XP_002104043.1|  GD20747                                          67.0    3e-11   Drosophila simulans
ref|XP_002097037.1|  GE24716                                          67.0    3e-11   Drosophila yakuba
ref|NP_649963.1|  arginine methyltransferase 4, isoform A             67.0    3e-11   Drosophila melanogaster
ref|XP_002031806.1|  GM26200                                          67.0    3e-11   Drosophila sechellia
gb|AAO45207.1|  RE68504p                                              67.0    3e-11   Drosophila melanogaster
ref|XP_001357999.1|  GA18823                                          67.0    3e-11   Drosophila pseudoobscura pseudoobscura
ref|XP_002074175.1|  GK14504                                          67.0    3e-11   Drosophila willistoni
ref|XP_011199153.1|  PREDICTED: histone-arginine methyltransferas...  67.0    3e-11   
ref|XP_005191609.1|  PREDICTED: histone-arginine methyltransferas...  66.6    5e-11   Musca domestica
ref|XP_004529208.1|  PREDICTED: histone-arginine methyltransferas...  67.0    5e-11   Ceratitis capitata [medfly]
gb|ETN64413.1|  histone-arginine methyltransferase CARM1              63.5    6e-11   Anopheles darlingi [American malaria mosquito]
ref|XP_011184873.1|  PREDICTED: histone-arginine methyltransferas...  66.6    6e-11   Zeugodacus cucurbitae [melon fruit fly]
gb|ELK26820.1|  Pumilio domain-containing protein KIAA0020            63.2    8e-11   Myotis davidii
gb|KFB35345.1|  AGAP003923-PA-like protein                            65.1    8e-11   Anopheles sinensis
ref|XP_010007679.1|  PREDICTED: histone-arginine methyltransferas...  65.9    9e-11   Nestor notabilis
ref|XP_003388033.1|  PREDICTED: histone-arginine methyltransferas...  63.2    1e-10   Amphimedon queenslandica
gb|EFX85598.1|  hypothetical protein DAPPUDRAFT_193775                65.9    1e-10   Daphnia pulex
ref|XP_005155168.1|  PREDICTED: histone-arginine methyltransferas...  65.5    2e-10   Melopsittacus undulatus
emb|CAG05964.1|  unnamed protein product                              65.5    2e-10   Tetraodon nigroviridis
gb|AEG90855.1|  histone-arginine methyltransferase CARMER             66.2    2e-10   Apostichopus japonicus
gb|EPQ12832.1|  Pumilio domain-containing protein KIAA0020            61.6    2e-10   Myotis brandtii
ref|XP_006627327.1|  PREDICTED: histone-arginine methyltransferas...  64.3    2e-10   
ref|XP_787264.3|  PREDICTED: histone-arginine methyltransferase C...  64.7    3e-10   
ref|XP_001652238.1|  AAEL006782-PA                                    64.3    3e-10   
ref|XP_010870939.1|  PREDICTED: histone-arginine methyltransferas...  63.5    4e-10   
ref|XP_318375.4|  AGAP003923-PA                                       64.7    5e-10   Anopheles gambiae str. PEST
ref|XP_007255104.1|  PREDICTED: histone-arginine methyltransferas...  64.7    5e-10   
gb|EMP39509.1|  Histone-arginine methyltransferase CARM1              61.2    6e-10   Chelonia mydas [green seaturtle]
ref|XP_009303380.1|  PREDICTED: histone-arginine methyltransferas...  63.9    7e-10   
ref|XP_009303379.1|  PREDICTED: histone-arginine methyltransferas...  63.9    7e-10   
ref|XP_006898910.1|  PREDICTED: histone-arginine methyltransferas...  60.8    7e-10   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004277727.1|  PREDICTED: histone-arginine methyltransferas...  60.8    7e-10   Orcinus orca [Orca]
ref|XP_007575674.1|  PREDICTED: histone-arginine methyltransferas...  63.5    8e-10   
ref|XP_006014686.1|  PREDICTED: LOW QUALITY PROTEIN: coactivator-...  63.5    8e-10   
ref|NP_001244042.1|  protein arginine methyltransferase               64.3    8e-10   Ictalurus punctatus
gb|ELK17830.1|  Histone-arginine methyltransferase CARM1              60.8    8e-10   Pteropus alecto
sp|Q4AE70.1|CARM1_RAT  RecName: Full=Histone-arginine methyltrans...  60.8    8e-10   Rattus norvegicus [brown rat]
ref|XP_007993452.1|  PREDICTED: histone-arginine methyltransferas...  60.8    8e-10   Chlorocebus sabaeus
ref|XP_002114349.1|  hypothetical protein TRIADDRAFT_1535             62.8    8e-10   Trichoplax adhaerens
ref|XP_003413416.1|  PREDICTED: histone-arginine methyltransferas...  60.8    8e-10   
ref|XP_007575673.1|  PREDICTED: histone-arginine methyltransferas...  63.2    9e-10   Poecilia formosa
ref|XP_002942888.1|  PREDICTED: histone-arginine methyltransferas...  63.9    9e-10   Xenopus tropicalis [western clawed frog]
ref|XP_004918927.1|  PREDICTED: histone-arginine methyltransferas...  63.9    9e-10   
gb|ABK56015.1|  coactivator-associated arginine methyltransferase...  63.9    9e-10   Xenopus laevis [clawed frog]
ref|XP_004442736.1|  PREDICTED: histone-arginine methyltransferas...  60.5    9e-10   
ref|XP_008413288.1|  PREDICTED: histone-arginine methyltransferas...  63.2    9e-10   Poecilia reticulata
ref|XP_005347502.1|  PREDICTED: histone-arginine methyltransferas...  60.5    9e-10   
ref|NP_001108248.1|  coactivator-associated arginine methyltransf...  63.5    1e-09   Xenopus laevis [clawed frog]
ref|XP_005811778.1|  PREDICTED: histone-arginine methyltransferas...  63.2    1e-09   
ref|XP_010991569.1|  PREDICTED: histone-arginine methyltransferas...  62.4    1e-09   Camelus dromedarius [camel]
gb|EQB78378.1|  histone-arginine methyltransferase CARM1              60.5    1e-09   Camelus ferus
gb|ELV14040.1|  Histone-arginine methyltransferase CARM1              60.5    1e-09   Tupaia chinensis
ref|XP_002942887.1|  PREDICTED: histone-arginine methyltransferas...  63.5    1e-09   Xenopus tropicalis [western clawed frog]
ref|XP_008954245.1|  PREDICTED: histone-arginine methyltransferas...  60.5    1e-09   Pan paniscus [bonobo]
ref|XP_010966192.1|  PREDICTED: histone-arginine methyltransferas...  62.4    1e-09   Camelus bactrianus [camel]
ref|XP_004918926.1|  PREDICTED: histone-arginine methyltransferas...  63.5    1e-09   
ref|XP_006003608.1|  PREDICTED: histone-arginine methyltransferas...  62.4    1e-09   Latimeria chalumnae
gb|KDR22157.1|  Histone-arginine methyltransferase CARMER             64.3    1e-09   Zootermopsis nevadensis
gb|AAI67706.1|  carm1 protein                                         63.5    1e-09   Xenopus tropicalis [western clawed frog]
ref|XP_006003607.1|  PREDICTED: histone-arginine methyltransferas...  62.4    1e-09   Latimeria chalumnae
ref|XP_006987123.1|  PREDICTED: histone-arginine methyltransferas...  60.5    1e-09   
ref|XP_011287956.1|  PREDICTED: histone-arginine methyltransferas...  60.5    1e-09   
ref|XP_010749350.1|  PREDICTED: histone-arginine methyltransferas...  62.8    1e-09   Larimichthys crocea [croceine croaker]
gb|ELK07031.1|  Histone-arginine methyltransferase CARM1              62.4    1e-09   Pteropus alecto
ref|XP_001843300.1|  histone-arginine methyltransferase CARM1         62.0    1e-09   Culex quinquefasciatus
ref|XP_004568663.1|  PREDICTED: histone-arginine methyltransferas...  62.8    2e-09   Maylandia zebra
ref|XP_008283965.1|  PREDICTED: histone-arginine methyltransferas...  62.4    2e-09   Stegastes partitus
ref|XP_003446486.1|  PREDICTED: histone-arginine methyltransferas...  62.8    2e-09   Oreochromis niloticus
ref|XP_002606913.1|  hypothetical protein BRAFLDRAFT_126366           67.0    2e-09   Branchiostoma floridae
ref|XP_004072083.1|  PREDICTED: histone-arginine methyltransferas...  62.4    2e-09   
ref|XP_011286532.1|  PREDICTED: histone-arginine methyltransferas...  61.2    2e-09   
ref|XP_007094228.1|  PREDICTED: histone-arginine methyltransferas...  61.2    2e-09   Panthera tigris altaica
ref|XP_006208226.1|  PREDICTED: histone-arginine methyltransferas...  62.0    2e-09   
ref|XP_006768311.1|  PREDICTED: histone-arginine methyltransferas...  62.0    2e-09   Myotis davidii
ref|XP_007094227.1|  PREDICTED: histone-arginine methyltransferas...  61.2    2e-09   Panthera tigris altaica
dbj|BAN21131.1|  protein arginine n-methyltransferase                 61.2    2e-09   Riptortus pedestris
ref|XP_007464261.1|  PREDICTED: histone-arginine methyltransferas...  61.6    2e-09   Lipotes vexillifer [baiji]
ref|NP_001244041.1|  protein arginine methyltransferase               62.0    2e-09   Ictalurus punctatus
ref|XP_010966193.1|  PREDICTED: histone-arginine methyltransferas...  61.6    2e-09   Camelus bactrianus [camel]
ref|NP_001088145.1|  histone-arginine methyltransferase CARM1         62.4    2e-09   Xenopus laevis [clawed frog]
ref|XP_006184179.1|  PREDICTED: histone-arginine methyltransferas...  61.2    2e-09   
ref|XP_005874531.1|  PREDICTED: histone-arginine methyltransferas...  61.6    2e-09   
ref|NP_001003645.1|  histone-arginine methyltransferase CARM1         62.0    2e-09   
ref|XP_006918538.1|  PREDICTED: histone-arginine methyltransferas...  61.2    2e-09   
ref|XP_005164073.1|  PREDICTED: histone-arginine methyltransferas...  62.0    2e-09   
gb|KFP41985.1|  Histone-arginine methyltransferase CARM1              61.2    2e-09   
ref|XP_007905291.1|  PREDICTED: histone-arginine methyltransferas...  61.2    2e-09   
ref|XP_008255229.1|  PREDICTED: histone-arginine methyltransferas...  61.6    2e-09   
ref|XP_003964315.1|  PREDICTED: histone-arginine methyltransferas...  61.6    3e-09   
emb|CDI99703.1|  histone arginine methyltransferase CARMER            60.1    3e-09   
ref|XP_009504380.1|  PREDICTED: histone-arginine methyltransferas...  60.8    3e-09   
ref|XP_011374980.1|  PREDICTED: histone-arginine methyltransferas...  61.2    3e-09   
ref|XP_006631533.1|  PREDICTED: histone-arginine methyltransferas...  62.0    3e-09   
ref|XP_008143276.1|  PREDICTED: histone-arginine methyltransferas...  61.2    3e-09   
ref|XP_008101537.1|  PREDICTED: histone-arginine methyltransferas...  60.8    3e-09   
gb|KFO26510.1|  Pumilio domain-containing protein KIAA0020            57.4    3e-09   
ref|XP_006094176.1|  PREDICTED: histone-arginine methyltransferas...  60.8    3e-09   
gb|EUB62938.1|  Histone-arginine methyltransferase CARM1              60.1    3e-09   
gb|KFQ52350.1|  Histone-arginine methyltransferase CARM1              60.8    3e-09   
ref|XP_008328809.1|  PREDICTED: histone-arginine methyltransferas...  61.2    3e-09   
ref|XP_001517823.3|  PREDICTED: histone-arginine methyltransferas...  60.8    3e-09   
ref|XP_008328808.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
ref|XP_008328810.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
ref|XP_008328807.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
ref|XP_010788531.1|  PREDICTED: histone-arginine methyltransferas...  62.8    4e-09   
ref|XP_008049883.1|  PREDICTED: histone-arginine methyltransferas...  60.8    4e-09   
ref|XP_009131707.1|  PREDICTED: uncharacterized protein LOC103856351  62.8    4e-09   
ref|XP_006811636.1|  PREDICTED: histone-arginine methyltransferas...  64.7    4e-09   
ref|XP_006003606.1|  PREDICTED: histone-arginine methyltransferas...  60.5    4e-09   
ref|XP_007430081.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
ref|XP_007430082.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
ref|XP_003798085.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
ref|XP_007430083.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
gb|ETE63391.1|  Histone-arginine methyltransferase CARM1              61.6    4e-09   
ref|XP_009639803.1|  PREDICTED: histone-arginine methyltransferas...  60.5    4e-09   
ref|XP_005336337.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
pdb|2Y1W|A  Chain A, Crystal Structure Of Coactivator Associated ...  61.2    4e-09   
gb|EFB12971.1|  hypothetical protein PANDA_010301                     61.2    4e-09   
gb|KFP18244.1|  Histone-arginine methyltransferase CARM1              60.5    4e-09   
ref|XP_010638438.1|  PREDICTED: histone-arginine methyltransferas...  60.5    4e-09   
ref|XP_010372130.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
gb|KFO91684.1|  Histone-arginine methyltransferase CARM1              59.7    4e-09   
ref|XP_007638657.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
ref|XP_006741125.1|  PREDICTED: histone-arginine methyltransferas...  61.2    4e-09   
gb|KFM07977.1|  Histone-arginine methyltransferase CARM1              60.8    4e-09   
ref|NP_954592.1|  histone-arginine methyltransferase CARM1            61.2    5e-09   
ref|XP_004616833.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_010805154.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
pdb|4IKP|A  Chain A, Crystal Structure Of Coactivator-associated ...  61.2    5e-09   
ref|XP_004866115.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_005674240.1|  PREDICTED: histone-arginine methyltransferas...  60.5    5e-09   
pdb|3B3F|A  Chain A, The 2.2 A Crystal Structure Of The Catalytic...  61.2    5e-09   
ref|XP_007638658.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_003914955.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
gb|KFM62172.1|  Histone-arginine methyltransferase CARMER             60.1    5e-09   
ref|XP_003216889.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_002688914.3|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_008102027.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_010327836.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_009882622.1|  PREDICTED: histone-arginine methyltransferas...  60.5    5e-09   
ref|XP_004009350.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_010633021.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_010805157.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_009191753.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_006206552.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_005632937.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_010327837.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
gb|KGL92712.1|  Histone-arginine methyltransferase CARM1              60.1    5e-09   
ref|XP_008542179.1|  PREDICTED: histone-arginine methyltransferas...  60.5    5e-09   
gb|ELR59995.1|  Histone-arginine methyltransferase CARM1              61.2    5e-09   
ref|XP_004907683.1|  PREDICTED: histone-arginine methyltransferas...  60.5    5e-09   
ref|XP_005259765.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
tpg|DAA27991.1|  TPA: coactivator-associated arginine methyltrans...  61.2    5e-09   
ref|XP_003760505.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_004633051.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_011378654.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_008173665.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|NP_067506.2|  histone-arginine methyltransferase CARM1 isoform 1  61.2    5e-09   
ref|XP_009432979.1|  PREDICTED: LOW QUALITY PROTEIN: histone-argi...  61.2    5e-09   
ref|XP_004286277.1|  PREDICTED: histone-arginine methyltransferas...  61.6    5e-09   
ref|XP_001916423.2|  PREDICTED: LOW QUALITY PROTEIN: histone-argi...  61.2    5e-09   
gb|AAH46240.1|  CARM1 protein                                         60.8    5e-09   
gb|ELU16220.1|  hypothetical protein CAPTEDRAFT_179627                62.4    5e-09   
gb|AID68328.1|  coactivator-associated arginine methyltransferase...  61.2    5e-09   
ref|XP_010805156.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
emb|CBY24231.1|  unnamed protein product                              62.4    5e-09   
ref|XP_005208865.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_006068444.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_006185070.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_005859258.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_010581165.1|  PREDICTED: histone-arginine methyltransferas...  60.1    5e-09   
ref|XP_003461301.2|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_006161647.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_004688793.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|NP_001029260.1|  histone-arginine methyltransferase CARM1 iso...  61.2    5e-09   
ref|XP_008831771.1|  PREDICTED: histone-arginine methyltransferas...  60.8    5e-09   
ref|XP_007182364.1|  PREDICTED: histone-arginine methyltransferas...  61.6    5e-09   
ref|XP_010976622.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_006905976.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_006106015.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_009278232.1|  PREDICTED: histone-arginine methyltransferas...  60.5    5e-09   
ref|XP_008572026.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_007951782.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_005078645.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_009952554.1|  PREDICTED: histone-arginine methyltransferas...  60.1    5e-09   
ref|XP_004399060.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
pdb|3B3J|A  Chain A, The 2.55 A Crystal Structure Of The Apo Cata...  61.2    5e-09   
ref|XP_010304008.1|  PREDICTED: histone-arginine methyltransferas...  60.1    5e-09   
ref|XP_010796588.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_004900430.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_011225938.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_004716890.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_004595805.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_010805155.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_008055783.1|  PREDICTED: histone-arginine methyltransferas...  60.8    5e-09   
ref|XP_006068445.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_011225937.1|  PREDICTED: histone-arginine methyltransferas...  60.8    5e-09   
ref|XP_005588718.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_003123256.3|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_007460820.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_004667480.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_007055943.1|  PREDICTED: histone-arginine methyltransferas...  61.2    5e-09   
ref|XP_010826648.1|  PREDICTED: histone-arginine methyltransferas...  61.2    6e-09   
ref|XP_004838511.1|  PREDICTED: histone-arginine methyltransferas...  60.1    6e-09   
gb|EDL25201.1|  coactivator-associated arginine methyltransferase 1   61.2    6e-09   
ref|XP_006023538.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
ref|XP_004093251.1|  PREDICTED: LOW QUALITY PROTEIN: histone-argi...  60.8    6e-09   
ref|XP_010167620.1|  PREDICTED: histone-arginine methyltransferas...  60.1    6e-09   
ref|XP_007629789.1|  PREDICTED: histone-arginine methyltransferas...  61.2    6e-09   
ref|XP_005970374.1|  PREDICTED: histone-arginine methyltransferas...  61.2    6e-09   
pdb|2V74|B  Chain B, Crystal Structure Of Coactivator-Associated ...  60.8    6e-09   
ref|XP_006265675.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
gb|ELK28713.1|  Histone-arginine methyltransferase CARM1              60.8    6e-09   
ref|XP_002801119.1|  PREDICTED: histone-arginine methyltransferas...  61.2    6e-09   
gb|KFZ47388.1|  Histone-arginine methyltransferase CARM1              60.1    6e-09   
ref|XP_003762172.1|  PREDICTED: histone-arginine methyltransferas...  60.1    6e-09   
ref|XP_008156317.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
dbj|BAE34644.1|  unnamed protein product                              61.2    6e-09   
ref|XP_007079410.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
ref|XP_004311240.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
gb|EHB12942.1|  Histone-arginine methyltransferase CARM1              60.8    6e-09   
gb|EPQ03298.1|  Histone-arginine methyltransferase CARM1              60.8    6e-09   
ref|XP_005890881.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
ref|XP_007488937.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
gb|KFO28764.1|  Histone-arginine methyltransferase CARM1              60.8    6e-09   
ref|XP_006765890.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
dbj|BAE16335.1|  coactivator-associated arginine methyltransferas...  60.8    6e-09   
gb|EHH59210.1|  hypothetical protein EGM_09266                        61.2    6e-09   
ref|XP_004748673.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
ref|XP_005616878.1|  PREDICTED: histone-arginine methyltransferas...  60.5    6e-09   
ref|XP_006875227.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
ref|XP_004378607.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
gb|EHH29636.1|  hypothetical protein EGK_10113                        61.2    6e-09   
gb|AAH03964.1|  Carm1 protein                                         60.5    6e-09   
gb|EAW84155.1|  coactivator-associated arginine methyltransferase...  60.8    6e-09   
ref|XP_007526103.1|  PREDICTED: histone-arginine methyltransferas...  60.8    6e-09   
gb|KFV85831.1|  Histone-arginine methyltransferase CARM1              59.7    6e-09   
gb|ACH71268.1|  coactivator-associated arginine methyltransferase 1   60.8    6e-09   
ref|XP_007638656.1|  PREDICTED: histone-arginine methyltransferas...  60.8    7e-09   
ref|XP_005406190.1|  PREDICTED: histone-arginine methyltransferas...  60.8    7e-09   
ref|XP_007499582.1|  PREDICTED: histone-arginine methyltransferas...  59.7    7e-09   
ref|XP_004900431.1|  PREDICTED: histone-arginine methyltransferas...  60.5    7e-09   
ref|XP_010805153.1|  PREDICTED: histone-arginine methyltransferas...  60.8    7e-09   
ref|XP_005605198.1|  PREDICTED: histone-arginine methyltransferas...  59.7    7e-09   
ref|XP_002761788.1|  PREDICTED: histone-arginine methyltransferas...  61.2    7e-09   
ref|XP_009682022.1|  PREDICTED: histone-arginine methyltransferas...  59.7    7e-09   
ref|XP_006274718.1|  PREDICTED: histone-arginine methyltransferas...  59.7    7e-09   
ref|XP_007499583.1|  PREDICTED: histone-arginine methyltransferas...  59.7    7e-09   
ref|XP_007065682.1|  PREDICTED: histone-arginine methyltransferas...  59.7    7e-09   
ref|XP_007169268.1|  PREDICTED: histone-arginine methyltransferas...  60.8    7e-09   
ref|XP_006129962.1|  PREDICTED: histone-arginine methyltransferas...  59.7    7e-09   
gb|KFP93233.1|  Histone-arginine methyltransferase CARM1              59.3    7e-09   
ref|XP_006025479.1|  PREDICTED: histone-arginine methyltransferas...  59.7    7e-09   
ref|XP_002169585.2|  PREDICTED: histone-arginine methyltransferas...  62.0    8e-09   
ref|XP_011223099.1|  PREDICTED: histone-arginine methyltransferas...  59.7    8e-09   
ref|XP_004600389.1|  PREDICTED: histone-arginine methyltransferas...  58.9    8e-09   
ref|XP_008185717.1|  PREDICTED: histone-arginine methyltransferas...  59.3    8e-09   
ref|XP_004457467.1|  PREDICTED: histone-arginine methyltransferas...  59.7    8e-09   
ref|XP_009929144.1|  PREDICTED: histone-arginine methyltransferas...  59.3    8e-09   
ref|XP_001945590.2|  PREDICTED: histone-arginine methyltransferas...  59.3    8e-09   
ref|XP_004447793.1|  PREDICTED: histone-arginine methyltransferas...  60.5    8e-09   
ref|XP_007107347.1|  PREDICTED: histone-arginine methyltransferas...  60.5    8e-09   
ref|XP_003377729.1|  histone-arginine methyltransferase CARM1         59.7    9e-09   
ref|XP_004766258.1|  PREDICTED: histone-arginine methyltransferas...  59.3    9e-09   
ref|XP_005296839.1|  PREDICTED: histone-arginine methyltransferas...  59.3    9e-09   
gb|KFW69346.1|  Histone-arginine methyltransferase CARM1              59.7    1e-08   
ref|XP_004678058.1|  PREDICTED: histone-arginine methyltransferas...  59.3    1e-08   
ref|XP_009325567.1|  PREDICTED: histone-arginine methyltransferas...  59.7    1e-08   
ref|XP_006510583.1|  PREDICTED: histone-arginine methyltransferas...  60.1    1e-08   
ref|XP_005437599.1|  PREDICTED: histone-arginine methyltransferas...  59.3    1e-08   
ref|XP_005241680.1|  PREDICTED: histone-arginine methyltransferas...  59.3    1e-08   
ref|XP_007423440.1|  PREDICTED: histone-arginine methyltransferas...  58.9    1e-08   
ref|XP_007423439.1|  PREDICTED: histone-arginine methyltransferas...  58.9    1e-08   
gb|EHB17438.1|  Histone-arginine methyltransferase CARM1              58.9    1e-08   
ref|XP_007890799.1|  PREDICTED: histone-arginine methyltransferas...  60.5    1e-08   
ref|XP_007423438.1|  PREDICTED: histone-arginine methyltransferas...  58.9    1e-08   
ref|XP_007890798.1|  PREDICTED: histone-arginine methyltransferas...  60.5    1e-08   
ref|XP_009695553.1|  PREDICTED: histone-arginine methyltransferas...  58.5    1e-08   
ref|XP_004394590.1|  PREDICTED: histone-arginine methyltransferas...  58.9    1e-08   
ref|XP_006736578.1|  PREDICTED: histone-arginine methyltransferas...  58.5    1e-08   
gb|KFV19829.1|  Histone-arginine methyltransferase CARM1              60.1    1e-08   
ref|XP_003429617.1|  PREDICTED: histone-arginine methyltransferas...  59.3    1e-08   
gb|KFQ94770.1|  Histone-arginine methyltransferase CARM1              58.5    1e-08   
ref|XP_009460516.1|  PREDICTED: histone-arginine methyltransferas...  58.5    1e-08   
ref|XP_010118796.1|  PREDICTED: histone-arginine methyltransferas...  58.5    2e-08   
ref|XP_008539059.1|  PREDICTED: histone-arginine methyltransferas...  60.1    2e-08   
ref|XP_009482710.1|  PREDICTED: LOW QUALITY PROTEIN: histone-argi...  58.2    2e-08   
ref|XP_009568785.1|  PREDICTED: LOW QUALITY PROTEIN: histone-argi...  59.7    2e-08   
ref|XP_009012068.1|  hypothetical protein HELRODRAFT_72919            59.7    2e-08   
ref|XP_009805238.1|  PREDICTED: histone-arginine methyltransferas...  58.2    2e-08   
ref|XP_004987541.1|  hypothetical protein PTSG_11441                  59.7    2e-08   
emb|CDX77277.1|  BnaC08g03220D                                        63.2    2e-08   
emb|CDQ60270.1|  unnamed protein product                              58.9    2e-08   
ref|XP_010137555.1|  PREDICTED: histone-arginine methyltransferas...  57.4    2e-08   
ref|XP_008689234.1|  PREDICTED: histone-arginine methyltransferas...  58.2    2e-08   
gb|ETE71430.1|  Histone-arginine methyltransferase CARM1              54.7    2e-08   
ref|XP_009166181.1|  hypothetical protein T265_03433                  57.0    2e-08   
ref|XP_003144122.1|  Carm1-pending protein                            57.4    3e-08   
ref|XP_005507220.1|  PREDICTED: histone-arginine methyltransferas...  57.8    3e-08   
gb|EMC85642.1|  Histone-arginine methyltransferase CARM1              57.8    3e-08   
ref|XP_010875600.1|  PREDICTED: histone-arginine methyltransferas...  57.4    5e-08   



