BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF021A22

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACU17965.1|  unknown                                                 269   4e-87   Glycine max [soybeans]
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    279   3e-86   Solanum lycopersicum
gb|AAB42159.1|  Hsc70                                                   276   7e-85   Solanum lycopersicum
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    276   8e-85   Nicotiana sylvestris
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    275   2e-84   Solanum lycopersicum
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    274   3e-84   Nicotiana tomentosiformis
gb|KHN48981.1|  Heat shock cognate 70 kDa protein                       271   1e-83   Glycine soja [wild soybean]
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    272   2e-83   Tarenaya hassleriana [spider flower]
ref|XP_006574857.1|  PREDICTED: heat shock cognate 70 kDa protein...    270   2e-83   Glycine max [soybeans]
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        272   2e-83   Morus notabilis
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     271   6e-83   Glycine soja [wild soybean]
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    271   6e-83   Glycine max [soybeans]
gb|KDO36486.1|  hypothetical protein CISIN_1g020168mg                   261   8e-83   Citrus sinensis [apfelsine]
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     270   9e-83   Glycine soja [wild soybean]
gb|ACA23466.1|  heat shock protein 70                                   255   1e-82   Arachis diogoi
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         270   1e-82   Jatropha curcas
ref|XP_010042813.1|  PREDICTED: probable mediator of RNA polymera...    263   3e-82   Eucalyptus grandis [rose gum]
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    269   3e-82   Nelumbo nucifera [Indian lotus]
gb|EAY81899.1|  hypothetical protein OsI_37065                          261   1e-81   Oryza sativa Indica Group [Indian rice]
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             266   3e-81   Phaseolus vulgaris [French bean]
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         266   4e-81   Jatropha curcas
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     266   4e-81   Nelumbo nucifera [Indian lotus]
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    266   5e-81   Solanum tuberosum [potatoes]
emb|CCJ09763.1|  putative heat shock protein-70kDa                      253   5e-81   Hirudo medicinalis
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                266   5e-81   Erythranthe guttata [common monkey flower]
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    265   9e-81   Phoenix dactylifera
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    265   1e-80   Cicer arietinum [garbanzo]
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             265   1e-80   Phaseolus vulgaris [French bean]
gb|AAA82974.1|  HSP70b                                                  249   1e-80   Pisum sativum [garden pea]
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    265   1e-80   Glycine max [soybeans]
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    264   2e-80   Fragaria vesca subsp. vesca
gb|ABG22609.1|  Heat shock cognate 70 kDa protein, putative, expr...    261   2e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     264   2e-80   Elaeis guineensis
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     263   3e-80   
ref|XP_002316294.1|  heat shock protein 70                              263   3e-80   Populus trichocarpa [western balsam poplar]
gb|ACJ11741.1|  heat shock protein 70                                   263   4e-80   Gossypium hirsutum [American cotton]
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    263   4e-80   Populus euphratica
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    263   5e-80   Phoenix dactylifera
gb|AAB65162.1|  heat shock cognate protein                              254   5e-80   Solanum commersonii
gb|ABG22608.1|  Heat shock cognate 70 kDa protein, putative, expr...    262   5e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006378714.1|  heat shock protein 70 cognate                      263   7e-80   Populus trichocarpa [western balsam poplar]
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             263   7e-80   Arabidopsis lyrata subsp. lyrata
gb|KJB16979.1|  hypothetical protein B456_002G258500                    263   7e-80   Gossypium raimondii
gb|EAY98319.1|  hypothetical protein OsI_20227                          256   7e-80   Oryza sativa Indica Group [Indian rice]
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    263   7e-80   Populus euphratica
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             262   1e-79   Capsella rubella
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             262   1e-79   Citrus clementina [clementine]
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    262   1e-79   Citrus sinensis [apfelsine]
gb|EAZ19310.1|  hypothetical protein OsJ_34853                          261   1e-79   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA44672.1|  TPA: hsp70 protein                                     259   1e-79   
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     261   2e-79   
ref|XP_007009369.1|  Heat shock protein 70                              261   2e-79   
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    261   2e-79   Nicotiana sylvestris
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    261   2e-79   
gb|KHG00348.1|  Heat shock 70 kDa 4 -like protein                       259   2e-79   Gossypium arboreum [tree cotton]
gb|AEP40944.1|  heat shock protein 70 family protein                    248   2e-79   Posidonia oceanica
ref|NP_001068540.1|  Os11g0703900                                       261   2e-79   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    261   2e-79   Oryza brachyantha
gb|KJB73858.1|  hypothetical protein B456_011G256600                    261   2e-79   Gossypium raimondii
emb|CDP00073.1|  unnamed protein product                                261   3e-79   Coffea canephora [robusta coffee]
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       261   3e-79   Phaseolus vulgaris [French bean]
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     261   3e-79   Vigna radiata [mung bean]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             261   3e-79   Phaseolus vulgaris [French bean]
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    260   4e-79   Elaeis guineensis
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    260   5e-79   Fragaria vesca subsp. vesca
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     260   7e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          259   9e-79   
ref|XP_010911697.1|  PREDICTED: probable mediator of RNA polymera...    248   1e-78   Elaeis guineensis
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    259   1e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_187864.1|  heat shock protein 70-4                               259   1e-78   Arabidopsis thaliana [mouse-ear cress]
gb|ABD32895.1|  Heat shock protein Hsp70                                259   1e-78   Medicago truncatula
emb|CAA05547.1|  heat shock protein 70                                  259   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    259   1e-78   Camelina sativa [gold-of-pleasure]
emb|CAA47948.2|  heat shock protein 70                                  259   1e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_004492129.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   2e-78   
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     259   2e-78   Phoenix dactylifera
gb|KJB55903.1|  hypothetical protein B456_009G100400                    259   2e-78   Gossypium raimondii
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     258   3e-78   
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                258   3e-78   Zea mays [maize]
gb|AAP04522.1|  heat shock protein 70                                   258   3e-78   Nicotiana tabacum [American tobacco]
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          258   3e-78   Sorghum bicolor [broomcorn]
gb|AAR17080.1|  heat shock protein 70-3                                 258   3e-78   Nicotiana tabacum [American tobacco]
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                258   3e-78   
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    258   3e-78   Fragaria vesca subsp. vesca
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    258   4e-78   Tarenaya hassleriana [spider flower]
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    258   4e-78   Nicotiana tomentosiformis
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    258   6e-78   
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    258   6e-78   Solanum lycopersicum
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    257   7e-78   Camelina sativa [gold-of-pleasure]
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    257   8e-78   Cicer arietinum [garbanzo]