>ref|XP_009777618.1| PREDICTED: probable histone-arginine methyltransferase 1.3 [Nicotiana 
sylvestris]
Length=527

 Score =   166 bits (420),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 102/115 (89%), Gaps = 1/115 (1%)
 Frame = -2

Query  561  HWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLDLKE  382
            HWYQLRCVL QPLYVMPGQEITGRL LVAHKAQSYTIYLTLSA VGDMLQ+S+ KLDLKE
Sbjct  413  HWYQLRCVLPQPLYVMPGQEITGRLHLVAHKAQSYTIYLTLSALVGDMLQTSSVKLDLKE  472

Query  381  PYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNADLQSL  220
            PYYRMSQPQ+YS +QD QPNQLLQTQD ++ SRD+D +ILMQ  SPNS ADL SL
Sbjct  473  PYYRMSQPQAYSLAQDQQPNQLLQTQDIELPSRDEDGSILMQPPSPNSGADLHSL  527


 Score = 46.6 bits (109),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  385  GLACWFDVLFNGSTVQRWL  403



>ref|XP_009779154.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X1 [Nicotiana sylvestris]
Length=531

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 110/142 (77%), Gaps = 6/142 (4%)
 Frame = -2

Query  627  MCCLTGALFRGG*-PLLLV----HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQ  463
            + C    LF G   P  L      P  HWYQLRCVLSQPLYVMPGQEITGRL+LVAHKAQ
Sbjct  390  LACWFDVLFNGSTVPRWLTTAPGAPTTHWYQLRCVLSQPLYVMPGQEITGRLRLVAHKAQ  449

Query  462  SYTIYLTLSAQVGDMLQSSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsr  286
            SYTIYLTLSA VGD+LQ+S+GKLDLKEPYYRMSQPQ+YS +QD QPNQLLQ QD   QSR
Sbjct  450  SYTIYLTLSATVGDVLQTSSGKLDLKEPYYRMSQPQAYSLAQDQQPNQLLQAQDILTQSR  509

Query  285  dddDAILMQQLSPNSNADLQSL  220
            D+D ++ +Q  SPNS A+L SL
Sbjct  510  DEDGSVPVQHPSPNSVAELHSL  531



>ref|XP_009630322.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X1 [Nicotiana tomentosiformis]
Length=531

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 110/142 (77%), Gaps = 6/142 (4%)
 Frame = -2

Query  627  MCCLTGALFRGG*-PLLLV----HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQ  463
            + C    LF G   P  L      P  HWYQLRCVLSQPLYVMPGQEITGRL+LV+HKAQ
Sbjct  390  LACWFDVLFNGSTVPRWLTTAPGAPTTHWYQLRCVLSQPLYVMPGQEITGRLRLVSHKAQ  449

Query  462  SYTIYLTLSAQVGDMLQSSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsr  286
            SYTIYLTLSA VGD+LQ+S+GKLDLKEPYYRMSQPQ+YS +QD QPNQLLQ QD   QSR
Sbjct  450  SYTIYLTLSATVGDVLQTSSGKLDLKEPYYRMSQPQAYSLAQDQQPNQLLQAQDILTQSR  509

Query  285  dddDAILMQQLSPNSNADLQSL  220
            D+D ++ +QQ SPN  A+L SL
Sbjct  510  DEDGSVPVQQPSPNFCAELHSL  531



>ref|XP_009612678.1| PREDICTED: probable histone-arginine methyltransferase 1.3 [Nicotiana 
tomentosiformis]
Length=527

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 109/142 (77%), Gaps = 6/142 (4%)
 Frame = -2

Query  627  MCCLTGALFRGG*PLLLVHPQP-----HWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQ  463
            + C    LF G      +   P     HWYQLRCVL QPLYVMPGQEITGRL LVAHKAQ
Sbjct  386  LACWFDVLFNGSTVQRWLTTAPGAATTHWYQLRCVLPQPLYVMPGQEITGRLHLVAHKAQ  445

Query  462  SYTIYLTLSAQVGDMLQSSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsr  286
            SYTIYLTLSA VGDMLQ+S+ KLDLKEPYYRMSQPQ+YS +QD QPNQLLQTQD ++ SR
Sbjct  446  SYTIYLTLSALVGDMLQTSSVKLDLKEPYYRMSQPQAYSLAQDQQPNQLLQTQDIELPSR  505

Query  285  dddDAILMQQLSPNSNADLQSL  220
            D+D +ILMQ  SPNS A+L SL
Sbjct  506  DEDGSILMQPPSPNSGAELHSL  527



>ref|XP_009779155.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X2 [Nicotiana sylvestris]
Length=509

 Score =   157 bits (397),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 1/86 (1%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQLRCVLSQPLYVMPGQEITGRL+LVAHKAQSYTIYLTLSA VGD+LQ+S+GKLD
Sbjct  414  PTTHWYQLRCVLSQPLYVMPGQEITGRLRLVAHKAQSYTIYLTLSATVGDVLQTSSGKLD  473

Query  390  LKEPYYRMSQPQSYSASQD-QPNQLL  316
            LKEPYYRMSQPQ+YS +QD QPNQLL
Sbjct  474  LKEPYYRMSQPQAYSLAQDQQPNQLL  499


 Score = 44.3 bits (103),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTV RWL
Sbjct  389  GLACWFDVLFNGSTVPRWL  407



>ref|XP_009630323.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X2 [Nicotiana tomentosiformis]
Length=515

 Score =   156 bits (395),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 1/86 (1%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQLRCVLSQPLYVMPGQEITGRL+LV+HKAQSYTIYLTLSA VGD+LQ+S+GKLD
Sbjct  414  PTTHWYQLRCVLSQPLYVMPGQEITGRLRLVSHKAQSYTIYLTLSATVGDVLQTSSGKLD  473

Query  390  LKEPYYRMSQPQSYSASQD-QPNQLL  316
            LKEPYYRMSQPQ+YS +QD QPNQLL
Sbjct  474  LKEPYYRMSQPQAYSLAQDQQPNQLL  499


 Score = 44.3 bits (103),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTV RWL
Sbjct  389  GLACWFDVLFNGSTVPRWL  407



>ref|XP_009630324.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X3 [Nicotiana tomentosiformis]
Length=509

 Score =   156 bits (394),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 1/86 (1%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQLRCVLSQPLYVMPGQEITGRL+LV+HKAQSYTIYLTLSA VGD+LQ+S+GKLD
Sbjct  414  PTTHWYQLRCVLSQPLYVMPGQEITGRLRLVSHKAQSYTIYLTLSATVGDVLQTSSGKLD  473

Query  390  LKEPYYRMSQPQSYSASQD-QPNQLL  316
            LKEPYYRMSQPQ+YS +QD QPNQLL
Sbjct  474  LKEPYYRMSQPQAYSLAQDQQPNQLL  499


 Score = 44.3 bits (103),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTV RWL
Sbjct  389  GLACWFDVLFNGSTVPRWL  407



>ref|XP_004239813.1| PREDICTED: probable histone-arginine methyltransferase 1.3 [Solanum 
lycopersicum]
Length=527

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 106/141 (75%), Gaps = 6/141 (4%)
 Frame = -2

Query  627  MCCLTGALFRGG*-PLLLV----HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQ  463
            + C    LF G   P  L      P  HWYQLRCVLSQPLYVMPGQEITG  +LVAH+AQ
Sbjct  388  LACWFDVLFNGSTVPRWLTTAPGAPTTHWYQLRCVLSQPLYVMPGQEITGNFRLVAHRAQ  447

Query  462  SYTIYLTLSAQVGDMLQSSTGKLDLKEPYYRMSQPQSYSASQDQPNQLLqtqdsqmqsrd  283
            SYTIYLTLSA VGDMLQ+S+GKLDLKEPYYRMSQPQ+YS++Q+ PNQLLQTQD   QS  
Sbjct  448  SYTIYLTLSATVGDMLQTSSGKLDLKEPYYRMSQPQAYSSAQE-PNQLLQTQDVLTQSWV  506

Query  282  ddDAILMQQLSPNSNADLQSL  220
            +D  + +QQ SPN   +LQ+L
Sbjct  507  EDGLVPVQQPSPNHGVELQTL  527



>ref|XP_004252900.1| PREDICTED: probable histone-arginine methyltransferase 1.3 [Solanum 
lycopersicum]
Length=522

 Score =   153 bits (386),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQLRCVL QPLYVMPGQEITGRL LVAHKAQSYTIYLTLSA VGDMLQ+S+ KLD
Sbjct  409  PTTHWYQLRCVLPQPLYVMPGQEITGRLHLVAHKAQSYTIYLTLSALVGDMLQTSSVKLD  468

Query  390  LKEPYYRMSQPQSYSASQDQ-PNQLLqtqdsqmqsrdddDAILMQQLSPN  244
            LKEPYYRMSQPQSYSA+QDQ P+QLL   D Q  SRDDD +ILMQ  SPN
Sbjct  469  LKEPYYRMSQPQSYSAAQDQNPSQLL-QSDMQFPSRDDDGSILMQPPSPN  517


 Score = 46.6 bits (109),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  384  GLACWFDVLFNGSTVQRWL  402



>ref|XP_006349813.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
[Solanum tuberosum]
Length=521

 Score =   152 bits (383),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQLRCVL QPLYVMPGQEITGRL LVAHKAQSYTIYLTLSA VGDMLQ+S+ KLD
Sbjct  408  PTTHWYQLRCVLPQPLYVMPGQEITGRLHLVAHKAQSYTIYLTLSALVGDMLQTSSVKLD  467

Query  390  LKEPYYRMSQPQSYSASQDQ-PNQLLqtqdsqmqsrdddDAILMQQLSPN  244
            LKEPYYRMSQPQ+YSA+QDQ P+QLL   D Q  SRDDD +ILMQ  SPN
Sbjct  468  LKEPYYRMSQPQAYSAAQDQNPSQLL-QSDMQFPSRDDDGSILMQPPSPN  516


 Score = 46.6 bits (109),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  383  GLACWFDVLFNGSTVQRWL  401



>ref|XP_006365839.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
[Solanum tuberosum]
Length=527

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 105/141 (74%), Gaps = 6/141 (4%)
 Frame = -2

Query  627  MCCLTGALFRGG*-PLLLV----HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQ  463
            + C    LF G   P  L      P  HWYQLRCVL QPLYVMPGQEITG  +LVAHKAQ
Sbjct  388  LACWFDVLFNGSTVPRWLTTAPGAPTTHWYQLRCVLPQPLYVMPGQEITGHFRLVAHKAQ  447

Query  462  SYTIYLTLSAQVGDMLQSSTGKLDLKEPYYRMSQPQSYSASQDQPNQLLqtqdsqmqsrd  283
            SYTIYLTLSA VGDMLQ+S+GKLDLKEPYYRMSQPQ+YS++Q+ PNQLLQTQD   QS  
Sbjct  448  SYTIYLTLSATVGDMLQTSSGKLDLKEPYYRMSQPQAYSSAQE-PNQLLQTQDVLTQSWV  506

Query  282  ddDAILMQQLSPNSNADLQSL  220
            +D ++ +QQ SPN  A+L  L
Sbjct  507  EDGSVPVQQPSPNHGAELHPL  527



>ref|XP_004143091.1| PREDICTED: probable histone-arginine methyltransferase 1.4-like 
[Cucumis sativus]
 ref|XP_004163234.1| PREDICTED: probable histone-arginine methyltransferase 1.4-like 
[Cucumis sativus]
Length=540

 Score =   141 bits (355),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (77%), Gaps = 7/124 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH AQSYT+YLTLSA++       G +LQ
Sbjct  415  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMVAHSAQSYTLYLTLSAKMWGPGAEQGGILQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQLLqtqdsqmqsrdddDAILMQQLSPNSNAD  232
            SS+ KLDLKEPYYRMSQPQ Y  +QDQ +QL+ +QD  +Q +D +DA LM Q SPNS A 
Sbjct  475  SSSCKLDLKEPYYRMSQPQVYPVAQDQQHQLIPSQDVPIQPQDLEDADLMLQASPNSGAP  534

Query  231  LQSL  220
            L SL
Sbjct  535  LNSL  538


 Score = 46.6 bits (109),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  390  GLACWFDVLFNGSTVQRWL  408



>ref|XP_008458452.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Cucumis 
melo]
Length=540

 Score =   140 bits (353),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 94/124 (76%), Gaps = 7/124 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH AQSYT+YLTLSA++       G +LQ
Sbjct  415  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMVAHSAQSYTLYLTLSAKMWGPGAEQGGILQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQLLqtqdsqmqsrdddDAILMQQLSPNSNAD  232
            SS+ KLDLKEPYYRMSQPQ Y  +QDQ +QL+  QD  +Q +D +DA LM Q SPNS A 
Sbjct  475  SSSCKLDLKEPYYRMSQPQVYPVAQDQQHQLIPPQDVPIQPQDLEDADLMLQASPNSGAP  534

Query  231  LQSL  220
            L SL
Sbjct  535  LNSL  538


 Score = 46.6 bits (109),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  390  GLACWFDVLFNGSTVQRWL  408



>ref|XP_010098279.1| putative histone-arginine methyltransferase 1.4 [Morus notabilis]
 gb|EXB74783.1| putative histone-arginine methyltransferase 1.4 [Morus notabilis]
Length=544

 Score =   140 bits (352),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 8/125 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL++VAH AQSYTIYLTLSA++       G +LQ
Sbjct  418  PTTHWYQLRCVLSQPIYVMAGQEITGRLRMVAHDAQSYTIYLTLSAKMWGPGAEQGGILQ  477

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +S+ KLDLKEPYYRMSQPQ+Y+ +QD QPNQL+QTQD  +QS+D DD  L+ Q SP+S A
Sbjct  478  TSSCKLDLKEPYYRMSQPQAYALAQDQQPNQLIQTQDIPIQSQDLDDIELLAQPSPSSGA  537

Query  234  DLQSL  220
             L +L
Sbjct  538  QLNTL  542


 Score = 46.2 bits (108),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  393  GLACWFDVLFNGSTVQRWL  411



>ref|XP_003609673.1| Protein arginine N-methyltransferase [Medicago truncatula]
 gb|AES91870.1| histone-arginine methyltransferase, putative [Medicago truncatula]
Length=534

 Score =   139 bits (351),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 98/125 (78%), Gaps = 8/125 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  406  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  465

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +S+ KLDLKEPYYRMSQPQ+Y  +QD QP  L+QTQD  +QS++ D+  +MQQLSPNS A
Sbjct  466  TSSCKLDLKEPYYRMSQPQAYPLAQDQQPQPLVQTQDIHIQSQELDEPEIMQQLSPNSCA  525

Query  234  DLQSL  220
             + SL
Sbjct  526  QIDSL  530


 Score = 46.6 bits (109),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  381  GLACWFDVLFNGSTVQRWL  399



>ref|XP_007035586.1| Arginine methyltransferase 4B isoform 2 [Theobroma cacao]
 gb|EOY06512.1| Arginine methyltransferase 4B isoform 2 [Theobroma cacao]
Length=531

 Score =   137 bits (345),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 2/116 (2%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RCVLSQP+YVM GQEITGRL ++AH AQSYTIYLTLS Q G +LQ+S+ KLD
Sbjct  417  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTIYLTLSEQ-GGILQTSSCKLD  475

Query  390  LKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNADLQ  226
            LKEPYYRMSQPQ Y+ +QD QP+QLLQ QD  + + D ++  L+QQ S NS A LQ
Sbjct  476  LKEPYYRMSQPQPYTLAQDQQPHQLLQAQDIPIHAEDLEEPELLQQPSENSGAQLQ  531


 Score = 46.6 bits (109),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  392  GLACWFDVLFNGSTVQRWL  410



>gb|KEH32288.1| histone-arginine methyltransferase, putative [Medicago truncatula]
Length=527

 Score =   137 bits (344),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 87/124 (70%), Gaps = 13/124 (10%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  406  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  465

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQLLqtqdsqmqsrdddDAILMQQLSPNSNAD  232
            +S+ KLDLKEPYYRMSQPQ+Y  +QDQ  Q L       +        +MQQLSPNS A 
Sbjct  466  TSSCKLDLKEPYYRMSQPQAYPLAQDQQPQPLVQTQELDEPE------IMQQLSPNSCAQ  519

Query  231  LQSL  220
            + SL
Sbjct  520  IDSL  523


 Score = 46.6 bits (109),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  381  GLACWFDVLFNGSTVQRWL  399



>ref|XP_011090965.1| PREDICTED: probable histone-arginine methyltransferase 1.3 [Sesamum 
indicum]
Length=519

 Score =   137 bits (345),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 7/89 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVMPGQEITGRL +VAHKAQSYT+YLTLSA++       G +LQ
Sbjct  405  PTTHWYQLRCVLSQPIYVMPGQEITGRLHMVAHKAQSYTLYLTLSAKMWGPGAEQGGILQ  464

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPN  325
            SS+GKLDLKEPYYRMSQPQ+Y  SQ+QP+
Sbjct  465  SSSGKLDLKEPYYRMSQPQAYPMSQEQPS  493


 Score = 46.6 bits (109),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  380  GLACWFDVLFNGSTVQRWL  398



>ref|XP_007035585.1| Arginine methyltransferase 4A isoform 1 [Theobroma cacao]
 gb|EOY06511.1| Arginine methyltransferase 4A isoform 1 [Theobroma cacao]
Length=539

 Score =   135 bits (341),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 8/123 (7%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL ++AH AQSYTIYLTLSA++       G +LQ
Sbjct  417  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  476

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +S+ KLDLKEPYYRMSQPQ Y+ +QD QP+QLLQ QD  + + D ++  L+QQ S NS A
Sbjct  477  TSSCKLDLKEPYYRMSQPQPYTLAQDQQPHQLLQAQDIPIHAEDLEEPELLQQPSENSGA  536

Query  234  DLQ  226
             LQ
Sbjct  537  QLQ  539


 Score = 46.6 bits (109),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  392  GLACWFDVLFNGSTVQRWL  410



>ref|XP_004508215.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
isoform X1 [Cicer arietinum]
Length=534

 Score =   135 bits (339),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 8/125 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  406  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  465

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +S+ KLDLKEPYYRMSQPQ+Y  +QD QP  L+QTQD  +Q+++ ++  ++QQ SPNS A
Sbjct  466  TSSCKLDLKEPYYRMSQPQAYPLAQDQQPQPLVQTQDIHIQNQELEEPEILQQPSPNSCA  525

Query  234  DLQSL  220
             + SL
Sbjct  526  QIDSL  530


 Score = 46.6 bits (109),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  381  GLACWFDVLFNGSTVQRWL  399



>ref|XP_007154284.1| hypothetical protein PHAVU_003G105500g [Phaseolus vulgaris]
 gb|ESW26278.1| hypothetical protein PHAVU_003G105500g [Phaseolus vulgaris]
Length=529

 Score =   134 bits (337),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 88/124 (71%), Gaps = 13/124 (10%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  408  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  467

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQLLqtqdsqmqsrdddDAILMQQLSPNSNAD  232
            +S+ KLDLKEPYYRMSQPQ+Y+ +QDQ  QLL       +        +++Q SPNS+  
Sbjct  468  TSSCKLDLKEPYYRMSQPQAYAFAQDQQPQLLIPTQDVDEPE------IVRQPSPNSSVQ  521

Query  231  LQSL  220
            + SL
Sbjct  522  IDSL  525


 Score = 46.6 bits (109),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  383  GLACWFDVLFNGSTVQRWL  401



>ref|XP_007154285.1| hypothetical protein PHAVU_003G105500g [Phaseolus vulgaris]
 gb|ESW26279.1| hypothetical protein PHAVU_003G105500g [Phaseolus vulgaris]
Length=536

 Score =   134 bits (336),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 8/125 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  408  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  467

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +S+ KLDLKEPYYRMSQPQ+Y+ +QD QP  L+ TQD  +QS+D D+  +++Q SPNS+ 
Sbjct  468  TSSCKLDLKEPYYRMSQPQAYAFAQDQQPQLLIPTQDIHIQSQDVDEPEIVRQPSPNSSV  527

Query  234  DLQSL  220
             + SL
Sbjct  528  QIDSL  532


 Score = 46.6 bits (109),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  383  GLACWFDVLFNGSTVQRWL  401



>ref|XP_006600355.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
isoform X2 [Glycine max]
Length=534

 Score =   133 bits (335),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 8/125 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  406  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  465

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +S+ KLDLKEPYYRMSQPQ+Y+ +QD QP  L+QTQD  +QS+D D+  ++QQ  PNS A
Sbjct  466  TSSCKLDLKEPYYRMSQPQAYALAQDQQPQPLIQTQDIHIQSQDLDEPEIVQQPLPNSCA  525

Query  234  DLQSL  220
             + SL
Sbjct  526  QIDSL  530


 Score = 46.2 bits (108),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  381  GLACWFDVLFNGSTVQRWL  399



>ref|XP_003550276.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
isoform X1 [Glycine max]
 gb|KHN03360.1| Putative histone-arginine methyltransferase 1.4 [Glycine soja]
Length=535

 Score =   133 bits (335),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 8/125 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  407  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  466

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +S+ KLDLKEPYYRMSQPQ+Y+ +QD QP  L+QTQD  +QS+D D+  ++QQ  PNS A
Sbjct  467  TSSCKLDLKEPYYRMSQPQAYALAQDQQPQPLIQTQDIHIQSQDLDEPEIVQQPLPNSCA  526

Query  234  DLQSL  220
             + SL
Sbjct  527  QIDSL  531


 Score = 46.2 bits (108),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  382  GLACWFDVLFNGSTVQRWL  400



>ref|XP_002516920.1| protein arginine n-methyltransferase, putative [Ricinus communis]
 gb|EEF45534.1| protein arginine n-methyltransferase, putative [Ricinus communis]
Length=541

 Score =   133 bits (335),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 78/93 (84%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL++VAH AQSYTIYLTLSA++       G +LQ
Sbjct  419  PTTHWYQLRCVLSQPIYVMAGQEITGRLRMVAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  478

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ+Y+ +QD QP+QL+
Sbjct  479  TSSCKLDLKEPYYRMSQPQTYAMAQDQQPHQLI  511


 Score = 46.2 bits (108),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  394  GLACWFDVLFNGSTVQRWL  412



>gb|EYU43947.1| hypothetical protein MIMGU_mgv1a004608mg [Erythranthe guttata]
Length=518

 Score =   133 bits (334),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 8/90 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVL+QP+YVMPGQEITGRL++VAHKAQSYT+ LTLSA++       G +LQ
Sbjct  404  PTTHWYQLRCVLAQPIYVMPGQEITGRLQMVAHKAQSYTLNLTLSAKMWGPGAEQGGILQ  463

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPN  325
            +S+GKLDLKEPYYRMSQPQ+Y+ SQ+ QPN
Sbjct  464  TSSGKLDLKEPYYRMSQPQTYATSQEQQPN  493


 Score = 46.2 bits (108),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  379  GLACWFDVLFNGSTVQRWL  397



>gb|KEH37263.1| histone-arginine methyltransferase, putative [Medicago truncatula]
Length=537

 Score =   131 bits (330),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 93/126 (74%), Gaps = 9/126 (7%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL LVAH AQSYTIYLTLSA++       G +LQ
Sbjct  408  PVTHWYQLRCVLSQPIYVMAGQEITGRLHLVAHSAQSYTIYLTLSAKMWGPGAEQGGILQ  467

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ--LLqtqdsqmqsrdddDAILMQQLSPNSN  238
            +S+ KLDLKEPYYRMSQ QSY  +QDQP     L TQD +++S+D DD  +MQ+ SPNS 
Sbjct  468  TSSCKLDLKEPYYRMSQQQSYPTTQDQPQAQPFLPTQDVKIKSQDFDDTEIMQEPSPNSC  527

Query  237  ADLQSL  220
              + S 
Sbjct  528  VQIDSF  533


 Score = 46.2 bits (108),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  383  GLACWFDVLFNGSTVQRWL  401



>ref|XP_006600356.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
isoform X3 [Glycine max]
Length=528

 Score =   130 bits (328),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 86/124 (69%), Gaps = 13/124 (10%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  407  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  466

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQLLqtqdsqmqsrdddDAILMQQLSPNSNAD  232
            +S+ KLDLKEPYYRMSQPQ+Y+ +QDQ  Q L       +        ++QQ  PNS A 
Sbjct  467  TSSCKLDLKEPYYRMSQPQAYALAQDQQPQPLIQTQDLDEPE------IVQQPLPNSCAQ  520

Query  231  LQSL  220
            + SL
Sbjct  521  IDSL  524


 Score = 46.2 bits (108),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  382  GLACWFDVLFNGSTVQRWL  400



>gb|KGN47178.1| hypothetical protein Csa_6G194130 [Cucumis sativus]
Length=543

 Score =   130 bits (328),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 7/92 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH AQSYT+YLTLSA++       G +LQ
Sbjct  415  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMVAHSAQSYTLYLTLSAKMWGPGAEQGGILQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQLL  316
            SS+ KLDLKEPYYRMSQPQ Y  +QDQ +QL+
Sbjct  475  SSSCKLDLKEPYYRMSQPQVYPVAQDQQHQLI  506


 Score = 46.2 bits (108),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  390  GLACWFDVLFNGSTVQRWL  408



>ref|XP_006584026.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
isoform X1 [Glycine max]
 gb|KHN02965.1| Putative histone-arginine methyltransferase 1.4 [Glycine soja]
Length=536

 Score =   132 bits (331),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 98/125 (78%), Gaps = 8/125 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  408  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  467

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ-LLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +S+ KLDLKEPYYRMSQPQ+Y+ +QDQ +Q L+QTQD  +QS+D D+  ++QQ S NS A
Sbjct  468  TSSCKLDLKEPYYRMSQPQAYALAQDQQSQPLIQTQDIHIQSQDLDEPEIVQQPSLNSCA  527

Query  234  DLQSL  220
             + SL
Sbjct  528  QIDSL  532


 Score = 44.7 bits (104),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  383  GLACWFDVLFDGSTVQRWL  401



>ref|XP_006584027.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
isoform X2 [Glycine max]
Length=535

 Score =   132 bits (331),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 98/125 (78%), Gaps = 8/125 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  407  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  466

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ-LLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +S+ KLDLKEPYYRMSQPQ+Y+ +QDQ +Q L+QTQD  +QS+D D+  ++QQ S NS A
Sbjct  467  TSSCKLDLKEPYYRMSQPQAYALAQDQQSQPLIQTQDIHIQSQDLDEPEIVQQPSLNSCA  526

Query  234  DLQSL  220
             + SL
Sbjct  527  QIDSL  531


 Score = 44.7 bits (104),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  382  GLACWFDVLFDGSTVQRWL  400



>gb|KEH37264.1| histone-arginine methyltransferase, putative [Medicago truncatula]
Length=534

 Score =   129 bits (325),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 91/124 (73%), Gaps = 8/124 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL LVAH AQSYTIYLTLSA++       G +LQ
Sbjct  408  PVTHWYQLRCVLSQPIYVMAGQEITGRLHLVAHSAQSYTIYLTLSAKMWGPGAEQGGILQ  467

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQLLqtqdsqmqsrdddDAILMQQLSPNSNAD  232
            +S+ KLDLKEPYYRMSQ QSY  +QDQP Q      +Q++S+D DD  +MQ+ SPNS   
Sbjct  468  TSSCKLDLKEPYYRMSQQQSYPTTQDQP-QAQPFLPTQIKSQDFDDTEIMQEPSPNSCVQ  526

Query  231  LQSL  220
            + S 
Sbjct  527  IDSF  530


 Score = 46.2 bits (108),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  383  GLACWFDVLFNGSTVQRWL  401



>ref|XP_010259610.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X3 [Nelumbo nucifera]
Length=523

 Score =   129 bits (324),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 8/92 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRC+LSQP+YVM GQEITGR  +VAH AQSYTIYLT+SA++       G +LQ
Sbjct  417  PTTHWYQLRCILSQPIYVMAGQEITGRFHMVAHNAQSYTIYLTMSAKMYGAGADQGGILQ  476

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQL  319
            +S+ K DLKEPYYRMSQPQ+Y+ SQD QP+QL
Sbjct  477  TSSCKFDLKEPYYRMSQPQAYTWSQDQQPHQL  508


 Score = 46.6 bits (109),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  392  GLACWFDVLFNGSTVQRWL  410



>emb|CAN78049.1| hypothetical protein VITISV_015861 [Vitis vinifera]
Length=1600

 Score =   128 bits (322),  Expect(2) = 3e-35, Method: Composition-based stats.
 Identities = 60/92 (65%), Positives = 71/92 (77%), Gaps = 7/92 (8%)
 Frame = -2

Query  570   PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTL-------SAQVGDMLQ  412
             P  HWYQLRCVL QPLYVM GQEITG+L+LVAH AQSYTI+LT+        A+ G++LQ
Sbjct  1488  PTTHWYQLRCVLLQPLYVMAGQEITGQLRLVAHNAQSYTIHLTMGVKMWGPGAEQGEVLQ  1547

Query  411   SSTGKLDLKEPYYRMSQPQSYSASQDQPNQLL  316
             SS+ KLDLKEPYYRMSQPQ+Y+ + DQ    L
Sbjct  1548  SSSCKLDLKEPYYRMSQPQAYTVAPDQQQHPL  1579


 Score = 47.4 bits (111),  Expect(2) = 3e-35, Method: Composition-based stats.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646   GLACWFDVLFNGSTVQRWL  590
             GLACWFDVLFNGSTVQRWL
Sbjct  1463  GLACWFDVLFNGSTVQRWL  1481



>ref|XP_010259609.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X2 [Nelumbo nucifera]
Length=530

 Score =   129 bits (324),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 8/92 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRC+LSQP+YVM GQEITGR  +VAH AQSYTIYLT+SA++       G +LQ
Sbjct  417  PTTHWYQLRCILSQPIYVMAGQEITGRFHMVAHNAQSYTIYLTMSAKMYGAGADQGGILQ  476

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQL  319
            +S+ K DLKEPYYRMSQPQ+Y+ SQD QP+QL
Sbjct  477  TSSCKFDLKEPYYRMSQPQAYTWSQDQQPHQL  508


 Score = 46.6 bits (109),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  392  GLACWFDVLFNGSTVQRWL  410



>ref|XP_010269509.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X2 [Nelumbo nucifera]
 ref|XP_010269510.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X2 [Nelumbo nucifera]
Length=563

 Score =   129 bits (325),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH AQSYT+YLT+SA++       G +LQ
Sbjct  441  PTTHWYQLRCVLSQPMYVMAGQEITGRLHMVAHNAQSYTMYLTMSAKMWGAGAEQGGILQ  500

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ+Y+ SQD QP+QL+
Sbjct  501  TSSCKLDLKEPYYRMSQPQAYAWSQDQQPHQLV  533


 Score = 46.2 bits (108),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  416  GLACWFDVLFNGSTVQRWL  434



>ref|XP_003546357.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
[Glycine max]
 gb|KHN14622.1| Putative histone-arginine methyltransferase 1.4 [Glycine soja]
Length=544

 Score =   132 bits (333),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 94/125 (75%), Gaps = 8/125 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGR+ L+AH AQSYTI+LTLSA+        G +LQ
Sbjct  415  PTTHWYQLRCVLSQPIYVMAGQEITGRMHLIAHTAQSYTIFLTLSAKTWGPGAEQGGILQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +S+ KLDLKEPYYRMSQPQ+Y  +QD QP   LQTQD  +QS+D D+  +MQQ SP S A
Sbjct  475  TSSCKLDLKEPYYRMSQPQAYPLTQDQQPQPFLQTQDIDIQSQDLDEVEIMQQPSPKSCA  534

Query  234  DLQSL  220
             + SL
Sbjct  535  QIDSL  539


 Score = 43.1 bits (100),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGST +RWL
Sbjct  390  GLACWFDVLFNGSTARRWL  408



>ref|XP_010269515.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X7 [Nelumbo nucifera]
Length=539

 Score =   129 bits (324),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH AQSYT+YLT+SA++       G +LQ
Sbjct  417  PTTHWYQLRCVLSQPMYVMAGQEITGRLHMVAHNAQSYTMYLTMSAKMWGAGAEQGGILQ  476

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ+Y+ SQD QP+QL+
Sbjct  477  TSSCKLDLKEPYYRMSQPQAYAWSQDQQPHQLV  509


 Score = 46.2 bits (108),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  392  GLACWFDVLFNGSTVQRWL  410



>ref|XP_010269514.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X6 [Nelumbo nucifera]
Length=540

 Score =   129 bits (324),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH AQSYT+YLT+SA++       G +LQ
Sbjct  418  PTTHWYQLRCVLSQPMYVMAGQEITGRLHMVAHNAQSYTMYLTMSAKMWGAGAEQGGILQ  477

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ+Y+ SQD QP+QL+
Sbjct  478  TSSCKLDLKEPYYRMSQPQAYAWSQDQQPHQLV  510


 Score = 46.2 bits (108),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  393  GLACWFDVLFNGSTVQRWL  411



>ref|XP_010269511.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X3 [Nelumbo nucifera]
Length=560

 Score =   129 bits (324),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH AQSYT+YLT+SA++       G +LQ
Sbjct  445  PTTHWYQLRCVLSQPMYVMAGQEITGRLHMVAHNAQSYTMYLTMSAKMWGAGAEQGGILQ  504

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ+Y+ SQD QP+QL+
Sbjct  505  TSSCKLDLKEPYYRMSQPQAYAWSQDQQPHQLV  537


 Score = 46.2 bits (108),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  420  GLACWFDVLFNGSTVQRWL  438



>ref|XP_010259608.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X1 [Nelumbo nucifera]
Length=555

 Score =   129 bits (323),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 8/92 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRC+LSQP+YVM GQEITGR  +VAH AQSYTIYLT+SA++       G +LQ
Sbjct  417  PTTHWYQLRCILSQPIYVMAGQEITGRFHMVAHNAQSYTIYLTMSAKMYGAGADQGGILQ  476

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQL  319
            +S+ K DLKEPYYRMSQPQ+Y+ SQD QP+QL
Sbjct  477  TSSCKFDLKEPYYRMSQPQAYTWSQDQQPHQL  508


 Score = 46.2 bits (108),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  392  GLACWFDVLFNGSTVQRWL  410



>ref|XP_010269508.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X1 [Nelumbo nucifera]
Length=567

 Score =   129 bits (323),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH AQSYT+YLT+SA++       G +LQ
Sbjct  445  PTTHWYQLRCVLSQPMYVMAGQEITGRLHMVAHNAQSYTMYLTMSAKMWGAGAEQGGILQ  504

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ+Y+ SQD QP+QL+
Sbjct  505  TSSCKLDLKEPYYRMSQPQAYAWSQDQQPHQLV  537


 Score = 46.2 bits (108),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  420  GLACWFDVLFNGSTVQRWL  438



>ref|XP_010269512.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X4 [Nelumbo nucifera]
Length=544

 Score =   129 bits (323),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH AQSYT+YLT+SA++       G +LQ
Sbjct  422  PTTHWYQLRCVLSQPMYVMAGQEITGRLHMVAHNAQSYTMYLTMSAKMWGAGAEQGGILQ  481

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ+Y+ SQD QP+QL+
Sbjct  482  TSSCKLDLKEPYYRMSQPQAYAWSQDQQPHQLV  514


 Score = 46.2 bits (108),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  397  GLACWFDVLFNGSTVQRWL  415



>ref|XP_010269513.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X5 [Nelumbo nucifera]
Length=543

 Score =   129 bits (323),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH AQSYT+YLT+SA++       G +LQ
Sbjct  421  PTTHWYQLRCVLSQPMYVMAGQEITGRLHMVAHNAQSYTMYLTMSAKMWGAGAEQGGILQ  480

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ+Y+ SQD QP+QL+
Sbjct  481  TSSCKLDLKEPYYRMSQPQAYAWSQDQQPHQLV  513


 Score = 46.2 bits (108),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  396  GLACWFDVLFNGSTVQRWL  414



>gb|EPS70406.1| hypothetical protein M569_04353, partial [Genlisea aurea]
Length=514

 Score =   128 bits (321),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 75/93 (81%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVL QP+YVMPGQEI GRL +VAHKAQSYT++LTLSA+        G +LQ
Sbjct  401  PTTHWYQLRCVLPQPIYVMPGQEIIGRLYMVAHKAQSYTLHLTLSAKTWGPGADQGGILQ  460

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQ-PNQLL  316
            +S+ KLDLKEPYYRMSQPQ Y A+Q+Q PNQLL
Sbjct  461  TSSVKLDLKEPYYRMSQPQVYPATQEQPPNQLL  493


 Score = 46.2 bits (108),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  376  GLACWFDVLFNGSTVQRWL  394



>ref|XP_011005087.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Populus 
euphratica]
Length=544

 Score =   127 bits (319),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 76/91 (84%), Gaps = 8/91 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITG+L++VAH AQSYT+YLTLSA++       G +LQ
Sbjct  421  PTTHWYQLRCVLSQPLYVMAGQEITGQLRMVAHNAQSYTLYLTLSAKMWGPGAEQGGILQ  480

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQ  322
            +S+ KLDLKEPYYRMSQPQ+Y+ +QD QP+Q
Sbjct  481  TSSCKLDLKEPYYRMSQPQAYAMAQDQQPHQ  511


 Score = 46.6 bits (109),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  396  GLACWFDVLFNGSTVQRWL  414



>gb|ABK94929.1| unknown [Populus trichocarpa]
Length=544

 Score =   127 bits (319),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 76/91 (84%), Gaps = 8/91 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITG+L++VAH AQSYT+YLTLSA++       G +LQ
Sbjct  421  PTTHWYQLRCVLSQPLYVMAGQEITGQLRMVAHNAQSYTLYLTLSAKMWGPGAEQGGILQ  480

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQ  322
            +S+ KLDLKEPYYRMSQPQ+Y+ +QD QP+Q
Sbjct  481  TSSCKLDLKEPYYRMSQPQAYAMAQDQQPHQ  511


 Score = 46.6 bits (109),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  396  GLACWFDVLFNGSTVQRWL  414



>gb|AFK39038.1| unknown [Lotus japonicus]
Length=280

 Score =   127 bits (320),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 94/124 (76%), Gaps = 8/124 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLS-------AQVGDMLQ  412
            P  HWYQLRCVL QP+YV+ GQE+TGRL L+AH AQSYTIYLTLS       A+ G +LQ
Sbjct  154  PTTHWYQLRCVLPQPIYVVAGQEMTGRLHLIAHNAQSYTIYLTLSTKMWGPGAEQGGILQ  213

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQLLqtqdsqmqsrdddDAILMQQLSPNSNAD  232
            +S+ KLDLKEPYYRMSQPQ+Y  +QDQ   L+QT+D  +QS++ D+  +MQQ SPNS A 
Sbjct  214  TSSCKLDLKEPYYRMSQPQAYPVAQDQ-QPLIQTRDIHIQSQELDETEIMQQPSPNSCAQ  272

Query  231  LQSL  220
            + SL
Sbjct  273  VDSL  276


 Score = 46.2 bits (108),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  129  GLACWFDVLFNGSTVQRWL  147



>ref|XP_006378073.1| hypothetical protein POPTR_0010s01850g [Populus trichocarpa]
 gb|ERP55870.1| hypothetical protein POPTR_0010s01850g [Populus trichocarpa]
Length=544

 Score =   127 bits (319),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 76/91 (84%), Gaps = 8/91 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITG+L++VAH AQSYT+YLTLSA++       G +LQ
Sbjct  421  PTTHWYQLRCVLSQPLYVMAGQEITGQLRMVAHNAQSYTLYLTLSAKMWGPGAEQGGILQ  480

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQ  322
            +S+ KLDLKEPYYRMSQPQ+Y+ +QD QP+Q
Sbjct  481  TSSCKLDLKEPYYRMSQPQAYAMAQDQQPHQ  511


 Score = 46.6 bits (109),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  396  GLACWFDVLFNGSTVQRWL  414



>ref|XP_004508216.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
isoform X2 [Cicer arietinum]
Length=501

 Score =   127 bits (319),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 7/87 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ
Sbjct  406  PTTHWYQLRCVLSQPIYVMAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  465

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQ  331
            +S+ KLDLKEPYYRMSQPQ+Y  +QDQ
Sbjct  466  TSSCKLDLKEPYYRMSQPQAYPLAQDQ  492


 Score = 46.2 bits (108),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  381  GLACWFDVLFNGSTVQRWL  399



>gb|KJB34628.1| hypothetical protein B456_006G076000 [Gossypium raimondii]
Length=512

 Score =   127 bits (319),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL ++AH AQSYTIYL LSA++       G ++Q
Sbjct  414  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTIYLALSAKMWGPGAEQGGIIQ  473

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ Y+ +QD QP+QLL
Sbjct  474  TSSCKLDLKEPYYRMSQPQPYTTAQDQQPHQLL  506


 Score = 46.2 bits (108),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  389  GLACWFDVLFNGSTVQRWL  407



>gb|KJB34627.1| hypothetical protein B456_006G076000 [Gossypium raimondii]
Length=533

 Score =   127 bits (318),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL ++AH AQSYTIYL LSA++       G ++Q
Sbjct  414  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTIYLALSAKMWGPGAEQGGIIQ  473

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ Y+ +QD QP+QLL
Sbjct  474  TSSCKLDLKEPYYRMSQPQPYTTAQDQQPHQLL  506


 Score = 46.2 bits (108),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  389  GLACWFDVLFNGSTVQRWL  407



>gb|KHG21096.1| putative histone-arginine methyltransferase 1.3 -like protein 
[Gossypium arboreum]
Length=536

 Score =   126 bits (316),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITG+L ++AH AQSYTIYLTLSA++       G ++Q
Sbjct  413  PTTHWYQIRCVLSQPIYVMAGQEITGQLHMIAHNAQSYTIYLTLSAKMWGPGAEQGGIIQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ Y+ +QD QP+QLL
Sbjct  473  TSSCKLDLKEPYYRMSQPQPYTMAQDQQPHQLL  505