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    257   8e-78   Elaeis guineensis
gb|EAY89457.1|  hypothetical protein OsI_10990                          251   9e-78   Oryza sativa Indica Group [Indian rice]
ref|NP_001055754.1|  Os05g0460000                                       257   1e-77   
ref|NP_001049719.2|  Os03g0277300                                       250   1e-77   
ref|XP_003625487.1|  Heat shock protein                                 258   1e-77   
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   2e-77   Nicotiana tomentosiformis
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   2e-77   
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    256   2e-77   Camelina sativa [gold-of-pleasure]
gb|EMS50129.1|  Heat shock cognate 70 kDa protein 1                     258   2e-77   Triticum urartu
gb|EAY89450.1|  hypothetical protein OsI_10982                          250   2e-77   Oryza sativa Indica Group [Indian rice]
gb|AIU34470.1|  putative heat shock protein                             256   3e-77   Taraxacum brevicorniculatum
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    256   3e-77   
ref|XP_002311161.1|  heat shock protein 70                              256   3e-77   Populus trichocarpa [western balsam poplar]
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    256   3e-77   Pyrus x bretschneideri [bai li]
emb|CAA83548.1|  PsHSC71.0                                              255   4e-77   Pisum sativum [garden pea]
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     255   4e-77   Triticum urartu
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     255   5e-77   
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     255   5e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002528432.1|  heat shock protein, putative                       255   6e-77   Ricinus communis
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     254   8e-77   Brachypodium distachyon [annual false brome]
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     254   1e-76   Sesamum indicum [beniseed]
tpg|DAA55190.1|  TPA: heat shock protein70-4                            251   1e-76   
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    254   1e-76   Tarenaya hassleriana [spider flower]
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    254   1e-76   
gb|AAL85887.1|AF479058_1  70 kDa heat shock protein                     246   1e-76   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AEO13403.1|  heat shock 70                                           252   1e-76   Glycine max [soybeans]
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    254   1e-76   Setaria italica
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       254   1e-76   Cucumis melo [Oriental melon]
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    254   1e-76   Pyrus x bretschneideri [bai li]
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    254   1e-76   Fragaria vesca subsp. vesca
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    254   2e-76   Brachypodium distachyon [annual false brome]
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    254   2e-76   Sesamum indicum [beniseed]
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     253   2e-76   Fragaria vesca subsp. vesca
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     253   2e-76   
dbj|BAJ91305.1|  predicted protein                                      253   2e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002805956.1|  PREDICTED: heat shock cognate 70 kDa protein...    241   2e-76   
ref|XP_003621886.1|  Heat shock protein                                 253   2e-76   Medicago truncatula
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     253   3e-76   Vitis vinifera
ref|NP_001140835.1|  uncharacterized protein LOC100272911               251   3e-76   Zea mays [maize]
gb|AII99890.1|  heat shock protein                                      257   3e-76   Cicer arietinum [garbanzo]
gb|AAV98051.1|  heat shock protein 70                                   253   3e-76   Medicago sativa [alfalfa]
dbj|BAK00257.1|  predicted protein                                      253   3e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS68565.1|  hypothetical protein M569_06198                         253   3e-76   Genlisea aurea
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    253   3e-76   Sesamum indicum [beniseed]
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    253   3e-76   Solanum tuberosum [potatoes]
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     253   4e-76   Glycine max [soybeans]
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       253   4e-76   Glycine soja [wild soybean]
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     255   5e-76   Triticum urartu
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    252   5e-76   Prunus mume [ume]
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             252   6e-76   
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    252   6e-76   Arabis alpina [alpine rockcress]
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     252   6e-76   
ref|XP_004142750.1|  PREDICTED: heat shock cognate 70 kDa protein...    251   6e-76   
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    252   6e-76   Populus euphratica
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       252   7e-76   Cenchrus americanus [bulrush millet]
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    252   7e-76   Brachypodium distachyon [annual false brome]
dbj|BAA34919.1|  heat shock protein 70 cognate                          246   7e-76   Salix gilgiana
gb|AEO22185.1|  CytHSP70                                                249   8e-76   Triticum aestivum [Canadian hard winter wheat]
gb|AAK59628.2|  putative dnaK-type molecular chaperone hsc70.1 pr...    239   8e-76   Arabidopsis thaliana [mouse-ear cress]
emb|CAA67588.1|  70 kD heatshockprotein                                 239   8e-76   Medicago sativa [alfalfa]
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             252   8e-76   Prunus persica
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    252   9e-76   Cucumis sativus [cucumbers]
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     252   9e-76   Prunus mume [ume]
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    252   1e-75   
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    252   1e-75   Setaria italica
gb|AHW48175.1|  heat shock protein 70                                   249   1e-75   Triticum aestivum [Canadian hard winter wheat]
gb|ACJ85522.1|  unknown                                                 251   1e-75   Medicago truncatula
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    251   1e-75   Solanum lycopersicum
emb|CAA55183.1|  heat shock protein 70 kDa                              239   1e-75   Zea mays [maize]
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    251   1e-75   
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    251   1e-75   Populus euphratica
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    251   1e-75   Solanum tuberosum [potatoes]
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    251   2e-75   Glycine max [soybeans]
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    251   2e-75   Solanum lycopersicum
gb|ACJ54890.1|  heat shock protein 70                                   251   2e-75   Oryza sativa Japonica Group [Japonica rice]
emb|CCA29121.1|  heat shock protein 70 isoform 2                        251   2e-75   Solanum lycopersicum
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    251   2e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    251   2e-75   Zea mays [maize]
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    253   2e-75   
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    251   2e-75   
gb|ABP01597.1|  heat shock protein 70                                   241   2e-75   Ageratina adenophora
gb|KDO67650.1|  hypothetical protein CISIN_1g0212722mg                  238   2e-75   Citrus sinensis [apfelsine]
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    251   2e-75   Tarenaya hassleriana [spider flower]
emb|CDY40362.1|  BnaA10g27060D                                          246   2e-75   Brassica napus [oilseed rape]
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     251   3e-75   Vigna radiata [mung bean]
ref|NP_001049712.1|  Os03g0276500                                       250   3e-75   
gb|AGR45355.1|  HSP70                                                   250   3e-75   Dendrobium officinale
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     250   3e-75   Triticum urartu
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    247   3e-75   Populus euphratica
gb|AAB99745.1|  HSP70                                                   250   4e-75   Triticum aestivum [Canadian hard winter wheat]
gb|ACM42161.1|  heat shock protein 70.58                                250   5e-75   Ageratina adenophora
ref|XP_004156719.1|  PREDICTED: heat shock cognate 70 kDa protein...    248   5e-75   