 Score = 46.2 bits (108),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  388  GLACWFDVLFNGSTVQRWL  406



>gb|KJB38603.1| hypothetical protein B456_006G262700 [Gossypium raimondii]
Length=536

 Score =   126 bits (316),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 7/86 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL +VAH AQSYTIY+TLSA++       G ++Q
Sbjct  414  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMVAHNAQSYTIYVTLSAKMWGPGAEQGGIIQ  473

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD  334
            SS+ KLDLKEPYYRMSQPQ Y+ +QD
Sbjct  474  SSSCKLDLKEPYYRMSQPQPYTTAQD  499


 Score = 46.6 bits (109),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  389  GLACWFDVLFNGSTVQRWL  407



>emb|CDO98873.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   125 bits (315),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 66/79 (84%), Gaps = 7/79 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVMPGQEITGRL L AH AQSYTI+LTLSA++       G +LQ
Sbjct  338  PTTHWYQLRCVLSQPIYVMPGQEITGRLHLAAHTAQSYTIHLTLSAKMWGPGAEQGGILQ  397

Query  411  SSTGKLDLKEPYYRMSQPQ  355
            +STGKLDLKEPYYRMSQPQ
Sbjct  398  TSTGKLDLKEPYYRMSQPQ  416


 Score = 46.6 bits (109),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  313  GLACWFDVLFNGSTVQRWL  331



>ref|NP_001130830.1| hypothetical protein [Zea mays]
 gb|ACF79197.1| unknown [Zea mays]
 tpg|DAA64080.1| TPA: hypothetical protein ZEAMMB73_541170 [Zea mays]
 tpg|DAA64081.1| TPA: hypothetical protein ZEAMMB73_541170 [Zea mays]
 tpg|DAA64082.1| TPA: hypothetical protein ZEAMMB73_541170 [Zea mays]
 tpg|DAA64083.1| TPA: hypothetical protein ZEAMMB73_541170 [Zea mays]
 tpg|DAA64084.1| TPA: hypothetical protein ZEAMMB73_541170 [Zea mays]
Length=538

 Score =   125 bits (315),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 68/81 (84%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITGRL LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  414  PTTHWYQLRCVLSQPLYVMAGQEITGRLHLVAHSAQSYTIYLTMSAKMWGVGAEQGGILQ  473

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +STGKL+LKEPYYR+SQPQSY
Sbjct  474  TSTGKLELKEPYYRLSQPQSY  494


 Score = 46.2 bits (108),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  389  GLACWFDVLFNGSTVQRWL  407



>ref|XP_008650820.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=537

 Score =   125 bits (315),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 68/81 (84%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITGRL LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  413  PTTHWYQLRCVLSQPLYVMAGQEITGRLHLVAHSAQSYTIYLTMSAKMWGVGAEQGGILQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +STGKL+LKEPYYR+SQPQSY
Sbjct  473  TSTGKLELKEPYYRLSQPQSY  493


 Score = 46.2 bits (108),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  388  GLACWFDVLFNGSTVQRWL  406



>ref|XP_002461187.1| hypothetical protein SORBIDRAFT_02g042540 [Sorghum bicolor]
 gb|EER97708.1| hypothetical protein SORBIDRAFT_02g042540 [Sorghum bicolor]
Length=555

 Score =   125 bits (313),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 68/81 (84%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITGRL LVAH +QSYTIYLT+SA++       G +LQ
Sbjct  432  PTTHWYQLRCVLSQPLYVMAGQEITGRLHLVAHSSQSYTIYLTMSAKMWGVGAEQGGILQ  491

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +STGKL+LKEPYYR+SQPQSY
Sbjct  492  TSTGKLELKEPYYRLSQPQSY  512


 Score = 46.6 bits (109),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  407  GLACWFDVLFNGSTVQRWL  425



>ref|XP_006419580.1| hypothetical protein CICLE_v10004703mg [Citrus clementina]
 ref|XP_006489091.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
[Citrus sinensis]
 gb|ESR32820.1| hypothetical protein CICLE_v10004703mg [Citrus clementina]
Length=534

 Score =   126 bits (317),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITG+L+++AH AQSYTIYLTLS ++       G +LQ
Sbjct  412  PTTHWYQLRCVLSQPLYVMAGQEITGQLRMIAHSAQSYTIYLTLSVKMWGPGADQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ Y  +QD QP+QL+
Sbjct  472  TSSCKLDLKEPYYRMSQPQPYVLTQDQQPHQLM  504


 Score = 44.7 bits (104),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>ref|XP_006419579.1| hypothetical protein CICLE_v10004703mg [Citrus clementina]
 gb|ESR32819.1| hypothetical protein CICLE_v10004703mg [Citrus clementina]
Length=513

 Score =   126 bits (317),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITG+L+++AH AQSYTIYLTLS ++       G +LQ
Sbjct  391  PTTHWYQLRCVLSQPLYVMAGQEITGQLRMIAHSAQSYTIYLTLSVKMWGPGADQGGILQ  450

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ Y  +QD QP+QL+
Sbjct  451  TSSCKLDLKEPYYRMSQPQPYVLTQDQQPHQLM  483


 Score = 44.7 bits (104),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  366  GLACWFDVLFDGSTVQRWL  384



>gb|KDO71644.1| hypothetical protein CISIN_1g015038mg [Citrus sinensis]
Length=414

 Score =   126 bits (316),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITG+L+++AH AQSYTIYLTLS ++       G +LQ
Sbjct  292  PTTHWYQLRCVLSQPLYVMAGQEITGQLRMIAHSAQSYTIYLTLSVKMWGPGADQGGILQ  351

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ KLDLKEPYYRMSQPQ Y  +QD QP+QL+
Sbjct  352  TSSCKLDLKEPYYRMSQPQPYVLTQDQQPHQLM  384


 Score = 44.7 bits (104),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  267  GLACWFDVLFDGSTVQRWL  285



>ref|XP_004296838.1| PREDICTED: probable histone-arginine methyltransferase 1.4 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=537

 Score =   127 bits (318),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL ++AH AQSYTIYLTLSA++       G ++Q
Sbjct  414  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTIYLTLSAKMWGPGAEQGGIIQ  473

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            SS+ KLDLKEPYYRMSQPQ Y  +QD QP+Q L
Sbjct  474  SSSCKLDLKEPYYRMSQPQPYVMAQDQQPHQQL  506


 Score = 43.9 bits (102),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF GSTVQRWL
Sbjct  389  GLACWFDVLFGGSTVQRWL  407



>ref|XP_007138912.1| hypothetical protein PHAVU_009G248200g [Phaseolus vulgaris]
 gb|ESW10906.1| hypothetical protein PHAVU_009G248200g [Phaseolus vulgaris]
Length=539

 Score =   127 bits (320),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 85/124 (69%), Gaps = 10/124 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YV+ GQEITGR+ L+AH AQSYTIYLTLSA+        G +LQ
Sbjct  415  PTTHWYQLRCVLSQPIYVVAGQEITGRMHLIAHTAQSYTIYLTLSAKTWGPGAEQGGILQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQLLqtqdsqmqsrdddDAILMQQLSPNSNAD  232
            +S+ KLDLKEPYYRMSQPQ+Y  +QDQ  + L          D +   +MQQ SP S A 
Sbjct  475  TSSCKLDLKEPYYRMSQPQAYPLNQDQQPKPLDMNIQSQDLDDVE---MMQQPSPKSCAQ  531

Query  231  LQSL  220
            + SL
Sbjct  532  IDSL  535


 Score = 43.1 bits (100),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGST +RWL
Sbjct  390  GLACWFDVLFNGSTARRWL  408



>ref|XP_011462720.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=511

 Score =   127 bits (318),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL ++AH AQSYTIYLTLSA++       G ++Q
Sbjct  414  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTIYLTLSAKMWGPGAEQGGIIQ  473

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            SS+ KLDLKEPYYRMSQPQ Y  +QD QP+Q L
Sbjct  474  SSSCKLDLKEPYYRMSQPQPYVMAQDQQPHQQL  506


 Score = 43.9 bits (102),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF GSTVQRWL
Sbjct  389  GLACWFDVLFGGSTVQRWL  407



>gb|AGT17201.1| hypothetical protein SHCRBa_098_E22_R_290 [Saccharum hybrid cultivar 
R570]
Length=389

 Score =   124 bits (310),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 68/81 (84%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITGRL LVAH +QSYTIYLT+SA++       G +LQ
Sbjct  266  PTTHWYQLRCVLSQPLYVMAGQEITGRLHLVAHSSQSYTIYLTMSAKMWGVGAEQGGILQ  325

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +STGKL+LKEPYYR+SQPQSY
Sbjct  326  TSTGKLELKEPYYRLSQPQSY  346


 Score = 46.2 bits (108),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  241  GLACWFDVLFNGSTVQRWL  259



>ref|XP_010037469.1| PREDICTED: probable histone-arginine methyltransferase 1.3 [Eucalyptus 
grandis]
 gb|KCW84487.1| hypothetical protein EUGRSUZ_B01318 [Eucalyptus grandis]
Length=543

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 103/146 (71%), Gaps = 13/146 (9%)
 Frame = -2

Query  627  MCCLTGALFRGG*-PLLLV----HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQ  463
            + C    LF G   P  L      P  HWYQLRCVLSQPLYVM GQEITGRL LVAHK+Q
Sbjct  397  LACWFDVLFNGSTVPRWLTTAPGSPTTHWYQLRCVLSQPLYVMAGQEITGRLHLVAHKSQ  456

Query  462  SYTIYLTLS-------AQVGDMLQSSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLLqtq  307
            SYTI LTLS       A+ G +LQ+S+ KLDLKEPYYRMSQPQSY+ +QD QP+QLLQ+Q
Sbjct  457  SYTINLTLSTMMWGPGAEQGRILQTSSTKLDLKEPYYRMSQPQSYTVAQDQQPHQLLQSQ  516

Query  306  dsqmqsrdddDAILMQQLSPNSNADL  229
            +  +Q++D ++A +++Q + NS A  
Sbjct  517  ELNVQTQDIEEADILEQPAQNSGAHF  542



>ref|XP_011011651.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Populus 
euphratica]
Length=542

 Score =   123 bits (309),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 7/87 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYV+ GQEI G+L++VAH AQSYT+YLTLSA++       G +LQ
Sbjct  420  PTTHWYQLRCVLSQPLYVVAGQEIAGQLRMVAHNAQSYTVYLTLSAKMWGPGAEQGGILQ  479

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQ  331
            +S+ KL+LKEPYYRMSQPQ+Y+ +QDQ
Sbjct  480  TSSCKLELKEPYYRMSQPQTYAMAQDQ  506


 Score = 46.6 bits (109),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  395  GLACWFDVLFNGSTVQRWL  413



>gb|KDP27795.1| hypothetical protein JCGZ_18875 [Jatropha curcas]
Length=542

 Score =   123 bits (309),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 72/93 (77%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVL QPLYVM GQEITGRL +VAH AQSYTI LTLSA++       G +LQ
Sbjct  416  PTTHWYQLRCVLPQPLYVMAGQEITGRLHMVAHNAQSYTINLTLSAKMWGPGAEQGGILQ  475

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQLL  316
            +S+ K DLKEPYYRMSQPQ Y  +QD QP+Q++
Sbjct  476  TSSCKFDLKEPYYRMSQPQVYGMAQDQQPHQMI  508


 Score = 46.6 bits (109),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  391  GLACWFDVLFNGSTVQRWL  409



>gb|KHG28804.1| putative histone-arginine methyltransferase 1.4 [Gossypium arboreum]
Length=546

 Score =   125 bits (313),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 7/82 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL ++AH AQSYT+YL+LSA++       G +LQ
Sbjct  424  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTMYLSLSAKMWGPGAVQGGILQ  483

Query  411  SSTGKLDLKEPYYRMSQPQSYS  346
            +S+GKLDLKEPYYRMSQPQSY+
Sbjct  484  TSSGKLDLKEPYYRMSQPQSYT  505


 Score = 44.7 bits (104),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS VQRWL
Sbjct  399  GLACWFDVLFNGSAVQRWL  417



>gb|KJB72683.1| hypothetical protein B456_011G190400 [Gossypium raimondii]
Length=539

 Score =   125 bits (313),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 7/82 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL ++AH AQSYT+YL+LSA++       G +LQ
Sbjct  417  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTMYLSLSAKMWGPGAVQGGILQ  476

Query  411  SSTGKLDLKEPYYRMSQPQSYS  346
            +S+GKLDLKEPYYRMSQPQSY+
Sbjct  477  TSSGKLDLKEPYYRMSQPQSYT  498


 Score = 44.7 bits (104),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS VQRWL
Sbjct  392  GLACWFDVLFNGSAVQRWL  410



>gb|KJB72681.1| hypothetical protein B456_011G190400 [Gossypium raimondii]
Length=538

 Score =   125 bits (313),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 7/82 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL ++AH AQSYT+YL+LSA++       G +LQ
Sbjct  416  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTMYLSLSAKMWGPGAVQGGILQ  475

Query  411  SSTGKLDLKEPYYRMSQPQSYS  346
            +S+GKLDLKEPYYRMSQPQSY+
Sbjct  476  TSSGKLDLKEPYYRMSQPQSYT  497


 Score = 44.7 bits (104),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS VQRWL
Sbjct  391  GLACWFDVLFNGSAVQRWL  409



>emb|CDY24659.1| BnaA05g30580D [Brassica napus]
Length=532

 Score =   124 bits (312),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (81%), Gaps = 7/84 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVL+QP+YVM GQEITGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  408  PTTHWYQIRCVLAQPIYVMAGQEITGRLHLVAHSAQSYTIDLTLSAKMWGPGASQGGILQ  467

Query  411  SSTGKLDLKEPYYRMSQPQSYSAS  340
            SSTGK DLKEPYYRMSQPQ+Y A+
Sbjct  468  SSTGKFDLKEPYYRMSQPQAYPAA  491


 Score = 44.7 bits (104),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  383  GLACWFDVLFDGSTVQRWL  401



>ref|XP_009147121.1| PREDICTED: probable histone-arginine methyltransferase 1.3 [Brassica 
rapa]
Length=531

 Score =   124 bits (312),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (81%), Gaps = 7/84 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVL+QP+YVM GQEITGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  408  PTTHWYQIRCVLAQPIYVMAGQEITGRLHLVAHSAQSYTIDLTLSAKMWGPGASQGGILQ  467

Query  411  SSTGKLDLKEPYYRMSQPQSYSAS  340
            SSTGK DLKEPYYRMSQPQ+Y A+
Sbjct  468  SSTGKFDLKEPYYRMSQPQAYPAA  491


 Score = 44.7 bits (104),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  383  GLACWFDVLFDGSTVQRWL  401



>gb|KJB72682.1| hypothetical protein B456_011G190400 [Gossypium raimondii]
Length=523

 Score =   124 bits (312),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 7/82 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL ++AH AQSYT+YL+LSA++       G +LQ
Sbjct  401  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTMYLSLSAKMWGPGAVQGGILQ  460

Query  411  SSTGKLDLKEPYYRMSQPQSYS  346
            +S+GKLDLKEPYYRMSQPQSY+
Sbjct  461  TSSGKLDLKEPYYRMSQPQSYT  482


 Score = 44.7 bits (104),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS VQRWL
Sbjct  376  GLACWFDVLFNGSAVQRWL  394



>ref|NP_850528.1| arginine methyltransferase 4B [Arabidopsis thaliana]
 sp|Q84W92.3|ANM13_ARATH RecName: Full=Probable histone-arginine methyltransferase 1.3; 
Short=AtPRMT13; AltName: Full=Coactivator-associated methyltransferase 
1A; AltName: Full=Protein arginine N-methyltransferase 
4B; Short=AtPRMT4B [Arabidopsis thaliana]
 gb|AEE74478.1| arginine methyltransferase 4B [Arabidopsis thaliana]
Length=535

 Score =   124 bits (311),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  501


 Score = 44.7 bits (104),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>ref|NP_001150868.1| histone-arginine methyltransferase CARM1 [Zea mays]
 gb|ACG40704.1| histone-arginine methyltransferase CARM1 [Zea mays]
 tpg|DAA41718.1| TPA: histone-arginine methyltransferase CARM1 [Zea mays]
Length=533

 Score =   122 bits (307),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 7/80 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITG L+LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  414  PTTHWYQLRCVLSQPLYVMAGQEITGHLRLVAHSAQSYTIYLTMSAKMWGVGAEQGGILQ  473

Query  411  SSTGKLDLKEPYYRMSQPQS  352
            +STGKL+LKEPYYR+SQPQS
Sbjct  474  TSTGKLELKEPYYRLSQPQS  493


 Score = 46.2 bits (108),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  389  GLACWFDVLFNGSTVQRWL  407



>gb|AAO42127.1| putative arginine methyltransferase [Arabidopsis thaliana]
Length=535

 Score =   124 bits (311),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  501


 Score = 44.7 bits (104),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>ref|XP_004958628.1| PREDICTED: probable histone-arginine methyltransferase CARM1-like 
isoform X1 [Setaria italica]
Length=538

 Score =   122 bits (306),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 5/79 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-----GDMLQSS  406
            P  HWYQLRCVLSQPLYVM GQEITGRL LVAH +QSYTIYLT+SA++       +LQ+S
Sbjct  415  PTTHWYQLRCVLSQPLYVMAGQEITGRLHLVAHSSQSYTIYLTMSAKMWGVEQDGILQTS  474

Query  405  TGKLDLKEPYYRMSQPQSY  349
            TGKL+LKEPYYR+SQPQSY
Sbjct  475  TGKLELKEPYYRLSQPQSY  493


 Score = 46.6 bits (109),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  390  GLACWFDVLFNGSTVQRWL  408



>ref|XP_004958629.1| PREDICTED: probable histone-arginine methyltransferase CARM1-like 
isoform X2 [Setaria italica]
Length=537

 Score =   122 bits (306),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 67/79 (85%), Gaps = 5/79 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-----GDMLQSS  406
            P  HWYQLRCVLSQPLYVM GQEITGRL LVAH +QSYTIYLT+SA++       +LQ+S
Sbjct  414  PTTHWYQLRCVLSQPLYVMAGQEITGRLHLVAHSSQSYTIYLTMSAKMWGVEQDGILQTS  473

Query  405  TGKLDLKEPYYRMSQPQSY  349
            TGKL+LKEPYYR+SQPQSY
Sbjct  474  TGKLELKEPYYRLSQPQSY  492


 Score = 46.6 bits (109),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  389  GLACWFDVLFNGSTVQRWL  407



>ref|XP_008668082.1| PREDICTED: histone-arginine methyltransferase CARM1 isoform X1 
[Zea mays]
 tpg|DAA41720.1| TPA: hypothetical protein ZEAMMB73_688738 [Zea mays]
Length=532

 Score =   122 bits (306),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 7/80 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITG L+LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  413  PTTHWYQLRCVLSQPLYVMAGQEITGHLRLVAHSAQSYTIYLTMSAKMWGVGAEQGGILQ  472

Query  411  SSTGKLDLKEPYYRMSQPQS  352
            +STGKL+LKEPYYR+SQPQS
Sbjct  473  TSTGKLELKEPYYRLSQPQS  492


 Score = 46.2 bits (108),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  388  GLACWFDVLFNGSTVQRWL  406



>emb|CDY05299.1| BnaC05g45040D [Brassica napus]
Length=530

 Score =   124 bits (310),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 7/84 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVL+QP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  407  PTTHWYQIRCVLAQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  466

Query  411  SSTGKLDLKEPYYRMSQPQSYSAS  340
            SSTGK DLKEPYYRMSQPQ+Y A+
Sbjct  467  SSTGKFDLKEPYYRMSQPQAYPAA  490


 Score = 44.7 bits (104),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  382  GLACWFDVLFDGSTVQRWL  400



>ref|XP_010446281.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X2 [Camelina sativa]
Length=534

 Score =   123 bits (309),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  501


 Score = 44.7 bits (104),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>ref|XP_008340814.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Malus 
domestica]
Length=552

 Score =   123 bits (309),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 8/91 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVL+QP+YVM GQEITGRL +VAH AQSYT+YLTL+A++       G ++Q
Sbjct  415  PTTHWYQLRCVLAQPIYVMAGQEITGRLHMVAHNAQSYTMYLTLAAKMWGPGAEQGGIIQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD-QPNQ  322
             S+ KLDLKEPYYRMSQPQ+Y+ +QD QP+Q
Sbjct  475  QSSCKLDLKEPYYRMSQPQAYTIAQDPQPHQ  505


 Score = 44.7 bits (104),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  390  GLACWFDVLFDGSTVQRWL  408



>emb|CAN77729.1| hypothetical protein VITISV_027411 [Vitis vinifera]
Length=538

 Score =   122 bits (305),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 7/87 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTL-------SAQVGDMLQ  412
            P  HWYQLRCVL QPLYVM GQEITG+L+LVAH AQSYTI+LT+        A+ G++LQ
Sbjct  426  PTTHWYQLRCVLLQPLYVMAGQEITGQLRLVAHNAQSYTIHLTMGVKMWGPGAEQGEVLQ  485

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQ  331
            SS+ KLDLKEPYYRMSQPQ+Y+ + DQ
Sbjct  486  SSSCKLDLKEPYYRMSQPQAYTVAPDQ  512


 Score = 46.6 bits (109),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  401  GLACWFDVLFNGSTVQRWL  419



>ref|XP_002884615.1| arginine N-methyltransferase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60874.1| arginine N-methyltransferase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=531

 Score =   124 bits (310),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  409  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  468

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  469  SSTCKFDLKEPYYRMSQPQAYPVTQEPPLQ  498


 Score = 44.7 bits (104),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  384  GLACWFDVLFDGSTVQRWL  402



>ref|XP_010446228.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X1 [Camelina sativa]
Length=535

 Score =   123 bits (309),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  501


 Score = 44.7 bits (104),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>gb|KHG28805.1| putative histone-arginine methyltransferase 1.3 [Gossypium arboreum]
Length=540

 Score =   124 bits (311),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 7/82 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL ++AH AQSYT+YL+LSA++       G +LQ
Sbjct  418  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTMYLSLSAKMWGPGAVQGGILQ  477

Query  411  SSTGKLDLKEPYYRMSQPQSYS  346
            +S+GKLDLKEPYYRMSQPQSY+
Sbjct  478  TSSGKLDLKEPYYRMSQPQSYT  499


 Score = 44.3 bits (103),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS VQRWL
Sbjct  393  GLACWFDVLFNGSAVQRWL  411



>ref|XP_010464286.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X2 [Camelina sativa]
Length=526

 Score =   123 bits (309),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  404  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  463

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  464  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  493


 Score = 44.7 bits (104),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  379  GLACWFDVLFDGSTVQRWL  397



>ref|XP_010486223.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X2 [Camelina sativa]
Length=534

 Score =   123 bits (309),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  501


 Score = 44.7 bits (104),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>ref|XP_010464285.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X1 [Camelina sativa]
Length=534

 Score =   123 bits (309),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  501


 Score = 44.7 bits (104),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>dbj|BAF00156.1| arginine methyltransferase like protein [Arabidopsis thaliana]
Length=529

 Score =   123 bits (309),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  501


 Score = 44.7 bits (104),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>ref|XP_010486222.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X1 [Camelina sativa]
Length=535

 Score =   123 bits (309),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  501


 Score = 44.7 bits (104),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>ref|NP_187349.2| arginine methyltransferase 4B [Arabidopsis thaliana]
 gb|AAU05537.1| At3g06930 [Arabidopsis thaliana]
 gb|AEE74477.1| arginine methyltransferase 4B [Arabidopsis thaliana]
Length=534

 Score =   123 bits (309),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  501


 Score = 44.7 bits (104),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>ref|XP_002273923.1| PREDICTED: probable histone-arginine methyltransferase 1.3 [Vitis 
vinifera]
 emb|CBI26080.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   121 bits (304),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 7/87 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTL-------SAQVGDMLQ  412
            P  HWYQLRCVL QPLYVM GQEITG+L+LVAH AQSYTI+LT+        A+ G++LQ
Sbjct  413  PTTHWYQLRCVLLQPLYVMAGQEITGQLRLVAHNAQSYTIHLTMGVKMWGPGAEQGEVLQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQ  331
            SS+ KLDLKEPYYRMSQPQ+Y+ + DQ
Sbjct  473  SSSCKLDLKEPYYRMSQPQAYTVAPDQ  499


 Score = 46.6 bits (109),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  388  GLACWFDVLFNGSTVQRWL  406



>tpg|DAA41721.1| TPA: hypothetical protein ZEAMMB73_688738 [Zea mays]
Length=385

 Score =   121 bits (304),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 7/80 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITG L+LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  266  PTTHWYQLRCVLSQPLYVMAGQEITGHLRLVAHSAQSYTIYLTMSAKMWGVGAEQGGILQ  325

Query  411  SSTGKLDLKEPYYRMSQPQS  352
            +STGKL+LKEPYYR+SQPQS
Sbjct  326  TSTGKLELKEPYYRLSQPQS  345


 Score = 46.2 bits (108),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  241  GLACWFDVLFNGSTVQRWL  259



>ref|XP_008367146.1| PREDICTED: probable histone-arginine methyltransferase 1.3, partial 
[Malus domestica]
Length=506

 Score =   123 bits (308),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 7/87 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLS-------AQVGDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH +QSYTIYLTL+       A++G ++Q
Sbjct  415  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMVAHNSQSYTIYLTLAAKMWGPGAELGGIIQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQ  331
             S+ KLDLKEPYYRMSQ Q+Y+ +QDQ
Sbjct  475  QSSCKLDLKEPYYRMSQXQAYTIAQDQ  501


 Score = 44.7 bits (104),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  390  GLACWFDVLFDGSTVQRWL  408



>ref|XP_006299916.1| hypothetical protein CARUB_v10016125mg [Capsella rubella]
 gb|EOA32814.1| hypothetical protein CARUB_v10016125mg [Capsella rubella]
Length=534

 Score =   122 bits (307),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 70/91 (77%), Gaps = 7/91 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQPLYVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPLYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQL  319
            SST K DLKEPYYRMSQPQ+Y  +Q+   QL
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPSLQL  502


 Score = 44.7 bits (104),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>gb|AAF26997.1|AC016827_8 putative arginine methyltransferase [Arabidopsis thaliana]
Length=388

 Score =   122 bits (306),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  266  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  325

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SST K DLKEPYYRMSQPQ+Y  +Q+ P Q
Sbjct  326  SSTCKFDLKEPYYRMSQPQAYPVAQEPPLQ  355


 Score = 44.7 bits (104),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  241  GLACWFDVLFDGSTVQRWL  259



>ref|NP_001060600.1| Os07g0671700 [Oryza sativa Japonica Group]
 sp|Q7XI75.1|CARM1_ORYSJ RecName: Full=Probable histone-arginine methyltransferase CARM1; 
AltName: Full=Protein arginine N-methyltransferase 4 [Oryza 
sativa Japonica Group]
 sp|A2YPT7.2|CARM1_ORYSI RecName: Full=Probable histone-arginine methyltransferase CARM1; 
AltName: Full=Protein arginine N-methyltransferase 4 [Oryza 
sativa Indica Group]
 dbj|BAC79844.1| putative protein arginine N-methyltransferase 4 [Oryza sativa 
Japonica Group]
 dbj|BAF22514.1| Os07g0671700 [Oryza sativa Japonica Group]
 dbj|BAG89761.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82664.1| hypothetical protein OsI_27289 [Oryza sativa Indica Group]
 gb|EEE67794.1| hypothetical protein OsJ_25531 [Oryza sativa Japonica Group]
Length=528

 Score =   120 bits (302),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 66/81 (81%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRC+LSQPLYVM GQEITGRL LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  420  PTTHWYQLRCILSQPLYVMAGQEITGRLHLVAHSAQSYTIYLTMSAKMWGEGAEQGGILQ  479

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +ST KL+LKEPYYR+SQPQ Y
Sbjct  480  TSTAKLELKEPYYRLSQPQPY  500


 Score = 46.2 bits (108),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  395  GLACWFDVLFNGSTVQRWL  413



>ref|XP_006840515.1| hypothetical protein AMTR_s00045p00203910 [Amborella trichopoda]
 gb|ERN02190.1| hypothetical protein AMTR_s00045p00203910 [Amborella trichopoda]
Length=542

 Score =   123 bits (309),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 8/120 (7%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITGRL +VAH AQSYT++LT+SA+        G +LQ
Sbjct  419  PTTHWYQLRCVLSQPLYVMAGQEITGRLHMVAHNAQSYTLHLTMSAKTWGPGAEQGGILQ  478

Query  411  SSTGKLDLKEPYYRMSQPQSYS-ASQDQPNQLLqtqdsqmqsrdddDAILMQQLSPNSNA  235
            +++GKLDLKEPYYRMSQPQ+Y+ A   QP QL+Q Q+  +Q++D    + +QQL+ NSNA
Sbjct  479  TASGKLDLKEPYYRMSQPQAYAWAQDQQPQQLIQPQEPLLQTQDVGGPVSLQQLTQNSNA  538


 Score = 43.1 bits (100),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GL+CWFDVLFNGS VQRWL
Sbjct  394  GLSCWFDVLFNGSAVQRWL  412



>ref|XP_007223076.1| hypothetical protein PRUPE_ppa003751mg [Prunus persica]
 gb|EMJ24275.1| hypothetical protein PRUPE_ppa003751mg [Prunus persica]
Length=551

 Score =   121 bits (304),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 7/84 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL ++AH AQSYTIYLTL+A++       G ++Q
Sbjct  414  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTIYLTLAAKMWGPGAEQGGIIQ  473

Query  411  SSTGKLDLKEPYYRMSQPQSYSAS  340
             S+ KLDLKEPYYRMSQPQ+Y+ +
Sbjct  474  ESSCKLDLKEPYYRMSQPQAYTIT  497


 Score = 44.7 bits (104),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  389  GLACWFDVLFDGSTVQRWL  407



>ref|XP_008223183.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Prunus 
mume]
Length=554

 Score =   121 bits (304),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 7/84 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL ++AH AQSYTIYLTL+A++       G ++Q
Sbjct  417  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTIYLTLAAKMWGPGAEQGGIIQ  476

Query  411  SSTGKLDLKEPYYRMSQPQSYSAS  340
             S+ KLDLKEPYYRMSQPQ+Y+ +
Sbjct  477  ESSCKLDLKEPYYRMSQPQAYTIT  500


 Score = 44.7 bits (104),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  392  GLACWFDVLFDGSTVQRWL  410



>ref|XP_006407889.1| hypothetical protein EUTSA_v10020486mg [Eutrema salsugineum]
 gb|ESQ49342.1| hypothetical protein EUTSA_v10020486mg [Eutrema salsugineum]
Length=534

 Score =   121 bits (304),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 68/88 (77%), Gaps = 7/88 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+ H AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIVHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQP  328
            SST K DLKEPYYRMSQPQ+Y  +Q+ P
Sbjct  472  SSTCKFDLKEPYYRMSQPQAYPVAQEPP  499


 Score = 44.7 bits (104),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>gb|ADE77041.1| unknown [Picea sitchensis]
Length=409

 Score =   121 bits (304),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 7/86 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQ ITGRL +VAH AQSYT+YLT+SA++       G +LQ
Sbjct  266  PTTHWYQLRCVLSQPIYVMAGQVITGRLHMVAHSAQSYTMYLTMSAKMWGAGADQGGILQ  325

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD  334
            +S+ KLDLKEPYYRMSQPQ Y+ SQD
Sbjct  326  TSSSKLDLKEPYYRMSQPQVYAWSQD  351


 Score = 44.3 bits (103),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS VQRWL
Sbjct  241  GLACWFDVLFNGSAVQRWL  259



>ref|XP_007223075.1| hypothetical protein PRUPE_ppa003751mg [Prunus persica]
 gb|EMJ24274.1| hypothetical protein PRUPE_ppa003751mg [Prunus persica]
Length=511

 Score =   121 bits (303),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 68/84 (81%), Gaps = 7/84 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL ++AH AQSYTIYLTL+A++       G ++Q
Sbjct  414  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTIYLTLAAKMWGPGAEQGGIIQ  473

Query  411  SSTGKLDLKEPYYRMSQPQSYSAS  340
             S+ KLDLKEPYYRMSQPQ+Y+ +
Sbjct  474  ESSCKLDLKEPYYRMSQPQAYTIT  497


 Score = 44.7 bits (104),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  389  GLACWFDVLFDGSTVQRWL  407



>ref|XP_003562471.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
[Brachypodium distachyon]
Length=536

 Score =   121 bits (303),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 66/81 (81%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQPLYVM GQEITGRL LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  413  PTTHWYQLRCVLSQPLYVMAGQEITGRLHLVAHSAQSYTIYLTMSAKMWGVGAEQGGILQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +ST KL+LKEPYYR+SQPQ Y
Sbjct  473  TSTAKLELKEPYYRLSQPQPY  493


 Score = 44.7 bits (104),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  388  GLACWFDVLFDGSTVQRWL  406



>ref|XP_010524707.1| PREDICTED: probable histone-arginine methyltransferase 1.3 [Tarenaya 
hassleriana]
Length=538

 Score =   119 bits (297),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 7/84 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQPL+VM GQE+TGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  413  PTTHWYQIRCVLSQPLHVMAGQELTGRLHLVAHSAQSYTINLTLSAKMWGPGAGQGGILQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSYSAS  340
            +S+ KLDLKEPYYRMSQPQ+Y+ +
Sbjct  473  TSSCKLDLKEPYYRMSQPQTYTVA  496


 Score = 46.2 bits (108),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  388  GLACWFDVLFNGSTVQRWL  406



>ref|XP_009352259.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Pyrus 
x bretschneideri]
Length=544

 Score =   120 bits (300),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 7/82 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLS-------AQVGDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH +QSYTIYLTL+       A++G ++Q
Sbjct  415  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMVAHNSQSYTIYLTLAAKMWGPGAELGGIIQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYS  346
             S+ KLDLKEPYYRMSQPQ+Y+
Sbjct  475  QSSCKLDLKEPYYRMSQPQAYT  496


 Score = 44.7 bits (104),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  390  GLACWFDVLFDGSTVQRWL  408



>ref|XP_009151707.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Brassica 
rapa]
Length=523

 Score =   121 bits (304),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  409  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLVAHSAQSYTINLTLSAKMWRPGASQGGILQ  468

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  469  TSSCKLDLKEPYYRMSQPQVYPVAQEPPAQ  498


 Score = 43.1 bits (100),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRW 
Sbjct  384  GLACWFDVLFDGSTVQRWF  402



>emb|CDX86257.1| BnaA06g29740D [Brassica napus]
Length=523

 Score =   121 bits (304),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  409  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLVAHSAQSYTINLTLSAKMWGPGANQGGILQ  468

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  469  TSSCKLDLKEPYYRMSQPQVYPVAQEPPAQ  498


 Score = 43.1 bits (100),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRW 
Sbjct  384  GLACWFDVLFDGSTVQRWF  402



>ref|XP_003533368.1| PREDICTED: probable histone-arginine methyltransferase 1.3-like 
isoform X1 [Glycine max]
Length=537

 Score =   121 bits (303),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 65/81 (80%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGR+ L+AH AQSYTIYL LSA+        G +LQ
Sbjct  408  PTTHWYQLRCVLSQPIYVMAGQEITGRMHLIAHTAQSYTIYLKLSAKTWGPGAEQGGILQ  467

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +S+ KLDLKEPYYRMSQPQ+Y
Sbjct  468  TSSCKLDLKEPYYRMSQPQAY  488


 Score = 43.1 bits (100),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGST +RWL
Sbjct  383  GLACWFDVLFNGSTARRWL  401



>emb|CDY33934.1| BnaA02g30530D [Brassica napus]
Length=529

 Score =   121 bits (303),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQE+TGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  415  PTTHWYQIRCVLSQPIHVMAGQELTGRLHLVAHSAQSYTINLTLSAKMWGPGANQGGILQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  475  TSSCKLDLKEPYYRMSQPQVYPVAQETPAQ  504


 Score = 43.1 bits (100),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRW  593
            GLACWFDVLF+GSTVQRW
Sbjct  390  GLACWFDVLFDGSTVQRW  407



>ref|XP_009129755.1| PREDICTED: probable histone-arginine methyltransferase 1.4 isoform 
X1 [Brassica rapa]
Length=532

 Score =   120 bits (302),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQE+TGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  418  PTTHWYQIRCVLSQPIHVMAGQELTGRLHLVAHSAQSYTINLTLSAKMWGPGANQGGILQ  477

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  478  TSSCKLDLKEPYYRMSQPQVYPVAQETPAQ  507


 Score = 43.1 bits (100),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRW  593
            GLACWFDVLF+GSTVQRW
Sbjct  393  GLACWFDVLFDGSTVQRW  410



>ref|XP_006395101.1| hypothetical protein EUTSA_v10003986mg [Eutrema salsugineum]
 gb|ESQ32387.1| hypothetical protein EUTSA_v10003986mg [Eutrema salsugineum]
Length=527

 Score =   120 bits (302),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 7/86 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  413  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLVAHSAQSYTINLTLSAKMWGPGANQGGILQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQD  334
            +S+ KLDLKEPYYRMSQPQ+Y  SQ+
Sbjct  473  TSSCKLDLKEPYYRMSQPQAYPVSQE  498


 Score = 43.1 bits (100),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRW 
Sbjct  388  GLACWFDVLFDGSTVQRWF  406



>ref|XP_006658954.1| PREDICTED: probable histone-arginine methyltransferase CARM1-like 
[Oryza brachyantha]
Length=551

 Score =   117 bits (292),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 7/78 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRC+LSQPLYVM GQEITGRL LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  427  PTTHWYQLRCILSQPLYVMAGQEITGRLHLVAHSAQSYTIYLTMSAKMWGEGAEQGGILQ  486

Query  411  SSTGKLDLKEPYYRMSQP  358
            +ST KL+LKEPYYR+SQP
Sbjct  487  TSTAKLELKEPYYRLSQP  504


 Score = 46.6 bits (109),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  402  GLACWFDVLFNGSTVQRWL  420



>gb|KHG10436.1| putative histone-arginine methyltransferase 1.3 -like protein 
[Gossypium arboreum]
Length=522

 Score =   117 bits (292),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 7/84 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITG+L +VAH AQSYTI LTLSA++       G ++Q
Sbjct  400  PTTHWYQIRCVLSQPIYVMTGQEITGQLHMVAHNAQSYTINLTLSAKMWGPGAEQGGIIQ  459

Query  411  SSTGKLDLKEPYYRMSQPQSYSAS  340
            SS+ KLDLKEPYYRMSQPQ Y+ +
Sbjct  460  SSSCKLDLKEPYYRMSQPQPYTTA  483


 Score = 46.6 bits (109),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  375  GLACWFDVLFNGSTVQRWL  393



>ref|XP_010666576.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=540

 Score =   117 bits (294),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 7/79 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITG L++VAH  QSYT+YLTLSA++       G +LQ
Sbjct  415  PTTHWYQLRCVLSQPIYVMAGQEITGSLRMVAHNNQSYTLYLTLSAKMWGVGAEQGGILQ  474

Query  411  SSTGKLDLKEPYYRMSQPQ  355
            +S+GK++LKEPYYRMSQPQ
Sbjct  475  TSSGKMELKEPYYRMSQPQ  493


 Score = 45.1 bits (105),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS+VQRWL
Sbjct  390  GLACWFDVLFNGSSVQRWL  408



>ref|XP_010547029.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Tarenaya 
hassleriana]
Length=539

 Score =   116 bits (291),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQE+TGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  413  PTTHWYQIRCVLSQPIHVMAGQELTGRLHLVAHSAQSYTINLTLSAKMWGPGADQGGILQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +S+ KLDLKEPYYRMSQPQ+Y
Sbjct  473  TSSCKLDLKEPYYRMSQPQAY  493


 Score = 46.2 bits (108),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  388  GLACWFDVLFNGSTVQRWL  406



>ref|XP_010666575.1| PREDICTED: probable histone-arginine methyltransferase 1.3 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=541

 Score =   117 bits (293),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 7/79 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITG L++VAH  QSYT+YLTLSA++       G +LQ
Sbjct  415  PTTHWYQLRCVLSQPIYVMAGQEITGSLRMVAHNNQSYTLYLTLSAKMWGVGAEQGGILQ  474

Query  411  SSTGKLDLKEPYYRMSQPQ  355
            +S+GK++LKEPYYRMSQPQ
Sbjct  475  TSSGKMELKEPYYRMSQPQ  493


 Score = 45.1 bits (105),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS+VQRWL
Sbjct  390  GLACWFDVLFNGSSVQRWL  408



>ref|XP_008390660.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Malus 
domestica]
Length=545

 Score =   117 bits (292),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 7/80 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLS-------AQVGDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH +QSYTIYLTL+       A++G ++Q
Sbjct  415  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMVAHNSQSYTIYLTLAAKMWGPGAELGGIIQ  474

Query  411  SSTGKLDLKEPYYRMSQPQS  352
             S+ KLDLKEPYYRMSQPQ+
Sbjct  475  QSSCKLDLKEPYYRMSQPQA  494


 Score = 44.7 bits (104),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  390  GLACWFDVLFDGSTVQRWL  408



>ref|XP_008351193.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Malus 
domestica]
Length=545

 Score =   117 bits (292),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 7/80 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLS-------AQVGDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGRL +VAH +QSYTIYLTL+       A++G ++Q
Sbjct  415  PTTHWYQLRCVLSQPIYVMAGQEITGRLHMVAHNSQSYTIYLTLAAKMWGPGAELGGIIQ  474

Query  411  SSTGKLDLKEPYYRMSQPQS  352
             S+ KLDLKEPYYRMSQPQ+
Sbjct  475  QSSCKLDLKEPYYRMSQPQA  494


 Score = 44.7 bits (104),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  390  GLACWFDVLFDGSTVQRWL  408



>gb|KFK38084.1| hypothetical protein AALP_AA3G067500 [Arabis alpina]
Length=533

 Score =   117 bits (293),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 69/90 (77%), Gaps = 8/90 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  412  PTTHWYQIRCVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQ  471

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +ST K DLKEPYYRMSQP SY  +Q+ P Q
Sbjct  472  TSTCKFDLKEPYYRMSQP-SYPVAQEPPLQ  500


 Score = 44.3 bits (103),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  387  GLACWFDVLFDGSTVQRWL  405



>emb|CDY05647.1| BnaC02g38900D [Brassica napus]
Length=529

 Score =   118 bits (295),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQE+TGRL LVAH  QSYTI LTLSA++       G +LQ
Sbjct  415  PTTHWYQIRCVLSQPIHVMAGQELTGRLHLVAHSTQSYTINLTLSAKMWGPGANQGGILQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ K DLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  475  TSSCKFDLKEPYYRMSQPQVYPVAQETPAQ  504


 Score = 43.1 bits (100),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRW 
Sbjct  390  GLACWFDVLFDGSTVQRWF  408



>ref|XP_008786718.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X2 [Phoenix dactylifera]
Length=541

 Score =   115 bits (289),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVL+QPLYVM GQEITG+L+LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  418  PTTHWYQLRCVLAQPLYVMAGQEITGQLRLVAHSAQSYTIYLTMSAKMWGAGANQGGILQ  477

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +S+ KL+LKEPYYR+SQPQ Y
Sbjct  478  TSSCKLELKEPYYRLSQPQPY  498


 Score = 45.1 bits (105),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS+VQRWL
Sbjct  393  GLACWFDVLFNGSSVQRWL  411



>ref|XP_008786717.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X1 [Phoenix dactylifera]
Length=542

 Score =   115 bits (289),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVL+QPLYVM GQEITG+L+LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  419  PTTHWYQLRCVLAQPLYVMAGQEITGQLRLVAHSAQSYTIYLTMSAKMWGAGANQGGILQ  478

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +S+ KL+LKEPYYR+SQPQ Y
Sbjct  479  TSSCKLELKEPYYRLSQPQPY  499


 Score = 45.1 bits (105),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS+VQRWL
Sbjct  394  GLACWFDVLFNGSSVQRWL  412



>ref|XP_002863948.1| arginine N-methyltransferase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH40207.1| arginine N-methyltransferase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=526

 Score =   117 bits (293),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 65/81 (80%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  413  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLVAHSAQSYTINLTLSAKMWGPGANQGGILQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +S+ KLDLKEPYYRMSQPQ Y
Sbjct  473  TSSCKLDLKEPYYRMSQPQVY  493


 Score = 43.1 bits (100),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRW  593
            GLACWFDVLF+GSTVQRW
Sbjct  388  GLACWFDVLFDGSTVQRW  405



>gb|KHN26555.1| Putative histone-arginine methyltransferase 1.4 [Glycine soja]
Length=537

 Score =   117 bits (293),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVLSQP+YVM GQEITGR+ L+AH AQSYTIYL LSA+        G +LQ
Sbjct  408  PTTHWYQLRCVLSQPIYVMAGQEITGRMHLIAHTAQSYTIYLKLSAKTWGPGAEQGGILQ  467

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +S+ KLDLKEPYYRMSQ Q+Y
Sbjct  468  TSSCKLDLKEPYYRMSQLQAY  488


 Score = 43.1 bits (100),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGST +RWL
Sbjct  383  GLACWFDVLFNGSTARRWL  401



>ref|XP_010921814.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X1 [Elaeis guineensis]
Length=542

 Score =   117 bits (293),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVL+QPLYVM GQEITGRL LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  419  PTTHWYQLRCVLAQPLYVMAGQEITGRLHLVAHSAQSYTIYLTMSAKMWGAGANQGGILQ  478