gb|ACB70177.1|  70 kDa heat shock protein                               250   5e-75   Capparis spinosa [caper]
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    249   6e-75   Zea mays [maize]
gb|ACJ11745.1|  heat shock protein 70                                   249   1e-74   Gossypium hirsutum [American cotton]
gb|AAP42157.1|AF509339_1  heat shock protein 70                         243   1e-74   Saussurea medusa
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             249   1e-74   Citrus clementina [clementine]
dbj|BAJ86014.1|  predicted protein                                      249   1e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    249   1e-74   Cicer arietinum [garbanzo]
gb|ACJ11742.1|  heat shock protein 70                                   248   2e-74   Gossypium hirsutum [American cotton]
gb|KJB20110.1|  hypothetical protein B456_003G133400                    248   2e-74   Gossypium raimondii
gb|ABR13285.1|  putative dnaK-type molecular chaperone hsc70.1          234   2e-74   Prunus dulcis [sweet almond]
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     248   2e-74   Vitis vinifera
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         248   2e-74   Jatropha curcas
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     248   2e-74   Petunia x hybrida [garden petunia]
gb|EEC71767.1|  hypothetical protein OsI_04375                          242   2e-74   Oryza sativa Indica Group [Indian rice]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     250   2e-74   Eucalyptus grandis [rose gum]
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    248   2e-74   
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                248   2e-74   Erythranthe guttata [common monkey flower]
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             248   2e-74   Citrus clementina [clementine]
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    248   3e-74   Petunia x hybrida [garden petunia]
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     248   3e-74   Populus euphratica
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          248   3e-74   Amborella trichopoda
ref|XP_002527736.1|  heat shock protein, putative                       248   3e-74   Ricinus communis
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    248   3e-74   Pyrus x bretschneideri [bai li]
gb|AFU34347.1|  70-kDa heat shock protein                               248   3e-74   Ipomoea batatas [batate]
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    248   3e-74   
gb|ADZ46371.1|  HSP70                                                   248   3e-74   Malus hupehensis
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    248   3e-74   Brachypodium distachyon [annual false brome]
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     255   3e-74   
emb|CDP09040.1|  unnamed protein product                                248   3e-74   Coffea canephora [robusta coffee]
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             248   3e-74   Phaseolus vulgaris [French bean]
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    248   3e-74   Solanum tuberosum [potatoes]
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     248   3e-74   Vitis vinifera
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    248   4e-74   Cucumis melo [Oriental melon]
gb|ABP35942.1|  heat shock protein 70                                   248   4e-74   Cyclamen persicum
gb|AAB88009.1|  heat shock cognate protein HSC70                        247   4e-74   Brassica napus [oilseed rape]
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          248   4e-74   Sorghum bicolor [broomcorn]
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    247   4e-74   Setaria italica
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             247   5e-74   Populus trichocarpa [western balsam poplar]
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                247   5e-74   
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    246   5e-74   
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    247   5e-74   
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    247   5e-74   Phoenix dactylifera
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    247   6e-74   
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       247   6e-74   Solanum lycopersicum
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    247   6e-74   Brassica rapa
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     247   6e-74   Vigna radiata [mung bean]
emb|CDX73815.1|  BnaA03g32320D                                          247   7e-74   
emb|CAB72129.1|  heat shock protein 70                                  247   7e-74   Cucumis sativus [cucumbers]
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    247   7e-74   Solanum tuberosum [potatoes]
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     247   7e-74   Nicotiana sylvestris
ref|XP_002312089.1|  heat shock protein 70 cognate                      247   7e-74   
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    247   8e-74   Solanum tuberosum [potatoes]
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    246   8e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           246   9e-74   Cucurbita maxima [Boston marrow]
ref|XP_002312090.1|  heat shock protein 70 cognate                      246   9e-74   Populus trichocarpa [western balsam poplar]
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         246   9e-74   Jatropha curcas
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    246   1e-73   Brassica rapa
emb|CDY00784.1|  BnaC03g37680D                                          246   1e-73   
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       246   1e-73   Medicago truncatula
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    246   1e-73   Populus euphratica
gb|ACJ11740.1|  heat shock protein 70                                   246   1e-73   Gossypium hirsutum [American cotton]
gb|ADN03965.1|  heat shock cognate 70 kDa protein                       245   1e-73   Phytolacca acinosa [food pokeberry]
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     246   1e-73   Nicotiana tomentosiformis
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       246   1e-73   Nicotiana tomentosiformis
gb|AEX55235.1|  heat shock protein 70                                   239   1e-73   Allium sativum
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     246   2e-73   Cucumis melo [Oriental melon]
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    246   2e-73   
gb|AAX07349.1|  heat shock protein 70                                   239   2e-73   Zea mays [maize]
gb|EMS51616.1|  Heat shock cognate 70 kDa protein 1                     248   2e-73   Triticum urartu
emb|CAB72130.1|  heat shock protein 70                                  246   2e-73   Cucumis sativus [cucumbers]
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       246   2e-73   Glycine soja [wild soybean]
ref|XP_003621869.1|  Heat shock protein                                 246   2e-73   Medicago truncatula
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       244   2e-73   Medicago truncatula
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    246   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    246   2e-73   
emb|CDY52661.1|  BnaC01g38510D                                          246   2e-73   Brassica napus [oilseed rape]
emb|CCA29120.1|  heat shock protein 70 isoform 1                        246   2e-73   Solanum lycopersicum
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             245   2e-73   Eutrema salsugineum [saltwater cress]
emb|CAA55184.1|  heat shock protein 70 kDa                              233   2e-73   Zea mays [maize]
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    245   3e-73   Phoenix dactylifera
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    245   3e-73   Phoenix dactylifera
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     245   4e-73   Eucalyptus grandis [rose gum]
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       246   4e-73   Triticum urartu
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    246   4e-73   
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    245   4e-73   Solanum tuberosum [potatoes]
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    245   4e-73   Eucalyptus grandis [rose gum]
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             244   5e-73   Selaginella moellendorffii
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             244   5e-73   Selaginella moellendorffii
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       244   5e-73   Medicago truncatula
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       244   5e-73   Cucurbita maxima [Boston marrow]
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                244   6e-73   Erythranthe guttata [common monkey flower]
gb|KJB46580.1|  hypothetical protein B456_007G375600                    244   6e-73   Gossypium raimondii
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    244   6e-73   Brassica rapa
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    249   6e-73   
ref|XP_002532297.1|  heat shock protein, putative                       244   6e-73   Ricinus communis
emb|CDY50531.1|  BnaA01g30490D                                          244   6e-73   Brassica napus [oilseed rape]
gb|KJB16980.1|  hypothetical protein B456_002G258500                    243   6e-73   Gossypium raimondii
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       244   7e-73   
gb|AAB97316.1|  cytosolic heat shock 70 protein                         244   7e-73   
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       244   7e-73   
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     246   8e-73   
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       244   8e-73   
gb|ADD71975.1|  heat shock protein 70                                   244   8e-73   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    244   9e-73   
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    243   9e-73   
gb|AGT97046.1|  heat shock protein 70                                   244   1e-72   
gb|AAV97978.1|  heat shock protein hsp70                                243   1e-72   
gb|AAM48131.1|AF509336_1  heat shock protein 70                         243   1e-72   
gb|ACR38891.1|  heat shock protein 70                                   243   1e-72   
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    243   1e-72   
gb|AFA51946.1|  heat shock protein 70                                   243   1e-72   
gb|AGL07711.1|  heat shock protein 70                                   243   1e-72   
dbj|BAP90755.1|  heat shock protein 70                                  243   2e-72   
ref|NP_001044757.1|  Os01g0840100                                       243   2e-72   
dbj|BAD94888.1|  dnaK-type molecular chaperone hsc70.1 - like           237   2e-72   
gb|EEC76425.1|  hypothetical protein OsI_14101                          238   2e-72   
ref|WP_039310754.1|  molecular chaperone DnaK                           243   2e-72   
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                243   2e-72   
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    243   2e-72   
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    243   3e-72   
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    243   3e-72   
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        243   3e-72   
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             243   3e-72   
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             243   3e-72   
gb|ABX76301.1|  heat shock protein 70                                   243   3e-72   
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  243   3e-72   
ref|XP_002873056.1|  HSC70-1                                            242   3e-72   
ref|XP_001783063.1|  predicted protein                                  230   4e-72   
gb|ACD93209.1|  heat shock protein 70                                   243   4e-72   
emb|CDX93666.1|  BnaA06g03820D                                          231   4e-72   
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             242   5e-72   
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    242   5e-72   
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    242   5e-72   
gb|AEK70336.1|  heat shock protein 70                                   242   5e-72   
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             242   5e-72   
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    242   5e-72   
emb|CAA52684.1|  heat shock protein 70 cognate                          242   5e-72   
ref|NP_195870.1|  heat shock cognate protein 70-1                       242   5e-72   
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    242   6e-72   
emb|CAA54419.1|  heat shock cognate 70-1                                241   6e-72   
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    242   6e-72   
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    242   6e-72   
emb|CDP09035.1|  unnamed protein product                                242   6e-72   
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             241   7e-72   
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          241   7e-72   
ref|XP_002446329.1|  hypothetical protein SORBIDRAFT_06g014400          240   8e-72   
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    241   8e-72   
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          241   8e-72   
gb|AAA62445.1|  heat shock protein                                      241   8e-72   
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    241   9e-72   
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             241   1e-71   
gb|AIA22210.1|  heat shock protein 70                                   241   1e-71   
ref|XP_010446275.1|  PREDICTED: probable mediator of RNA polymera...    240   1e-71   
gb|AIZ68155.1|  heat shock protein 70                                   241   1e-71   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    241   1e-71   
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    241   2e-71   
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    241   2e-71   
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    248   2e-71   
gb|KHN17505.1|  Heat shock 70 kDa protein                               238   2e-71   
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             240   2e-71   
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    240   2e-71   
ref|XP_002873055.1|  predicted protein                                  240   2e-71   
gb|EPS60056.1|  heat shock protein 70                                   240   3e-71   
ref|XP_006407675.1|  hypothetical protein EUTSA_v10020258mg             238   3e-71   
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             240   3e-71   
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                239   4e-71   
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    239   4e-71   
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             239   5e-71   
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    240   5e-71   
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    239   6e-71   
ref|XP_010452091.1|  PREDICTED: probable mediator of RNA polymera...    231   6e-71   
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    239   7e-71   
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    239   7e-71   
ref|NP_195869.1|  heat shock protein 70                                 239   7e-71   
ref|NP_001051724.1|  Os03g0821100                                       238   1e-70   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    238   1e-70   
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             238   2e-70   
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        238   2e-70   
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             238   2e-70   
dbj|BAJ34054.1|  unnamed protein product                                238   2e-70   
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    237   2e-70   
gb|ACH61066.1|  heat shock protein 70 kDa                               226   2e-70   
gb|KJB36734.1|  hypothetical protein B456_006G174000                    238   2e-70   
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    237   3e-70   
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    237   4e-70   
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    237   4e-70   
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    237   4e-70   
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        237   4e-70   
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    237   4e-70   
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    237   5e-70   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       237   5e-70   
ref|NP_187555.1|  heat shock protein 70-3                               236   5e-70   
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               236   6e-70   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    236   8e-70   
dbj|BAK02194.1|  predicted protein                                      236   1e-69   
gb|ACH61090.1|  heat shock protein 70 kDa                               224   1e-69   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       235   2e-69   
gb|KJB83911.1|  hypothetical protein B456_013G270600                    235   2e-69   
gb|KFK33437.1|  hypothetical protein AALP_AA5G013700                    235   3e-69   
gb|EPS64948.1|  hypothetical protein M569_09829                         234   4e-69   
ref|XP_010094065.1|  Heat shock 70 kDa protein                          234   4e-69   
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        234   4e-69   
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    234   4e-69   
ref|XP_001767839.1|  predicted protein                                  234   6e-69   
ref|NP_001183165.1|  uncharacterized protein LOC100501536               234   6e-69   
ref|XP_001759874.1|  predicted protein                                  233   9e-69   
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    233   1e-68   