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +S+ KL+LKEPYYR+SQPQ Y
Sbjct  479  TSSCKLELKEPYYRLSQPQPY  499


 Score = 43.1 bits (100),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GS+VQRWL
Sbjct  394  GLACWFDVLFSGSSVQRWL  412



>ref|XP_010921815.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
isoform X2 [Elaeis guineensis]
Length=541

 Score =   117 bits (293),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVL+QPLYVM GQEITGRL LVAH AQSYTIYLT+SA++       G +LQ
Sbjct  418  PTTHWYQLRCVLAQPLYVMAGQEITGRLHLVAHSAQSYTIYLTMSAKMWGAGANQGGILQ  477

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +S+ KL+LKEPYYR+SQPQ Y
Sbjct  478  TSSCKLELKEPYYRLSQPQPY  498


 Score = 43.1 bits (100),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GS+VQRWL
Sbjct  393  GLACWFDVLFSGSSVQRWL  411



>ref|XP_009383901.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
[Musa acuminata subsp. malaccensis]
Length=550

 Score =   115 bits (288),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 65/87 (75%), Gaps = 7/87 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVL+QP+YVM GQEITGR  LV+H AQSYTIYLTLSA+        G +LQ
Sbjct  417  PTTHWYQLRCVLAQPIYVMAGQEITGRFHLVSHNAQSYTIYLTLSAKTWGAGADQGGILQ  476

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQ  331
            + + KLDLKEPYYR+SQP  Y   QDQ
Sbjct  477  TFSCKLDLKEPYYRLSQPLPYVLQQDQ  503


 Score = 44.7 bits (104),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS+VQRWL
Sbjct  392  GLACWFDVLFNGSSVQRWL  410



>ref|XP_010442362.1| PREDICTED: probable histone-arginine methyltransferase 1.4 [Camelina 
sativa]
Length=528

 Score =   117 bits (293),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  414  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLVAHSAQSYTINLTLSAKMWGPRANQGGILQ  473

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  474  TSSCKLDLKEPYYRMSQPQVY-PTQEPPAQ  502


 Score = 43.1 bits (100),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRW 
Sbjct  389  GLACWFDVLFDGSTVQRWF  407



>ref|NP_974913.1| protein arginine methyltransferase 4A [Arabidopsis thaliana]
 gb|AED95760.1| protein arginine methyltransferase 4A [Arabidopsis thaliana]
Length=526

 Score =   117 bits (292),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  413  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLIAHSAQSYTINLTLSAKMWGPGANQGGILQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  473  TSSCKLDLKEPYYRMSQPQVY-PTQEPPAQ  501


 Score = 43.1 bits (100),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRW  593
            GLACWFDVLF+GSTVQRW
Sbjct  388  GLACWFDVLFDGSTVQRW  405



>ref|NP_199713.2| protein arginine methyltransferase 4A [Arabidopsis thaliana]
 sp|A3KPF2.1|ANM14_ARATH RecName: Full=Probable histone-arginine methyltransferase 1.4; 
Short=AtPRMT14; AltName: Full=Coactivator-associated methyltransferase 
1B; AltName: Full=Protein arginine N-methyltransferase 
4A; Short=AtPRMT4A [Arabidopsis thaliana]
 gb|ABO09883.1| At5g49020 [Arabidopsis thaliana]
 gb|ABO09886.1| At5g49020 [Arabidopsis thaliana]
 gb|AED95761.1| protein arginine methyltransferase 4A [Arabidopsis thaliana]
Length=528

 Score =   117 bits (292),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  415  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLIAHSAQSYTINLTLSAKMWGPGANQGGILQ  474

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  475  TSSCKLDLKEPYYRMSQPQVY-PTQEPPAQ  503


 Score = 43.1 bits (100),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRW  593
            GLACWFDVLF+GSTVQRW
Sbjct  390  GLACWFDVLFDGSTVQRW  407



>ref|XP_010442359.1| PREDICTED: probable histone-arginine methyltransferase 1.4 isoform 
X1 [Camelina sativa]
Length=527

 Score =   117 bits (292),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  413  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLVAHSAQSYTINLTLSAKMWGPGANQGGILQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  473  TSSCKLDLKEPYYRMSQPQVYP-TQEPPAQ  501


 Score = 43.1 bits (100),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRW 
Sbjct  388  GLACWFDVLFDGSTVQRWF  406



>emb|CDX85389.1| BnaC07g27000D [Brassica napus]
Length=523

 Score =   117 bits (293),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 7/90 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVL QP++VM GQEITGRL LVAH AQSYTI L LSA++       G +LQ
Sbjct  409  PTTHWYQIRCVLLQPIHVMAGQEITGRLHLVAHSAQSYTINLNLSAKMWGPGANQGGILQ  468

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  469  TSSCKLDLKEPYYRMSQPQVYPVAQEPPAQ  498


 Score = 42.7 bits (99),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRW 
Sbjct  384  GLACWFDVLFDGSTVQRWF  402



>ref|XP_010442360.1| PREDICTED: probable histone-arginine methyltransferase 1.4 isoform 
X2 [Camelina sativa]
Length=521

 Score =   117 bits (292),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  413  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLVAHSAQSYTINLTLSAKMWGPGANQGGILQ  472

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  473  TSSCKLDLKEPYYRMSQPQVYP-TQEPPAQ  501


 Score = 43.1 bits (100),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRW 
Sbjct  388  GLACWFDVLFDGSTVQRWF  406



>dbj|BAB10326.1| arginine methyltransferase-like protein [Arabidopsis thaliana]
Length=577

 Score =   117 bits (292),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  464  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLIAHSAQSYTINLTLSAKMWGPGANQGGILQ  523

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  524  TSSCKLDLKEPYYRMSQPQVY-PTQEPPAQ  552


 Score = 43.1 bits (100),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRW 
Sbjct  439  GLACWFDVLFDGSTVQRWF  457



>ref|XP_006280207.1| hypothetical protein CARUB_v10026115mg [Capsella rubella]
 gb|EOA13105.1| hypothetical protein CARUB_v10026115mg [Capsella rubella]
Length=601

 Score =   116 bits (291),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 65/81 (80%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQPL+VM GQE+TGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  488  PTTHWYQIRCVLSQPLHVMAGQELTGRLHLVAHSAQSYTINLTLSAKMWGPGANQGGILQ  547

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +S+ KLDLKEPYYRMSQPQ Y
Sbjct  548  TSSCKLDLKEPYYRMSQPQVY  568


 Score = 43.1 bits (100),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRW  593
            GLACWFDVLF+GSTVQRW
Sbjct  463  GLACWFDVLFDGSTVQRW  480



>gb|AAO22781.1| putative arginine methyltransferase [Arabidopsis thaliana]
Length=435

 Score =   116 bits (290),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQEITGRL L+AH AQSYTI LTLSA++       G +LQ
Sbjct  322  PTTHWYQIRCVLSQPIHVMAGQEITGRLHLIAHSAQSYTINLTLSAKMWGPGANQGGILQ  381

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            +S+ KLDLKEPYYRMSQPQ Y  +Q+ P Q
Sbjct  382  TSSCKLDLKEPYYRMSQPQVYP-TQEPPAQ  410


 Score = 43.1 bits (100),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRW  593
            GLACWFDVLF+GSTVQRW
Sbjct  297  GLACWFDVLFDGSTVQRW  314



>ref|XP_009129756.1| PREDICTED: probable histone-arginine methyltransferase 1.4 isoform 
X2 [Brassica rapa]
Length=519

 Score =   115 bits (288),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 67/91 (74%), Gaps = 7/91 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP++VM GQE+TGRL LVAH AQSYTI LTLSA++       G +LQ
Sbjct  418  PTTHWYQIRCVLSQPIHVMAGQELTGRLHLVAHSAQSYTINLTLSAKMWGPGANQGGILQ  477

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQL  319
            +S+ KLDLKEPYYRMSQPQ      D   +L
Sbjct  478  TSSCKLDLKEPYYRMSQPQDIQIQSDDLEEL  508


 Score = 43.1 bits (100),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRW  593
            GLACWFDVLF+GSTVQRW
Sbjct  393  GLACWFDVLFDGSTVQRW  410



>ref|XP_009384405.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
[Musa acuminata subsp. malaccensis]
Length=540

 Score =   113 bits (282),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 64/81 (79%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQLRCVL+QP+YVM GQEITGR  LV+H AQSYTI+LT+SA++       G +LQ
Sbjct  417  PTTHWYQLRCVLAQPIYVMAGQEITGRFHLVSHSAQSYTIFLTMSAKMWGAGADQGGILQ  476

Query  411  SSTGKLDLKEPYYRMSQPQSY  349
            +S+ K DLKEPYYR+SQPQ Y
Sbjct  477  TSSCKFDLKEPYYRLSQPQPY  497


 Score = 45.1 bits (105),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS+VQRWL
Sbjct  392  GLACWFDVLFNGSSVQRWL  410



>ref|XP_001759700.1| protein arginine N-methyltransferase [Physcomitrella patens]
 gb|EDQ75612.1| protein arginine N-methyltransferase [Physcomitrella patens]
Length=383

 Score =   105 bits (262),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 9/85 (11%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSA--------QVGDML  415
            P  HWYQ+RCVLSQPLYV+ GQ ITGRL L+AH +QSYTI+LT+SA        +VG  L
Sbjct  286  PTTHWYQIRCVLSQPLYVLAGQPITGRLHLIAHSSQSYTIHLTMSASSIIPGSNRVG-TL  344

Query  414  QSSTGKLDLKEPYYRMSQPQSYSAS  340
            Q+ST KLDLKEPYYRM+Q  +++ S
Sbjct  345  QTSTAKLDLKEPYYRMTQSPAFAWS  369


 Score = 45.1 bits (105),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF+GSTVQRWL
Sbjct  261  GLACWFDVLFDGSTVQRWL  279



>ref|XP_002973896.1| hypothetical protein SELMODRAFT_149478 [Selaginella moellendorffii]
 gb|EFJ24851.1| hypothetical protein SELMODRAFT_149478 [Selaginella moellendorffii]
Length=542

 Score =   103 bits (256),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 62/87 (71%), Gaps = 7/87 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLS-------AQVGDMLQ  412
            P  HWYQLR VLSQPLYVM GQ IT RL L AH AQSYTI L++S       A  G  +Q
Sbjct  436  PTTHWYQLRLVLSQPLYVMAGQTITTRLHLSAHSAQSYTINLSMSTTSWGAGAGQGATIQ  495

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQ  331
            SS+GK DLKEPYYRMSQ  +Y+ +Q+Q
Sbjct  496  SSSGKFDLKEPYYRMSQMPAYTWTQEQ  522


 Score = 42.7 bits (99),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            G+ACWFDVLFNGST+ RWL
Sbjct  411  GIACWFDVLFNGSTIPRWL  429



>ref|XP_002969165.1| hypothetical protein SELMODRAFT_410045 [Selaginella moellendorffii]
 gb|EFJ30281.1| hypothetical protein SELMODRAFT_410045 [Selaginella moellendorffii]
Length=526

 Score =   102 bits (255),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 62/87 (71%), Gaps = 7/87 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLS-------AQVGDMLQ  412
            P  HWYQLR VLSQPLYVM GQ IT RL L AH AQSYTI L++S       A  G  +Q
Sbjct  420  PTTHWYQLRLVLSQPLYVMAGQTITTRLHLSAHSAQSYTINLSMSTTSWGAGAGQGATIQ  479

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQ  331
            SS+GK DLKEPYYRMSQ  +Y+ +Q+Q
Sbjct  480  SSSGKFDLKEPYYRMSQMPAYTWTQEQ  506


 Score = 42.7 bits (99),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            G+ACWFDVLFNGST+ RWL
Sbjct  395  GIACWFDVLFNGSTIPRWL  413



>gb|AFK44531.1| unknown [Medicago truncatula]
Length=111

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 82/107 (77%), Gaps = 8/107 (7%)
 Frame = -2

Query  516  MPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQSSTGKLDLKEPYYRMSQP  358
            M GQEITGRL L+AH AQSYTIYLTLSA++       G +LQ+S+ KLDLKEPYYRMSQP
Sbjct  1    MAGQEITGRLHLIAHNAQSYTIYLTLSAKMWGPGAEQGGILQTSSCKLDLKEPYYRMSQP  60

Query  357  QSYSASQDQ-PNQLLqtqdsqmqsrdddDAILMQQLSPNSNADLQSL  220
            Q+Y  +QDQ P  L+QTQD  +QS++ D+  +MQQLSPNS A + SL
Sbjct  61   QAYPLAQDQRPQPLVQTQDIHIQSQELDEPEIMQQLSPNSCAQIDSL  107



>ref|XP_007035587.1| Arginine methyltransferase 4B isoform 3, partial [Theobroma cacao]
 gb|EOY06513.1| Arginine methyltransferase 4B isoform 3, partial [Theobroma cacao]
Length=470

 Score = 88.2 bits (217),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 7/62 (11%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQ+RCVLSQP+YVM GQEITGRL ++AH AQSYTIYLTLSA++       G +LQ
Sbjct  409  PTTHWYQIRCVLSQPIYVMAGQEITGRLHMIAHNAQSYTIYLTLSAKMWGPGAEQGGILQ  468

Query  411  SS  406
            +S
Sbjct  469  TS  470


 Score = 46.2 bits (108),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGSTVQRWL
Sbjct  384  GLACWFDVLFNGSTVQRWL  402



>ref|XP_010914428.1| PREDICTED: probable histone-arginine methyltransferase CARM1 
[Elaeis guineensis]
Length=553

 Score = 86.7 bits (213),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 7/91 (8%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQ  412
            P  HWYQL CVL QP+YVM  QEITG L LVAH  QSYTI L++SA++       G +LQ
Sbjct  409  PTTHWYQLLCVLPQPMYVMAEQEITGHLHLVAHHGQSYTINLSMSAKMWGPGACQGGILQ  468

Query  411  SSTGKLDLKEPYYRMSQPQSYSASQDQPNQL  319
            +S+  LDL+ PY  +SQ  +    Q+  NQ 
Sbjct  469  TSSCSLDLQNPYCHISQFYAVPHEQELLNQF  499


 Score = 42.0 bits (97),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLFNGS+VQ WL
Sbjct  384  GLACWFDVLFNGSSVQSWL  402



>ref|XP_005645466.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE20922.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=483

 Score = 86.3 bits (212),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 51/77 (66%), Gaps = 10/77 (13%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLS------AQVGD----  421
            P  HW+QLRCVLSQPL V PG E+ G L+L+AHK QSY I+L LS       +VG     
Sbjct  384  PTTHWFQLRCVLSQPLTVYPGAELHGELRLIAHKRQSYDIHLRLSVPSLAPGRVGSDAWP  443

Query  420  MLQSSTGKLDLKEPYYR  370
             L+  TGK DLKEPYYR
Sbjct  444  CLRQVTGKFDLKEPYYR  460


 Score = 39.7 bits (91),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            G+ACWFDVLF+GS+ QRWL
Sbjct  359  GVACWFDVLFDGSSSQRWL  377



>gb|EMT08864.1| Putative histone-arginine methyltransferase CARM1 [Aegilops tauschii]
Length=488

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 71/106 (67%), Gaps = 14/106 (13%)
 Frame = -2

Query  627  MCCLTGALFRGG*PLLLVHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIY  448
            + C    LF G     + +P  H+  ++ +   PLYVM GQEITGRL LVAH AQSYTIY
Sbjct  276  LACWFDVLFNGS---SVFNPFIHFPGIKNL---PLYVMAGQEITGRLHLVAHSAQSYTIY  329

Query  447  LTLSAQV-------GDMLQSSTGKLDLKEPYYRMSQPQSYSASQDQ  331
            LT+SA++       G +LQ+ST KL+LKEPYYR+SQPQ+Y   QDQ
Sbjct  330  LTMSAKMWGVGADPGGILQTSTAKLELKEPYYRLSQPQAY-MPQDQ  374



>ref|XP_006489087.1| PREDICTED: probable histone-arginine methyltransferase 1.4-like 
[Citrus sinensis]
Length=105

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 76/105 (72%), Gaps = 8/105 (8%)
 Frame = -2

Query  516  MPGQEITGRLKLVAHKAQSYTIYLTLSAQV-------GDMLQSSTGKLDLKEPYYRMSQP  358
            M GQEITG+L+++AH AQSYTIYLTLS ++       G +LQ+S+ KLDLKEPYYRMSQP
Sbjct  1    MAGQEITGQLRMIAHSAQSYTIYLTLSVKMWGPGADQGGILQTSSCKLDLKEPYYRMSQP  60

Query  357  QSYSASQD-QPNQLLqtqdsqmqsrdddDAILMQQLSPNSNADLQ  226
            Q Y  +QD QP+QL+ +QD  +Q+ D ++  L+Q  S  S A LQ
Sbjct  61   QPYVLTQDQQPHQLMHSQDIPIQAEDLEEPELIQLQSQCSGAQLQ  105



>gb|EMS50330.1| putative histone-arginine methyltransferase CARM1 [Triticum urartu]
Length=534

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 71/106 (67%), Gaps = 14/106 (13%)
 Frame = -2

Query  627  MCCLTGALFRGG*PLLLVHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIY  448
            + C    LF G     + +P  H+  ++ +   PLYVM GQEITGRL LVAH AQSYTIY
Sbjct  399  LACWFDVLFNGS---SVFNPFIHYPGIKNL---PLYVMAGQEITGRLHLVAHSAQSYTIY  452

Query  447  LTLSAQV-------GDMLQSSTGKLDLKEPYYRMSQPQSYSASQDQ  331
            LT+SA++       G +LQ+ST KL+LKEPYYR+SQPQ+Y   QDQ
Sbjct  453  LTMSAKMWGVGADPGGILQTSTAKLELKEPYYRLSQPQAY-MPQDQ  497



>ref|XP_001753890.1| protein arginine N-methyltransferase [Physcomitrella patens]
 gb|EDQ81212.1| protein arginine N-methyltransferase, partial [Physcomitrella 
patens]
Length=383

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 71/115 (62%), Gaps = 14/115 (12%)
 Frame = -2

Query  627  MCCLTGALFRG-G*PLLLV----HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQ  463
            + C    LF G   P  L      P  HWYQ+RC++SQPL V+ GQ +TGRL ++AH +Q
Sbjct  256  LACWFDVLFDGSAVPRWLTTSPGSPTTHWYQIRCLISQPLCVLAGQPVTGRLHMIAHSSQ  315

Query  462  SYTIYLTLSAQ--------VGDMLQSSTGKLDLKEPYYRMSQPQSYSASQDQPNQ  322
            SYT++LTLSA         VG   Q+ST +LDLKEPYYRM+Q  +Y+  Q +  Q
Sbjct  316  SYTVHLTLSASSMTPDLNGVGGT-QTSTVELDLKEPYYRMTQFPAYAWFQQEQTQ  369



>ref|XP_002958435.1| hypothetical protein VOLCADRAFT_69442 [Volvox carteri f. nagariensis]
 gb|EFJ40511.1| hypothetical protein VOLCADRAFT_69442 [Volvox carteri f. nagariensis]
Length=392

 Score = 79.3 bits (194),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVM-PGQEITGRLKLVAHKAQSYTIYLTLSA---QVGDMLQSST  403
            P  HW+QLRCVL  PL V  P   ITG+L LVAH  QSY IYLTL+A   Q G   Q+S+
Sbjct  279  PTTHWFQLRCVLQHPLVVTSPNTRITGQLHLVAHARQSYDIYLTLTAPPLQPGQPPQTSS  338

Query  402  GKLDLKEPYYRMSQP  358
            GK DLKEPYYR   P
Sbjct  339  GKFDLKEPYYRQLTP  353


 Score = 31.2 bits (69),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDV F GS    WL
Sbjct  254  GLACWFDVFFAGSQQPVWL  272



>ref|XP_011398151.1| putative histone-arginine methyltransferase CARM1 [Auxenochlorella 
protothecoides]
 gb|KFM25259.1| putative histone-arginine methyltransferase CARM1 [Auxenochlorella 
protothecoides]
Length=345

 Score = 68.2 bits (165),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVM-PGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
            P  HW+QLRC+L +P+ V   G  +TGRL L+AH  QSY + L LS+    +   S G+ 
Sbjct  252  PTTHWFQLRCLLQEPVQVAKAGDTLTGRLHLLAHSRQSYDVTLELSSGASPV---SVGRY  308

Query  393  DLKEPYYR  370
            DLKEPYYR
Sbjct  309  DLKEPYYR  316


 Score = 38.1 bits (87),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLACWFDVLF GS   RWL
Sbjct  227  GLACWFDVLFEGSQAPRWL  245



>ref|XP_011153280.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X3 [Harpegnathos saltator]
 ref|XP_011153281.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X3 [Harpegnathos saltator]
Length=532

 Score = 72.4 bits (176),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIDLKLE-GTNLESSSNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.0 bits (66),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_011068467.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X3 [Acromyrmex echinatior]
Length=519

 Score = 72.0 bits (175),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   L
Sbjct  383  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNTL  441

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  442  DLKNPYFR------YTGAAAQP  457


 Score = 30.4 bits (67),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  359  GLAFWFDVAFIGSTQQVWL  377



>ref|XP_011153278.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X1 [Harpegnathos saltator]
Length=603

 Score = 72.0 bits (175),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIDLKLE-GTNLESSSNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.4 bits (67),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_011153279.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X2 [Harpegnathos saltator]
 gb|EFN75292.1| Probable histone-arginine methyltransferase CARMER [Harpegnathos 
saltator]
Length=597

 Score = 72.0 bits (175),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIDLKLE-GTNLESSSNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.4 bits (67),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_011171805.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X7 [Solenopsis invicta]
Length=519

 Score = 72.0 bits (175),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   LD
Sbjct  389  PLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNTLD  447

Query  390  LKEPYYRMSQPQSYSASQDQP  328
            LK PY+R      Y+ +  QP
Sbjct  448  LKNPYFR------YTGAAAQP  462


 Score = 30.0 bits (66),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  364  GLAFWFDVAFIGSTQQVWL  382



>ref|XP_011171800.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X6 [Solenopsis invicta]
Length=527

 Score = 72.0 bits (175),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   L
Sbjct  388  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNTL  446

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  447  DLKNPYFR------YTGAAAQP  462


 Score = 30.0 bits (66),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  364  GLAFWFDVAFIGSTQQVWL  382



>ref|XP_003699948.1| PREDICTED: histone-arginine methyltransferase CARMER-like isoform 
2 [Megachile rotundata]
Length=603

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ LVA+K QSY + + L  + G  ++SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILVANKRQSYDVTIELKLE-GTNMESSSNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.4 bits (67),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_003699947.1| PREDICTED: histone-arginine methyltransferase CARMER-like isoform 
1 [Megachile rotundata]
Length=597

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ LVA+K QSY + + L  + G  ++SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILVANKRQSYDVTIELKLE-GTNMESSSNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.4 bits (67),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_011171796.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X5 [Solenopsis invicta]
Length=574