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    236   1e-68   
gb|AAS09825.1|  heat shock cognate protein 70                           233   2e-68   
ref|XP_001783048.1|  predicted protein                                  233   2e-68   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          233   2e-68   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          232   2e-68   
gb|AFS65092.1|  DnaK-type molecular chaperone hsp70                     217   3e-68   
emb|CAA44820.1|  heat shock protein 70                                  230   3e-68   
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               232   4e-68   
ref|XP_002512742.1|  heat shock protein, putative                       231   5e-68   
ref|XP_001785822.1|  predicted protein                                  231   5e-68   
ref|XP_002512741.1|  heat shock protein, putative                       231   5e-68   
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             231   5e-68   
ref|XP_001751923.1|  predicted protein                                  231   7e-68   
ref|XP_003610287.1|  Heat-shock protein                                 231   7e-68   
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             231   9e-68   
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             231   1e-67   
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          230   1e-67   
gb|ACC93947.1|  heat-shock protein 70                                   230   1e-67   
dbj|BAD94875.1|  heat-shock protein                                     216   1e-67   
gb|KHN14134.1|  Heat shock 70 kDa protein                               229   2e-67   
gb|KDO55360.1|  hypothetical protein CISIN_1g038511mg                   229   2e-67   
gb|AAA82975.1|  PsHSP71.2                                               229   2e-67   
gb|ACD45076.1|  heat-shock protein 70                                   229   2e-67   
gb|ABR18415.1|  unknown                                                 229   4e-67   
emb|CAA27330.1|  heat shock protein 70                                  227   5e-67   
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    229   5e-67   
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       228   8e-67   
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          228   8e-67   
gb|ABK25453.1|  unknown                                                 228   9e-67   
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               228   1e-66   
gb|ABK55692.1|  heat shock protein 70 isoform-1                         212   1e-66   
prf||1205208A  heat shock protein hsp70                                 227   2e-66
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        227   2e-66   
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          226   2e-66   
gb|AIU40169.1|  heat shock protein 70                                   227   2e-66   
ref|XP_001421920.1|  Heat Shock Protein 70, cytosolic                   226   4e-66   
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     228   7e-66   
emb|CDO98244.1|  unnamed protein product                                226   7e-66   
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             225   1e-65   
sp|P16121.2|HSP70_LUPPO  RecName: Full=Heat shock 70 kDa protein        215   1e-65   
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       225   1e-65   
ref|XP_002502667.1|  heat shock 70 kDa protein                          224   2e-65   
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               224   2e-65   
ref|XP_010091163.1|  Heat shock 70 kDa protein                          224   3e-65   
ref|XP_007013854.1|  Heat shock protein 70B                             224   3e-65   
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    223   3e-65   
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          224   4e-65   
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             223   6e-65   
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          223   6e-65   
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          223   7e-65   
ref|XP_003064239.1|  heat shock protein 70kDa                           223   7e-65   
emb|CEG00633.1|  Heat shock protein 70 family                           223   1e-64   
ref|NP_173055.1|  heat shock protein 70B                                222   1e-64   
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          223   1e-64   
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    221   1e-64   
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          222   2e-64   
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          222   2e-64   
ref|XP_007023492.1|  Heat shock protein 70B                             222   2e-64   
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               221   2e-64   
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     221   3e-64   
gb|ADB85350.1|  putative heat shock cognate                             222   3e-64   
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    221   3e-64   
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          221   4e-64   
ref|XP_008352210.1|  PREDICTED: heat shock 70 kDa protein-like          211   5e-64   
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         221   5e-64   
dbj|BAJ34597.1|  unnamed protein product                                219   1e-63   
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             219   1e-63   
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               219   1e-63   
ref|XP_006306285.1|  hypothetical protein CARUB_v10012149mg             219   2e-63   
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560          219   2e-63   
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             219   3e-63   
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               219   3e-63   
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein               219   3e-63   
gb|KDP44977.1|  hypothetical protein JCGZ_01477                         217   3e-63   
emb|CDY33359.1|  BnaC05g12240D                                          216   3e-63   
ref|XP_007512662.1|  Heat Shock Protein 70, cytosolic                   219   4e-63   
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    218   4e-63   
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               218   5e-63   
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               218   5e-63   
emb|CDY35063.1|  BnaA06g10730D                                          215   7e-63   
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          218   8e-63   
gb|KJB20862.1|  hypothetical protein B456_003G169700                    217   1e-62   
emb|CDP02832.1|  unnamed protein product                                217   1e-62   
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               217   1e-62   
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    217   2e-62   
ref|XP_001781229.1|  predicted protein                                  216   2e-62   
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         216   2e-62   
ref|XP_006368489.1|  heat shock protein 70 cognate                      216   2e-62   
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          216   3e-62   
emb|CDX83960.1|  BnaC08g16850D                                          216   3e-62   
emb|CDY49668.1|  BnaC06g01970D                                          212   5e-62   
ref|XP_010063599.1|  PREDICTED: heat shock 70 kDa protein-like is...    215   5e-62   
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...    215   5e-62   
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             215   5e-62   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   215   6e-62   
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    215   6e-62   
gb|KDO37859.1|  hypothetical protein CISIN_1g041209mg                   210   7e-62   
gb|KDP38702.1|  hypothetical protein JCGZ_04055                         214   7e-62   
gb|KDP44979.1|  hypothetical protein JCGZ_01479                         217   7e-62   
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             215   8e-62   
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein-like          215   8e-62   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          215   8e-62   
emb|CDX96825.1|  BnaA08g23680D                                          214   1e-61   
ref|XP_009110463.1|  PREDICTED: heat shock 70 kDa protein 5-like        214   1e-61   
ref|XP_009784010.1|  PREDICTED: heat shock cognate 70 kDa protein...    201   1e-61   
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        214   2e-61   
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    213   3e-61   
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               213   4e-61   
gb|KDP44978.1|  hypothetical protein JCGZ_01478                         211   5e-61   
gb|EYU21748.1|  hypothetical protein MIMGU_mgv1a020843mg                213   5e-61   
emb|CDY40360.1|  BnaA10g27080D                                          202   6e-61   