 Score = 72.0 bits (175),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 7/83 (8%)
 Frame = -2

Query  576  VHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGK  397
              P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   
Sbjct  387  TEPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNT  445

Query  396  LDLKEPYYRMSQPQSYSASQDQP  328
            LDLK PY+R      Y+ +  QP
Sbjct  446  LDLKNPYFR------YTGAAAQP  462


 Score = 30.0 bits (66),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  364  GLAFWFDVAFIGSTQQVWL  382



>ref|XP_011171789.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X4 [Solenopsis invicta]
 gb|EFZ21951.1| hypothetical protein SINV_05460 [Solenopsis invicta]
Length=597

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.0 bits (66),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_011171780.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X2 [Solenopsis invicta]
Length=603

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.0 bits (66),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_011068465.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X1 [Acromyrmex echinatior]
Length=599

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   L
Sbjct  383  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNTL  441

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  442  DLKNPYFR------YTGAAAQP  457


 Score = 30.4 bits (67),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  359  GLAFWFDVAFIGSTQQVWL  377



>ref|XP_011068466.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X2 [Acromyrmex echinatior]
 gb|EGI69535.1| Histone-arginine methyltransferase CARMER [Acromyrmex echinatior]
Length=593

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   L
Sbjct  383  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNTL  441

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  442  DLKNPYFR------YTGAAAQP  457


 Score = 30.4 bits (67),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  359  GLAFWFDVAFIGSTQQVWL  377



>ref|XP_011171773.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X1 [Solenopsis invicta]
Length=606

 Score = 72.0 bits (175),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 7/83 (8%)
 Frame = -2

Query  576  VHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGK  397
              P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   
Sbjct  387  TEPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNT  445

Query  396  LDLKEPYYRMSQPQSYSASQDQP  328
            LDLK PY+R      Y+ +  QP
Sbjct  446  LDLKNPYFR------YTGAAAQP  462


 Score = 30.0 bits (66),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  364  GLAFWFDVAFIGSTQQVWL  382



>ref|XP_011171786.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X3 [Solenopsis invicta]
Length=600

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 7/83 (8%)
 Frame = -2

Query  576  VHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGK  397
              P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   
Sbjct  387  TEPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNT  445

Query  396  LDLKEPYYRMSQPQSYSASQDQP  328
            LDLK PY+R      Y+ +  QP
Sbjct  446  LDLKNPYFR------YTGAAAQP  462


 Score = 30.0 bits (66),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  364  GLAFWFDVAFIGSTQQVWL  382



>ref|XP_011334337.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X3 [Cerapachys biroi]
Length=564

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  L
Sbjct  384  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIDLKLE-GTNMESSSNTL  442

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  443  DLKNPYFR------YTGAAAQP  458


 Score = 30.4 bits (67),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  360  GLAFWFDVAFIGSTQQVWL  378



>ref|XP_006619600.1| PREDICTED: histone-arginine methyltransferase CARMER-like isoform 
X2 [Apis dorsata]
Length=597

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = -2

Query  576  VHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGK  397
              P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  
Sbjct  384  TEPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNMESSSNT  442

Query  396  LDLKEPYYRMSQPQSYSASQDQP  328
            LDLK PY+R      Y+ +  QP
Sbjct  443  LDLKNPYFR------YTGAAAQP  459


 Score = 30.4 bits (67),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_006619599.1| PREDICTED: histone-arginine methyltransferase CARMER-like isoform 
X1 [Apis dorsata]
Length=603

 Score = 71.6 bits (174),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNMESSSNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.0 bits (66),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_003250875.1| PREDICTED: histone-arginine methyltransferase CARMER-like isoform 
1 [Apis mellifera]
Length=597

 Score = 71.6 bits (174),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNMESSSNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.0 bits (66),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_003691819.1| PREDICTED: histone-arginine methyltransferase CARMER-like isoform 
1 [Apis florea]
Length=600

 Score = 71.6 bits (174),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = -2

Query  576  VHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGK  397
              P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  
Sbjct  387  TEPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNMESSSNT  445

Query  396  LDLKEPYYRMSQPQSYSASQDQP  328
            LDLK PY+R      Y+ +  QP
Sbjct  446  LDLKNPYFR------YTGAAAQP  462


 Score = 30.0 bits (66),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  364  GLAFWFDVAFIGSTQQVWL  382



>ref|XP_011171813.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X8 [Solenopsis invicta]
Length=499

 Score = 71.6 bits (174),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 7/83 (8%)
 Frame = -2

Query  576  VHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGK  397
              P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  L+SS   
Sbjct  280  TEPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNLESSNNT  338

Query  396  LDLKEPYYRMSQPQSYSASQDQP  328
            LDLK PY+R      Y+ +  QP
Sbjct  339  LDLKNPYFR------YTGAAAQP  355


 Score = 30.0 bits (66),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  257  GLAFWFDVAFIGSTQQVWL  275



>ref|XP_011259471.1| PREDICTED: histone-arginine methyltransferase CARMER [Camponotus 
floridanus]
Length=597

 Score = 71.2 bits (173),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNMESSSNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.4 bits (67),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_011334328.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X2 [Cerapachys biroi]
 gb|EZA62362.1| Histone-arginine methyltransferase CARMER [Cerapachys biroi]
Length=596

 Score = 71.2 bits (173),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  L
Sbjct  384  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIDLKLE-GTNMESSSNTL  442

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  443  DLKNPYFR------YTGAAAQP  458


 Score = 30.4 bits (67),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  360  GLAFWFDVAFIGSTQQVWL  378



>ref|XP_003691820.1| PREDICTED: histone-arginine methyltransferase CARMER-like isoform 
2 [Apis florea]
Length=606

 Score = 71.6 bits (174),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  L
Sbjct  388  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNMESSSNTL  446

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  447  DLKNPYFR------YTGAAAQP  462


 Score = 30.0 bits (66),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  364  GLAFWFDVAFIGSTQQVWL  382



>ref|XP_003489685.1| PREDICTED: histone-arginine methyltransferase CARMER-like [Bombus 
impatiens]
Length=597

 Score = 71.2 bits (173),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNMESSSNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.0 bits (66),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_011334319.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X1 [Cerapachys biroi]
Length=602

 Score = 71.2 bits (173),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  L
Sbjct  384  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIDLKLE-GTNMESSSNTL  442

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  443  DLKNPYFR------YTGAAAQP  458


 Score = 30.4 bits (67),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  360  GLAFWFDVAFIGSTQQVWL  378



>ref|XP_003398778.1| PREDICTED: histone-arginine methyltransferase CARMER-like [Bombus 
terrestris]
Length=597

 Score = 71.2 bits (173),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIELKLE-GTNMESSSNTL  443

Query  393  DLKEPYYRMSQPQSYSASQDQP  328
            DLK PY+R      Y+ +  QP
Sbjct  444  DLKNPYFR------YTGAAAQP  459


 Score = 30.0 bits (66),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_011304798.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X1 [Fopius arisanus]
Length=603

 Score = 71.2 bits (173),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ LVA+K QSY + + L  + G  ++SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILVANKRQSYDVTIDLKLE-GTNMESSSNTL  443

Query  393  DLKEPYYR  370
            DLK PY+R
Sbjct  444  DLKNPYFR  451


 Score = 30.4 bits (67),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_011304799.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X2 [Fopius arisanus]
Length=597

 Score = 70.9 bits (172),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   GQ ++G++ LVA+K QSY + + L  + G  ++SS+  L
Sbjct  385  EPLTHWYQVRCLLENPLFCKSGQLLSGKVILVANKRQSYDVTIDLKLE-GTNMESSSNTL  443

Query  393  DLKEPYYR  370
            DLK PY+R
Sbjct  444  DLKNPYFR  451


 Score = 30.4 bits (67),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_008543719.1| PREDICTED: probable histone-arginine methyltransferase CARMER 
isoform X1 [Microplitis demolitor]
Length=602

 Score = 70.9 bits (172),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -2

Query  576  VHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGK  397
              P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  
Sbjct  384  TEPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIDLKLE-GTNIESSSNT  442

Query  396  LDLKEPYYR  370
            LDLK PY+R
Sbjct  443  LDLKNPYFR  451


 Score = 30.0 bits (66),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_008543720.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X2 [Microplitis demolitor]
Length=596

 Score = 70.9 bits (172),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = -2

Query  576  VHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGK  397
              P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY + + L  + G  ++SS+  
Sbjct  384  TEPLTHWYQVRCLLENPLFCKSGQLLSGKVILIANKRQSYDVTIDLKLE-GTNIESSSNT  442

Query  396  LDLKEPYYR  370
            LDLK PY+R
Sbjct  443  LDLKNPYFR  451


 Score = 30.0 bits (66),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>gb|EHJ77473.1| hypothetical protein KGM_04110 [Danaus plexippus]
Length=532

 Score = 67.8 bits (164),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P++   GQ +TGR+ L+A+K QSY + + ++ +  ++  SS+  LD
Sbjct  384  PLTHWYQVRCLLETPIFAKQGQALTGRVLLLANKRQSYDVTMEINLEGTNI--SSSNTLD  441

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  442  LKNPYFR  448


 Score = 31.2 bits (69),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDVLF GST   WL
Sbjct  359  GLAFWFDVLFAGSTQHIWL  377



>ref|XP_011502373.1| PREDICTED: histone-arginine methyltransferase CARMER [Ceratosolen 
solmsi marchali]
Length=571

 Score = 67.8 bits (164),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 7/81 (9%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   GQ ++G + L+A+K QSY + + L  + G  + SS   LD
Sbjct  386  PLTHWYQVRCLLENPLFCKSGQLLSGIVNLIANKRQSYDVTIELKLE-GTNMGSSKNTLD  444

Query  390  LKEPYYRMSQPQSYSASQDQP  328
            LK PY+R      Y+ +  QP
Sbjct  445  LKNPYFR------YTGAAVQP  459


 Score = 30.0 bits (66),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GST Q WL
Sbjct  361  GLAFWFDVAFIGSTQQVWL  379



>ref|XP_008200759.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X3 [Tribolium castaneum]
Length=586

 Score = 71.2 bits (173),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L QPL +  GQ +TGR+ LVA+K QSY + + L+ +  +  QSS   L
Sbjct  381  EPLTHWYQVRCLLEQPLLLKQGQVLTGRVLLVANKRQSYDVTIDLAVEGTN--QSSKNTL  438

Query  393  DLKEPYYR  370
            DLK PY+R
Sbjct  439  DLKNPYFR  446


 Score = 26.2 bits (56),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS    WL
Sbjct  357  GLAFWFDVAFAGSQQTIWL  375



>ref|XP_008200758.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X2 [Tribolium castaneum]
Length=598

 Score = 71.2 bits (173),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L QPL +  GQ +TGR+ LVA+K QSY + + L+ +  +  QSS   L
Sbjct  381  EPLTHWYQVRCLLEQPLLLKQGQVLTGRVLLVANKRQSYDVTIDLAVEGTN--QSSKNTL  438

Query  393  DLKEPYYR  370
            DLK PY+R
Sbjct  439  DLKNPYFR  446


 Score = 26.2 bits (56),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS    WL
Sbjct  357  GLAFWFDVAFAGSQQTIWL  375



>ref|XP_008200757.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X1 [Tribolium castaneum]
 gb|EFA10996.1| hypothetical protein TcasGA2_TC004581 [Tribolium castaneum]
Length=605

 Score = 71.2 bits (173),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L QPL +  GQ +TGR+ LVA+K QSY + + L+ +  +  QSS   L
Sbjct  381  EPLTHWYQVRCLLEQPLLLKQGQVLTGRVLLVANKRQSYDVTIDLAVEGTN--QSSKNTL  438

Query  393  DLKEPYYR  370
            DLK PY+R
Sbjct  439  DLKNPYFR  446


 Score = 26.2 bits (56),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS    WL
Sbjct  357  GLAFWFDVAFAGSQQTIWL  375



>ref|XP_008200760.1| PREDICTED: histone-arginine methyltransferase CARMER isoform 
X4 [Tribolium castaneum]
Length=568

 Score = 70.5 bits (171),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L QPL +  GQ +TGR+ LVA+K QSY + + L+ +  +  QSS   L
Sbjct  381  EPLTHWYQVRCLLEQPLLLKQGQVLTGRVLLVANKRQSYDVTIDLAVEGTN--QSSKNTL  438

Query  393  DLKEPYYR  370
            DLK PY+R
Sbjct  439  DLKNPYFR  446


 Score = 26.2 bits (56),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS    WL
Sbjct  357  GLAFWFDVAFAGSQQTIWL  375



>ref|XP_001995856.1| GH14177 [Drosophila grimshawi]
 sp|B4JXV2.1|CARM1_DROGR RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
grimshawi]
 gb|EDV90514.1| GH14177 [Drosophila grimshawi]
Length=544

 Score = 67.4 bits (163),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  415  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  472

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  473  LKNPYFR  479


 Score = 29.3 bits (64),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GST   WL
Sbjct  390  GLAFWFDVEFSGSTQNVWL  408



>ref|XP_002500316.1| protein arginine methyltransferase [Micromonas sp. RCC299]
 gb|ACO61574.1| protein arginine methyltransferase [Micromonas sp. RCC299]
Length=451

 Score = 61.6 bits (148),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+R V  +P+    G+ + GR+K+ A   QSY + + L  + G   ++ +G+ D
Sbjct  365  PTTHWYQMRLVFERPMRCEAGETVKGRMKMTALDNQSYAVTVELKGKGG---KAVSGEWD  421

Query  390  LKEPYYR  370
            LK+PYYR
Sbjct  422  LKDPYYR  428


 Score = 35.0 bits (79),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            G+ACWFDVLF G+   RWL
Sbjct  340  GVACWFDVLFEGTAKSRWL  358



>ref|XP_004926170.1| PREDICTED: histone-arginine methyltransferase CARMER-like [Bombyx 
mori]
Length=531

 Score = 67.4 bits (163),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P++   GQ +TGR+ L+A+K QSY + + ++ +  ++  SS+  LD
Sbjct  384  PLTHWYQVRCLLETPIFAKQGQALTGRVLLLANKRQSYDVTMEVNLEGTNI--SSSNTLD  441

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  442  LKNPYFR  448


 Score = 29.3 bits (64),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDVLF G T   WL
Sbjct  359  GLAFWFDVLFAGGTQHIWL  377



>ref|XP_002428291.1| histone-arginine methyltransferase CARM1, putative [Pediculus 
humanus corporis]
 gb|EEB15553.1| histone-arginine methyltransferase CARM1, putative [Pediculus 
humanus corporis]
Length=593

 Score = 66.6 bits (161),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+V  G  + G + LVA+K QSY + + L     D++ S+T  LD
Sbjct  386  PLTHWYQVRCLFEDPLFVGSGDIVKGFVSLVANKRQSYDVTIQLQRVGSDIVASNT--LD  443

Query  390  LKEPYYRMS  364
            LK PY+R S
Sbjct  444  LKNPYFRYS  452


 Score = 29.3 bits (64),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDVLF+GS    WL
Sbjct  361  GLAFWFDVLFSGSGKNIWL  379



>ref|XP_001953607.1| GF17144 [Drosophila ananassae]
 sp|B3M1E1.1|CARM1_DROAN RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
ananassae]
 gb|EDV42168.1| GF17144 [Drosophila ananassae]
Length=531

 Score = 67.4 bits (163),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  406  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  463

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  464  LKNPYFR  470


 Score = 28.5 bits (62),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+G+T   WL
Sbjct  381  GLAFWFDVEFSGTTQNVWL  399



>ref|XP_002001237.1| GI22087 [Drosophila mojavensis]
 sp|B4KA23.1|CARM1_DROMO RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
mojavensis]
 gb|EDW16698.1| GI22087 [Drosophila mojavensis]
Length=539

 Score = 67.4 bits (163),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  414  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  471

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  472  LKNPYFR  478


 Score = 28.1 bits (61),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS+   WL
Sbjct  389  GLAFWFDVEFSGSSQNVWL  407



>ref|XP_002054013.1| GJ24202 [Drosophila virilis]
 sp|B4LVS8.1|CARM1_DROVI RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
virilis]
 gb|EDW67533.1| GJ24202 [Drosophila virilis]
Length=538

 Score = 67.4 bits (163),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  413  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  470

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  471  LKNPYFR  477


 Score = 28.1 bits (61),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS+   WL
Sbjct  388  GLAFWFDVEFSGSSQNVWL  406



>ref|XP_001980730.1| GG17314 [Drosophila erecta]
 sp|B3P4N5.1|CARM1_DROER RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
erecta]
 gb|EDV49688.1| GG17314 [Drosophila erecta]
Length=530

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  406  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  463

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  464  LKNPYFR  470


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS+   WL
Sbjct  381  GLAFWFDVEFSGSSQNVWL  399



>ref|XP_002104043.1| GD20747 [Drosophila simulans]
 sp|B4QVW6.1|CARM1_DROSI RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
simulans]
 gb|EDX13546.1| GD20747 [Drosophila simulans]
Length=530

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  406  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  463

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  464  LKNPYFR  470


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS+   WL
Sbjct  381  GLAFWFDVEFSGSSQNVWL  399



>ref|XP_002097037.1| GE24716 [Drosophila yakuba]
 sp|B4PVH6.1|CARM1_DROYA RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
yakuba]
 gb|EDW96749.1| GE24716 [Drosophila yakuba]
Length=530

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  406  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  463

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  464  LKNPYFR  470


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS+   WL
Sbjct  381  GLAFWFDVEFSGSSQNVWL  399



>ref|NP_649963.1| arginine methyltransferase 4, isoform A [Drosophila melanogaster]
 ref|NP_001262445.1| arginine methyltransferase 4, isoform B [Drosophila melanogaster]
 sp|Q9VH48.1|CARM1_DROME RecName: Full=Probable histone-arginine methyltransferase CARMER; 
AltName: Full=Coactivator arginine methyltransferase for 
EcR/Usp; AltName: Full=Protein arginine N-methyltransferase 
4; Short=DART4 [Drosophila melanogaster]
 gb|AAF54471.1| arginine methyltransferase 4, isoform A [Drosophila melanogaster]
 gb|ADY17722.1| FI04404p [Drosophila melanogaster]
 gb|AGB95827.1| arginine methyltransferase 4, isoform B [Drosophila melanogaster]
Length=530

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  406  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  463

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  464  LKNPYFR  470


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS+   WL
Sbjct  381  GLAFWFDVEFSGSSQNVWL  399



>ref|XP_002031806.1| GM26200 [Drosophila sechellia]
 sp|B4HJC0.1|CARM1_DROSE RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
sechellia]
 gb|EDW42792.1| GM26200 [Drosophila sechellia]
Length=530

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  406  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  463

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  464  LKNPYFR  470


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS+   WL
Sbjct  381  GLAFWFDVEFSGSSQNVWL  399



>gb|AAO45207.1| RE68504p [Drosophila melanogaster]
Length=530

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  406  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  463

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  464  LKNPYFR  470


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS+   WL
Sbjct  381  GLAFWFDVEFSGSSQNVWL  399



>ref|XP_001357999.1| GA18823 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002023835.1| GL27288 [Drosophila persimilis]
 sp|Q29B63.1|CARM1_DROPS RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
pseudoobscura pseudoobscura]
 sp|B4GZ20.1|CARM1_DROPE RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
persimilis]
 gb|EAL27136.1| GA18823 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW28038.1| GL27288 [Drosophila persimilis]
Length=531

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  406  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  463

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  464  LKNPYFR  470


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS+   WL
Sbjct  381  GLAFWFDVEFSGSSQNVWL  399



>ref|XP_002074175.1| GK14504 [Drosophila willistoni]
 sp|B4NKI9.1|CARM1_DROWI RecName: Full=Histone-arginine methyltransferase CARMER [Drosophila 
willistoni]
 gb|EDW85161.1| GK14504 [Drosophila willistoni]
Length=533

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  408  PLTHWYQVRCLLPMPIFIKQGQTLTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  465

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  466  LKNPYFR  472


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS+   WL
Sbjct  383  GLAFWFDVEFSGSSQNVWL  401



>ref|XP_011199153.1| PREDICTED: histone-arginine methyltransferase CARMER [Bactrocera 
dorsalis]
Length=568

 Score = 67.0 bits (162),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  442  PLTHWYQVRCLLPMPIFIKQGQLLTGRVLLEANRRQSYDV--TIDLHIDGTLISSSNTLD  499

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  500  LKNPYFR  506


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS+ Q WL
Sbjct  417  GLAFWFDVEFCGSSQQVWL  435



>ref|XP_005191609.1| PREDICTED: histone-arginine methyltransferase CARMER [Musca domestica]
Length=561

 Score = 66.6 bits (161),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  436  PLTHWYQVRCLLPMPIFIKQGQILTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  493

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  494  LKNPYFR  500


 Score = 28.1 bits (61),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS+ Q WL
Sbjct  411  GLAFWFDVEFCGSSQQVWL  429



>ref|XP_004529208.1| PREDICTED: histone-arginine methyltransferase CARMER-like [Ceratitis 
capitata]
Length=570

 Score = 67.0 bits (162),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  444  PLTHWYQVRCLLPMPIFIKQGQILTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  501

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  502  LKNPYFR  508


 Score = 27.3 bits (59),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS  Q WL
Sbjct  419  GLAFWFDVEFCGSNQQVWL  437



>gb|ETN64413.1| histone-arginine methyltransferase CARM1 [Anopheles darlingi]
Length=667

 Score = 63.5 bits (153),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = -2

Query  561  HWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLDLKE  382
            HWYQ+RC+L  P++V  GQ ++G++ L A++ QSY + + L  + G M+ SS   LDLK 
Sbjct  408  HWYQVRCLLQTPIFVKQGQVLSGKVVLAANQRQSYDVEIDLKLE-GTMITSSN-TLDLKN  465

Query  381  PYYR  370
            PY+R
Sbjct  466  PYFR  469


 Score = 30.8 bits (68),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS  Q WL
Sbjct  380  GLAFWFDVEFAGSCSQIWL  398



>ref|XP_011184873.1| PREDICTED: histone-arginine methyltransferase CARMER [Bactrocera 
cucurbitae]
 ref|XP_011184875.1| PREDICTED: histone-arginine methyltransferase CARMER [Bactrocera 
cucurbitae]
 ref|XP_011184876.1| PREDICTED: histone-arginine methyltransferase CARMER [Bactrocera 
cucurbitae]
 ref|XP_011184877.1| PREDICTED: histone-arginine methyltransferase CARMER [Bactrocera 
cucurbitae]
Length=568

 Score = 66.6 bits (161),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+++  GQ +TGR+ L A++ QSY +  T+   +   L SS+  LD
Sbjct  442  PLTHWYQVRCLLPMPIFIKQGQILTGRVLLEANRRQSYDV--TIDLHIEGTLISSSNTLD  499

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  500  LKNPYFR  506


 Score = 27.3 bits (59),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS  Q WL
Sbjct  417  GLAFWFDVEFCGSNQQVWL  435



>gb|ELK26820.1| Pumilio domain-containing protein KIAA0020 [Myotis davidii]
Length=927