>gb|ACU17965.1| unknown [Glycine max]
Length=233

 Score =   269 bits (687),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 148/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  71   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  130

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNTIKDEKI  KL P DKKKIEDAIEQAIQWLD NQL EADEFEDKMKEL
Sbjct  131  NALENYSYNMRNTIKDEKIGGKLDPADKKKIEDAIEQAIQWLDSNQLGEADEFEDKMKEL  190

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGAGPDV   MD+D         G+GAGPKIEEVD
Sbjct  191  ESICNPIIAKMYQGGAGPDVGGAMDDD-----VPAAGSGAGPKIEEVD  233



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 154/168 (92%), Gaps = 2/168 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL PD+KKKIED++EQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLSPDEKKKIEDSVEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGAGPD+A GMDED        +  GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGGAGPDMAGGMDED--GPSAGASSAGAGPKIEEVD  651



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   276 bits (705),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL PD+KKKIED++EQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLSPDEKKKIEDSVEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ESICNPIIAKMYQG AGPD+A GMDED
Sbjct  606  ESICNPIIAKMYQGRAGPDMAGGMDED  632



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   276 bits (705),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 153/169 (91%), Gaps = 5/169 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI SKL PDDKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDQAISWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ-GGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GGAGPD+A GMDED    G S   +GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQDGGAGPDMAGGMDED----GPSAGASGAGPKIEEVD  650



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 155/169 (92%), Gaps = 3/169 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL PD+KKKIED++EQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLSPDEKKKIEDSVEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGA-GPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGA GPD+A GMDED        +G GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGGASGPDMAGGMDED--GPSAGASGAGAGPKIEEVD  652



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 153/168 (91%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI SKL PDDKKKIEDAI++AI WLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDEAISWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAGPD+A GMDED    G S   +GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGPDMAGGMDED----GPSAGASGAGPKIEEVD  648



>gb|KHN48981.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=585

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 148/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  423  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  482

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNTIKDEKI  KL P DKKKIEDAIEQAIQWLD NQL EADEFEDKMKEL
Sbjct  483  NALENYSYNMRNTIKDEKIGGKLDPADKKKIEDAIEQAIQWLDSNQLGEADEFEDKMKEL  542

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGAGPDV   MD+D         G+GAGPKIEEVD
Sbjct  543  ESICNPIIAKMYQGGAGPDVGGAMDDD-----VPAAGSGAGPKIEEVD  585