 Score = 63.2 bits (152),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G+ ++GR+  VA+K QSY I +   A V      S   LD
Sbjct  263  PLTHWYQVRCLLQTPLFAKEGETLSGRVLFVANKRQSYDIQIV--ALVNQTGFRSGNILD  320

Query  390  LKEPYYRMS  364
            LK P++R+S
Sbjct  321  LKNPFFRVS  329


 Score = 30.8 bits (68),  Expect(2) = 8e-11, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS V  WL
Sbjct  238  GLAFWFDVAFVGSLVTVWL  256



>gb|KFB35345.1| AGAP003923-PA-like protein [Anopheles sinensis]
Length=645

 Score = 65.1 bits (157),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P++V  GQ ++G++ L A++ QSY + + L  + G M+ SS+  LD
Sbjct  390  PLTHWYQVRCLLQTPIFVKQGQVLSGKVVLAANQRQSYDVEIDLKLE-GTMI-SSSNTLD  447

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  448  LKNPYFR  454


 Score = 28.5 bits (62),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS  Q WL
Sbjct  365  GLAFWFDVEFGGSCAQIWL  383



>ref|XP_010007679.1| PREDICTED: histone-arginine methyltransferase CARM1, partial 
[Nestor notabilis]
Length=252

 Score = 65.9 bits (159),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+V  G+ ++G++ LVA+K QSY I++   A V +    S+  LD
Sbjct  188  PLTHWYQVRCLLQTPLFVKEGESLSGKVLLVANKRQSYDIHIV--AMVDETGIKSSNTLD  245

Query  390  LKEPYYR  370
            LK P +R
Sbjct  246  LKNPIFR  252


 Score = 27.7 bits (60),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS V  WL
Sbjct  163  GLAFWFDVAFVGSLVTVWL  181



>ref|XP_003388033.1| PREDICTED: histone-arginine methyltransferase CARMER-like [Amphimedon 
queenslandica]
Length=606

 Score = 63.2 bits (152),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RCVL  PL+V  GQE+ G + + A++ QSY I + ++  VG   Q S    D
Sbjct  411  PVTHWYQVRCVLKTPLFVSAGQELAGVINMKANERQSYDIEMEINV-VGTS-QVSKCHYD  468

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  469  LKNPYFR  475


 Score = 30.0 bits (66),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV FNGS+   WL
Sbjct  386  GLAFWFDVSFNGSSQTVWL  404



>gb|EFX85598.1| hypothetical protein DAPPUDRAFT_193775 [Daphnia pulex]
Length=608

 Score = 65.9 bits (159),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = -2

Query  576  VHPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGK  397
              P  HWYQ+RC+L  P++V  GQ +TG + L+A+K QSY + + L  +   +  S+T  
Sbjct  384  TEPLTHWYQVRCLLETPIFVKQGQLLTGTVLLLANKRQSYDVTIDLRVEGSGLTSSNT--  441

Query  396  LDLKEPYYR  370
            LDLK PY+R
Sbjct  442  LDLKNPYFR  450


 Score = 27.3 bits (59),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS+   WL
Sbjct  361  GLAFWFDVAFFGSSTSVWL  379



>ref|XP_005155168.1| PREDICTED: histone-arginine methyltransferase CARM1-like [Melopsittacus 
undulatus]
Length=458

 Score = 65.5 bits (158),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+V  G+ ++G++ LVA+K QSY I++   A V +    S+  LD
Sbjct  394  PLTHWYQVRCLLQTPLFVKEGESLSGKVLLVANKRQSYDIHIV--AMVDETGIKSSNILD  451

Query  390  LKEPYYR  370
            LK P +R
Sbjct  452  LKNPVFR  458


 Score = 27.3 bits (59),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS V  WL
Sbjct  369  GLAFWFDVAFVGSLVTVWL  387



>emb|CAG05964.1| unnamed protein product [Tetraodon nigroviridis]
Length=538

 Score = 65.5 bits (158),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  ++G   LVA++ QSY I  ++ AQV      S+  LD
Sbjct  369  PLTHWYQVRCLLQSPLFTKAGDTLSGTALLVANRRQSYDI--SIVAQVDQTGSKSSNLLD  426

Query  390  LKEPYYRMSQPQSYSA  343
            LK P++ MSQ  + S 
Sbjct  427  LKNPFFSMSQGMAVSG  442


 Score = 26.9 bits (58),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  344  GLAFWFDVAFMGSAMTIWL  362



>gb|AEG90855.1| histone-arginine methyltransferase CARMER [Apostichopus japonicus]
Length=165

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PLYV  GQ++TG++ L+A+K QSY I + L      +   ST +LD
Sbjct  21   PLTHWYQVRCLLRSPLYVKQGQKLTGKVVLIANKRQSYDIDIELECPRSGV--RSTNRLD  78

Query  390  LKEPYYRMS  364
            LK P++  S
Sbjct  79   LKNPFFHYS  87



>gb|EPQ12832.1| Pumilio domain-containing protein KIAA0020 [Myotis brandtii]
Length=1151

 Score = 61.6 bits (148),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = -2

Query  573  HPQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKL  394
             P  HWYQ+RC+L  PL+   G+ ++GR+  VA+K QSY I +   A V      S   L
Sbjct  597  EPLTHWYQVRCLLQTPLFAKEGETLSGRVLFVANKRQSYDIQIV--ALVNQTGFRSGNIL  654

Query  393  DLKEPYYRMS  364
            DLK P++R++
Sbjct  655  DLKNPFFRVA  664


 Score = 30.8 bits (68),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS V  WL
Sbjct  573  GLAFWFDVAFVGSLVTVWL  591



>ref|XP_006627327.1| PREDICTED: histone-arginine methyltransferase CARM1-like [Lepisosteus 
oculatus]
Length=456

 Score = 64.3 bits (155),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G+ +TG++ LVA+K QSY I++  + +       S   LD
Sbjct  392  PLTHWYQVRCLLKTPLFARAGETLTGKVLLVANKRQSYDIHIAATVEQSGF--KSGNVLD  449

Query  390  LKEPYYR  370
            LK P++R
Sbjct  450  LKNPFFR  456


 Score = 27.7 bits (60),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS V  WL
Sbjct  367  GLAFWFDVAFVGSQVTVWL  385



>ref|XP_787264.3| PREDICTED: histone-arginine methyltransferase CARM1, partial 
[Strongylocentrotus purpuratus]
Length=542

 Score = 64.7 bits (156),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P+YV  GQ +TG++ L+A+  QSY I L L +   ++   ST +LD
Sbjct  298  PLTHWYQVRCLLRSPMYVTKGQRLTGKVILIANARQSYDIDLELESPGSEV--KSTNRLD  355

Query  390  LKEPYYRMSQPQ  355
            LK P +  +  Q
Sbjct  356  LKNPLFHYTGQQ  367


 Score = 27.3 bits (59),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F+GS    WL
Sbjct  273  GLAFWFDVAFHGSLQSVWL  291



>ref|XP_001652238.1| AAEL006782-PA [Aedes aegypti]
 sp|Q174R2.1|CARM1_AEDAE RecName: Full=Histone-arginine methyltransferase CARMER [Aedes 
aegypti]
 gb|EAT41589.1| AAEL006782-PA [Aedes aegypti]
Length=593

 Score = 64.3 bits (155),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = -2

Query  561  HWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLDLKE  382
            HWYQ+RC+L  P++V  GQ ++G++ L A++ QSY + + L  + G M+ +ST  LDLK 
Sbjct  390  HWYQVRCLLQTPIFVKQGQVLSGKVVLAANQRQSYDVEMDLKLE-GTMI-TSTNTLDLKN  447

Query  381  PYYR  370
            PY+R
Sbjct  448  PYFR  451


 Score = 27.7 bits (60),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS  Q WL
Sbjct  362  GLAFWFDVEFAGSCSQVWL  380



>ref|XP_010870939.1| PREDICTED: histone-arginine methyltransferase CARM1-like [Esox 
lucius]
Length=574

 Score = 63.5 bits (153),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  385  PLTHWYQVRCLLQSPLFTKAGDTLSGTATLIANKRQSYDI--SMVAQVDQTGSKSSNLLD  442

Query  390  LKEPYYR  370
            LK P++R
Sbjct  443  LKNPFFR  449


 Score = 28.1 bits (61),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS V  WL
Sbjct  360  GLAFWFDVAFIGSAVTVWL  378



>ref|XP_318375.4| AGAP003923-PA [Anopheles gambiae str. PEST]
 sp|Q7Q2B7.5|CARM1_ANOGA RecName: Full=Histone-arginine methyltransferase CARMER; AltName: 
Full=Coactivator-associated arginine methyltransferase 
1; Short=AgCARM1 [Anopheles gambiae]
 gb|ACJ24894.1| coactivator associated arginine methyltransferase 1 [Anopheles 
gambiae]
 gb|EAA13615.4| AGAP003923-PA [Anopheles gambiae str. PEST]
Length=622

 Score = 64.7 bits (156),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  P++V  GQ ++G++ L A++ QSY + + L  + G M+ SS+  LD
Sbjct  383  PLTHWYQVRCLLQTPIFVKQGQVLSGKVVLAANQRQSYDVEIDLKLE-GTMI-SSSNTLD  440

Query  390  LKEPYYR  370
            LK PY+R
Sbjct  441  LKNPYFR  447


 Score = 26.2 bits (56),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F G+  Q WL
Sbjct  358  GLAFWFDVEFAGTCSQIWL  376



>ref|XP_007255104.1| PREDICTED: histone-arginine methyltransferase CARM1-like [Astyanax 
mexicanus]
Length=456

 Score = 64.7 bits (156),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY I++T  A V +    S   LD
Sbjct  392  PLSHWYQVRCLLQTPLFAKMGQTLSGQVLLIANKRQSYDIHIT--AVVDESGFKSGNTLD  449

Query  390  LKEPYYR  370
            LK P++R
Sbjct  450  LKNPFFR  456


 Score = 26.2 bits (56),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  367  GLAFWFDVAFVGSRMTVWL  385



>gb|EMP39509.1| Histone-arginine methyltransferase CARM1 [Chelonia mydas]
Length=705

 Score = 61.2 bits (147),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  500  PLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  557

Query  390  LKEPYYR  370
            LK P++R
Sbjct  558  LKNPFFR  564


 Score = 29.3 bits (64),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  475  GLAFWFDVAFIGSMMTVWL  493



>ref|XP_009303380.1| PREDICTED: histone-arginine methyltransferase CARM1 isoform X2 
[Danio rerio]
Length=449

 Score = 63.9 bits (154),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   GQ ++G + L+A+K QSY I+  +SA V      S   LD
Sbjct  383  PLTHWYQVRCLLQTPLFAKMGQTLSGHVHLIANKRQSYDIH--ISAVVDQSGFKSGNSLD  440

Query  390  LKEPYYR  370
            LK P++R
Sbjct  441  LKNPFFR  447


 Score = 26.6 bits (57),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  358  GLAFWFDVAFVGSKMTIWL  376



>ref|XP_009303379.1| PREDICTED: histone-arginine methyltransferase CARM1 isoform X1 
[Danio rerio]
Length=450

 Score = 63.9 bits (154),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   GQ ++G + L+A+K QSY I+  +SA V      S   LD
Sbjct  384  PLTHWYQVRCLLQTPLFAKMGQTLSGHVHLIANKRQSYDIH--ISAVVDQSGFKSGNSLD  441

Query  390  LKEPYYR  370
            LK P++R
Sbjct  442  LKNPFFR  448


 Score = 26.6 bits (57),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  359  GLAFWFDVAFVGSKMTIWL  377



>ref|XP_006898910.1| PREDICTED: histone-arginine methyltransferase CARM1 [Elephantulus 
edwardii]
Length=828

 Score = 60.8 bits (146),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  631  PLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  688

Query  390  LKEPYYR  370
            LK P++R
Sbjct  689  LKNPFFR  695


 Score = 29.3 bits (64),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  606  GLAFWFDVAFIGSIMTVWL  624



>ref|XP_004277727.1| PREDICTED: histone-arginine methyltransferase CARM1 [Orcinus 
orca]
Length=671

 Score = 60.8 bits (146),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  474  PLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  531

Query  390  LKEPYYR  370
            LK P++R
Sbjct  532  LKNPFFR  538


 Score = 29.3 bits (64),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  449  GLAFWFDVAFIGSIMTVWL  467



>ref|XP_007575674.1| PREDICTED: histone-arginine methyltransferase CARM1 isoform X2 
[Poecilia formosa]
Length=454

 Score = 63.5 bits (153),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  ++G   LVA+K QSY I  ++ AQV      S+  LD
Sbjct  385  PLTHWYQVRCLLQSPLFAKAGDTLSGTAMLVANKRQSYDI--SIVAQVDQTGSKSSNLLD  442

Query  390  LKEPYYR  370
            LK P++R
Sbjct  443  LKNPFFR  449


 Score = 26.9 bits (58),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  360  GLAFWFDVAFMGSVMTVWL  378



>ref|XP_006014686.1| PREDICTED: LOW QUALITY PROTEIN: coactivator-associated arginine 
methyltransferase 1 [Latimeria chalumnae]
Length=584

 Score = 63.5 bits (153),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  ++G + L+A+K QSY I  ++ AQV      S+  LD
Sbjct  385  PLTHWYQVRCLLQSPLFAKAGDSLSGTVLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  442

Query  390  LKEPYYR  370
            LK P++R
Sbjct  443  LKNPFFR  449


 Score = 26.6 bits (57),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  360  GLAFWFDVAFIGSAMTVWL  378



>ref|NP_001244042.1| protein arginine methyltransferase [Ictalurus punctatus]
 gb|AEU08946.1| protein arginine methyltransferase [Ictalurus punctatus]
Length=458

 Score = 64.3 bits (155),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   GQ ++G++ L+A+K QSY I++T  A + +    S   LD
Sbjct  392  PLSHWYQVRCLLQTPLFAKIGQTLSGQVLLIANKRQSYDIHIT--AVIDESGFKSGNTLD  449

Query  390  LKEPYYR  370
            LK P++R
Sbjct  450  LKNPFFR  456


 Score = 26.2 bits (56),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS    WL
Sbjct  367  GLAFWFDVAFVGSRTTVWL  385



>gb|ELK17830.1| Histone-arginine methyltransferase CARM1 [Pteropus alecto]
Length=715

 Score = 60.8 bits (146),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  518  PLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  575

Query  390  LKEPYYR  370
            LK P++R
Sbjct  576  LKNPFFR  582


 Score = 29.3 bits (64),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  493  GLAFWFDVAFIGSIMTVWL  511



>sp|Q4AE70.1|CARM1_RAT RecName: Full=Histone-arginine methyltransferase CARM1; AltName: 
Full=Coactivator-associated arginine methyltransferase 1; 
AltName: Full=Protein arginine N-methyltransferase 4 [Rattus 
norvegicus]
 dbj|BAE16334.1| coactivator-associated arginine methyltransferase 1 variant 2 
[Rattus norvegicus]
Length=651

 Score = 60.8 bits (146),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  412  PLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  469

Query  390  LKEPYYR  370
            LK P++R
Sbjct  470  LKNPFFR  476


 Score = 29.3 bits (64),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  387  GLAFWFDVAFIGSIMTVWL  405



>ref|XP_007993452.1| PREDICTED: histone-arginine methyltransferase CARM1, partial 
[Chlorocebus sabaeus]
Length=688

 Score = 60.8 bits (146),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  491  PLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  548

Query  390  LKEPYYR  370
            LK P++R
Sbjct  549  LKNPFFR  555


 Score = 29.3 bits (64),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  466  GLAFWFDVAFIGSIMTVWL  484



>ref|XP_002114349.1| hypothetical protein TRIADDRAFT_1535 [Trichoplax adhaerens]
 gb|EDV23439.1| hypothetical protein TRIADDRAFT_1535, partial [Trichoplax adhaerens]
Length=364

 Score = 62.8 bits (151),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 10/78 (13%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQS----ST  403
            P  HWYQ+RC+   PL+V  G  ITG + +VA+  QSY +      ++  +LQS    + 
Sbjct  277  PLTHWYQVRCLFRSPLFVRAGDVITGHISMVANTRQSYDV------EIMTVLQSTGVKTV  330

Query  402  GKLDLKEPYYRMSQPQSY  349
             ++DLK PY+R S  Q Y
Sbjct  331  AEVDLKNPYFRYSLGQPY  348


 Score = 27.3 bits (59),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS    WL
Sbjct  252  GLAFWFDVEFAGSATSIWL  270



>ref|XP_003413416.1| PREDICTED: histone-arginine methyltransferase CARM1 [Loxodonta 
africana]
Length=718

 Score = 60.8 bits (146),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  521  PLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  578

Query  390  LKEPYYR  370
            LK P++R
Sbjct  579  LKNPFFR  585


 Score = 29.3 bits (64),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  496  GLAFWFDVAFIGSIMTVWL  514



>ref|XP_007575673.1| PREDICTED: histone-arginine methyltransferase CARM1 isoform X1 
[Poecilia formosa]
Length=581

 Score = 63.2 bits (152),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  ++G   LVA+K QSY I  ++ AQV      S+  LD
Sbjct  385  PLTHWYQVRCLLQSPLFAKAGDTLSGTAMLVANKRQSYDI--SIVAQVDQTGSKSSNLLD  442

Query  390  LKEPYYR  370
            LK P++R
Sbjct  443  LKNPFFR  449


 Score = 26.9 bits (58),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  360  GLAFWFDVAFMGSVMTVWL  378



>ref|XP_002942888.1| PREDICTED: histone-arginine methyltransferase CARM1 isoformX2 
[Xenopus (Silurana) tropicalis]
Length=577

 Score = 63.9 bits (154),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  +TG   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  382  PLTHWYQVRCLLQSPLFTKAGDTLTGTALLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  439

Query  390  LKEPYYR  370
            LK P++R
Sbjct  440  LKNPFFR  446


 Score = 26.2 bits (56),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  357  GLAFWFDVAFIGSIMTVWL  375



>ref|XP_004918927.1| PREDICTED: histone-arginine methyltransferase CARM1 isoform X4 
[Xenopus (Silurana) tropicalis]
Length=606

 Score = 63.9 bits (154),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  +TG   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  411  PLTHWYQVRCLLQSPLFTKAGDTLTGTALLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  468

Query  390  LKEPYYR  370
            LK P++R
Sbjct  469  LKNPFFR  475


 Score = 26.2 bits (56),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  386  GLAFWFDVAFIGSIMTVWL  404



>gb|ABK56015.1| coactivator-associated arginine methyltransferase 1-a [Xenopus 
laevis]
Length=577

 Score = 63.9 bits (154),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  +TG   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  382  PLTHWYQVRCLLQSPLFTKAGDTLTGTALLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  439

Query  390  LKEPYYR  370
            LK P++R
Sbjct  440  LKNPFFR  446


 Score = 26.2 bits (56),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  357  GLAFWFDVAFIGSIMTVWL  375



>ref|XP_004442736.1| PREDICTED: histone-arginine methyltransferase CARM1 [Ceratotherium 
simum simum]
Length=977

 Score = 60.5 bits (145),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  665  PLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  722

Query  390  LKEPYYR  370
            LK P++R
Sbjct  723  LKNPFFR  729


 Score = 29.3 bits (64),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  640  GLAFWFDVAFIGSIMTVWL  658



>ref|XP_008413288.1| PREDICTED: histone-arginine methyltransferase CARM1 [Poecilia 
reticulata]
Length=582

 Score = 63.2 bits (152),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  ++G   LVA+K QSY I  ++ AQV      S+  LD
Sbjct  385  PLTHWYQVRCLLQSPLFAKAGDTLSGTAMLVANKRQSYDI--SIVAQVDQTGSKSSNLLD  442

Query  390  LKEPYYR  370
            LK P++R
Sbjct  443  LKNPFFR  449


 Score = 26.9 bits (58),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  360  GLAFWFDVAFMGSVMTVWL  378



>ref|XP_005347502.1| PREDICTED: histone-arginine methyltransferase CARM1 [Microtus 
ochrogaster]
Length=812

 Score = 60.5 bits (145),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  616  PLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  673

Query  390  LKEPYYR  370
            LK P++R
Sbjct  674  LKNPFFR  680


 Score = 29.3 bits (64),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  591  GLAFWFDVAFIGSIMTVWL  609



>ref|NP_001108248.1| coactivator-associated arginine methyltransferase 1-b [Xenopus 
laevis]
 gb|ABK56016.1| coactivator-associated arginine methyltransferase 1-b [Xenopus 
laevis]
Length=602

 Score = 63.5 bits (153),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  +TG   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  382  PLTHWYQVRCLLQSPLFTKAGDTLTGTALLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  439

Query  390  LKEPYYR  370
            LK P++R
Sbjct  440  LKNPFFR  446


 Score = 26.2 bits (56),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  357  GLAFWFDVAFIGSIMTVWL  375



>ref|XP_005811778.1| PREDICTED: histone-arginine methyltransferase CARM1-like [Xiphophorus 
maculatus]
Length=587

 Score = 63.2 bits (152),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G  ++G   LVA+K QSY I  ++ AQV      S+  LD
Sbjct  385  PLTHWYQVRCLLQSPLFAKAGDTLSGTAMLVANKRQSYDI--SIVAQVDQTGSKSSNLLD  442

Query  390  LKEPYYR  370
            LK P++R
Sbjct  443  LKNPFFR  449


 Score = 26.9 bits (58),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  360  GLAFWFDVAFMGSVMTVWL  378



>ref|XP_010991569.1| PREDICTED: histone-arginine methyltransferase CARM1-like [Camelus 
dromedarius]
Length=394

 Score = 62.4 bits (150),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+L  PL+   G+ ++GR+  VA+K QSY I +   A V      S   LD
Sbjct  328  PLTHWYQVRCLLQTPLFAKEGETLSGRVLFVANKRQSYDIQIV--ALVNQTGFRSGNTLD  385

Query  390  LKEPYYRMS  364
            LK P++R +
Sbjct  386  LKNPFFRFA  394


 Score = 27.3 bits (59),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS V  WL
Sbjct  303  GLAFWFDVAFVGSLVTVWL  321



>gb|EQB78378.1| histone-arginine methyltransferase CARM1 [Camelus ferus]
Length=756

 Score = 60.5 bits (145),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = -2

Query  570  PQPHWYQLRCVLSQPLYVMPGQEITGRLKLVAHKAQSYTIYLTLSAQVGDMLQSSTGKLD  391
            P  HWYQ+RC+   PL+   G  ++G   L+A+K QSY I  ++ AQV      S+  LD
Sbjct  559  PLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDI--SIVAQVDQTGSKSSNLLD  616

Query  390  LKEPYYR  370
            LK P++R
Sbjct  617  LKNPFFR  623


 Score = 29.3 bits (64),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -1

Query  646  GLACWFDVLFNGSTVQRWL  590
            GLA WFDV F GS +  WL
Sbjct  534  GLAFWFDVAFIGSIMTVWL  552



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000