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 156/170 (92%), Gaps = 4/170 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI SKL+P+DKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIRDEKIGSKLKPEDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIA+MYQGGAG D+  A GMD+D   A  +G G GAGPKIEEVD
Sbjct  606  ESICNPIIAQMYQGGAGADMDGAGGMDDD--CAPSAGGGRGAGPKIEEVD  653



>ref|XP_006574857.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
Length=586

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  423  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  482

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDKKKIEDAIE AIQWLDGNQLAEADEFEDKMKEL
Sbjct  483  NALENYAYNMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKEL  542

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES CNPIIAKMYQG   PD+A GMDED           GAGPKIEEVD
Sbjct  543  ESTCNPIIAKMYQGAGAPDMAGGMDED----VPPSGSGGAGPKIEEVD  586



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 151/169 (89%), Gaps = 4/169 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKISSKL P DKKKIEDAI+ AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKISSKLSPSDKKKIEDAIDGAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV-AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG  GPDV  AGMDED         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGGPDVGGAGMDED---DVPPAGGSGAGPKIEEVD  651



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDKKKIEDAIE AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLSDDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG   PD+A GMDED           GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGAPDMAGGMDED----VPPSGSGGAGPKIEEVD  649



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDKKKIEDAIE AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLSDDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG   PD+A GMDED           GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGAPDMAGGMDED----VPPSGSGGAGPKIEEVD  649



>gb|KDO36486.1| hypothetical protein CISIN_1g020168mg [Citrus sinensis]
Length=330

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAED+EHKKKVEAK
Sbjct  167  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAK  226

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKIS+KL   DKKKIEDAIE+AIQWLDGNQLAEADEFEDKMKEL
Sbjct  227  NALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKEL  286

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQGG G D  A MDED      +G G+GAGPKIEEVD
Sbjct  287  EGICNPIIAKMYQGG-GADAGASMDED---GPSAGAGSGAGPKIEEVD  330



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   270 bits (690),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDKKKIEDAIE AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES CNPIIAKMYQG   PD+A GMDED           GAGPKIEEVD
Sbjct  606  ESTCNPIIAKMYQGAGAPDMAGGMDED----VPPSGSGGAGPKIEEVD  649



>gb|ACA23466.1| heat shock protein 70 [Arachis diogoi]
Length=172

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  13   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  72

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTIKD+KISSKL P DK KI+DAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  73   NTLENYAYNMRNTIKDDKISSKLSPADKTKIDDAIEQAIQWLDANQLAEADEFEDKMKEL  132

Query  241  ESICNPIIAKMYQGGAGPDV  182
            ESICNPIIAKMYQGGAG +V
Sbjct  133  ESICNPIIAKMYQGGAGGEV  152



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 150/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKISSKL  DDKKKIEDAIEQAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKISSKLAADDKKKIEDAIEQAIHWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ G+GPD+A GMDED         G+ AGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GSGPDMAGGMDED----APPAGGSSAGPKIEEVD  648



>ref|XP_010042813.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Eucalyptus grandis]
Length=415

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 149/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  253  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAK  312

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKIS+KL   DKKKIEDAIE+AI WLDGNQLAEADEFEDKMKEL
Sbjct  313  NALENYAYNMRNTIKDEKISAKLPAADKKKIEDAIEEAIHWLDGNQLAEADEFEDKMKEL  372

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAGPD+  GMDED         G+GAGPKIEEVD
Sbjct  373  EGICNPIIAKMYQ-GAGPDMGGGMDED----VPPAGGSGAGPKIEEVD  415



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 152/168 (90%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI +KL P DKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGAKLAPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAGPD  AGMDED    G S  GTGAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGPDAGAGMDED----GPSVGGTGAGPKIEEVD  648



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  271  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  330

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEF+DKMKEL
Sbjct  331  NALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKEL  390

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D+A GMDED         G+GAGPKIEEVD
Sbjct  391  EGICNPIIAKMYQ-GAGADMAGGMDED---DAPPAGGSGAGPKIEEVD  434



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDKKKIEDAIE AIQWLD NQL EADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLSGDDKKKIEDAIESAIQWLDTNQLGEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG   PD+A GMDED           GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGAPDMAGGMDED----VPPSGSGGAGPKIEEVD  649



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 150/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKISSKL  DDKKKIEDAI+QAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKISSKLATDDKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG DV   MD+D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGADVGGSMDDD----VPPAGGSGAGPKIEEVD  648



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 153/168 (91%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI +KL P DKKKIEDAIEQAIQWLDGNQLAEADEF+DKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGAKLAPADKKKIEDAIEQAIQWLDGNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAGPD+  GMD++    G S  G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGPDMGGGMDDE----GPSVGGSGAGPKIEEVD  648



>ref|XP_006365705.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 141/147 (96%), Gaps = 2/147 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAERYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL P++K+KIED++EQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLSPEEKQKIEDSVEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ESICNPIIAKMYQGGA  D+A GMDED
Sbjct  606  ESICNPIIAKMYQGGA--DMAGGMDED  630



>emb|CCJ09763.1| putative heat shock protein-70kDa, partial [Hirudo medicinalis]
Length=229

 Score =   253 bits (646),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  68   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  127

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIED+IE AIQWL+GNQLAEADEFEDKMKEL
Sbjct  128  NALENYAYNMRNTIKDDKIASKLSAADKKKIEDSIESAIQWLEGNQLAEADEFEDKMKEL  187

Query  241  ESICNPIIAKMYQGGAGP  188
            ESICNPIIAKMY GGAGP
Sbjct  188  ESICNPIIAKMYSGGAGP  205



>gb|EYU19903.1| hypothetical protein MIMGU_mgv1a002628mg [Erythranthe guttata]
Length=652

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  LDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDKKK+EDAIE AIQWLD NQL EADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLGADDKKKVEDAIEGAIQWLDANQLGEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQG  GPD+A GMDED      +G  +G GPKIEEVD
Sbjct  606  EGICNPIIAKMYQGSGGPDMAGGMDED-GPPSAAGGSSGPGPKIEEVD  652



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 153/168 (91%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KISSKL  DDKKKIEDAIEQAIQWL+GNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKISSKLAADDKKKIEDAIEQAIQWLEGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAGPD+A GM++D      +  G+G+GPKIEEVD
Sbjct  606  EGICNPIIAKMYQ-GAGPDMADGMNDD----APAAGGSGSGPKIEEVD  648



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI SKL P+DKKKI+DAIE +IQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGSKLSPEDKKKIDDAIEASIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E +CNPIIAKMYQGG  PD+A GM++D          +GAGPKIEEVD
Sbjct  606  EGLCNPIIAKMYQGGGAPDMAGGMNDD----VPPSGSSGAGPKIEEVD  649



>ref|XP_007144451.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
 gb|ESW16445.1| hypothetical protein PHAVU_007G157200g [Phaseolus vulgaris]
Length=648

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI  KL P DKKKIEDA+EQ IQWLD NQL EADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAVEQTIQWLDTNQLGEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQGGAGPD+   MD+D         G+GAGPKIEEVD
Sbjct  606  ESLCNPIIAKMYQGGAGPDMGGAMDDD-----VPAGGSGAGPKIEEVD  648



>gb|AAA82974.1| HSP70b, partial [Pisum sativum]
Length=161

 Score =   249 bits (637),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 2/147 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK++IEKMV+EAE+YKAEDEEHKKKV+AK
Sbjct  17   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVEEAEKYKAEDEEHKKKVDAK  76

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI DEKI SKL P+DKKKI+DAIE AIQWLD NQLAEADEFEDKMKEL
Sbjct  77   NALENYAYNMRNTINDEKIGSKLSPEDKKKIDDAIEAAIQWLDSNQLAEADEFEDKMKEL  136

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ES+CNPIIAKMYQGG  PD+  G D+D
Sbjct  137  ESLCNPIIAKMYQGGGAPDM--GGDDD  161



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KD+KI  KL P DKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDDKIGEKLDPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGAGPDV      +   A     G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGGAGPDVGGAGAAEDEYAAPPSGGSGAGPKIEEVD  653



>ref|XP_004307529.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDE+HKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEDHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SK+ P DKKKIEDAIE+AI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKIDPSDKKKIEDAIEEAIHWLDNNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQGGA PD++ G D D         G+GAGPKIEEVD
Sbjct  606  ESLCNPIIAKMYQGGAAPDMSGGADAD----VPPSGGSGAGPKIEEVD  649



>gb|ABG22609.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=544

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  381  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  440

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEF+DKMKEL
Sbjct  441  NALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKEL  500

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D+A GMDED         G+GAGPKIEEVD
Sbjct  501  EGICNPIIAKMYQ-GAGADMAGGMDED---DAPPAGGSGAGPKIEEVD  544



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 153/168 (91%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KD+KISSKL  +DKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDDKISSKLTAEDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG D+ AGM++D      S  G+G+GPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGADMGAGMNDD----APSAGGSGSGPKIEEVD  648



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIED I+QAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLDAADKKKIEDTIDQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQG  GPDV   MD+D         G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGAGGPDVGGXMDDD----VPXAGGSGAGPKIEEVD  649



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 149/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI S+L P DKKKIEDAI+QAIQWLD NQLAE DEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQLAEVDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAGPD+   MDED      S  G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGPDMGGSMDED----IPSTGGSGAGPKIEEVD  648



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 149/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL PDDKK+IEDAIE+AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLSPDDKKRIEDAIEEAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ GAG D+   MDED         G+GAGPKIEEVD
Sbjct  606  ESVCNPIIAKMYQ-GAGGDMGGSMDED----APPSGGSGAGPKIEEVD  648



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 149/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI S+L P DKKKIEDAI+QAIQWLD NQLAE DEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSQLSPADKKKIEDAIDQAIQWLDSNQLAEVDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAGPD+   MDED      S  G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGPDMGGSMDED----IPSTGGSGAGPKIEEVD  648



>ref|XP_008776656.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=649

 Score =   263 bits (672),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 153/169 (91%), Gaps = 5/169 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNV+ EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKK+EAK
Sbjct  485  IDANGILNVTAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKIEAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI++KL P DKKKIEDAIEQAI WLDGNQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTIKDEKIAAKLPPADKKKIEDAIEQAINWLDGNQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQG-GAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG GAG D  AGMDED  +    G+ +GAGPKIEEVD
Sbjct  605  ESICNPIIAKMYQGAGAGMD--AGMDED--APAAGGSSSGAGPKIEEVD  649



>gb|AAB65162.1| heat shock cognate protein [Solanum commersonii]
Length=339

 Score =   254 bits (649),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  176  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVEAK  235

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KISSKL  +DKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  236  NALENYAYNMRNTIKDDKISSKLGAEDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKEL  295

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ GAG +  A MD+D          TGAGPKIEEVD
Sbjct  296  ESLCNPIIAKMYQ-GAGGEAGAPMDDD---DAPPAGSTGAGPKIEEVD  339



>gb|ABG22608.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=602

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  439  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  498

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEF+DKMKEL
Sbjct  499  NALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKEL  558

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D+A GMDED         G+GAGPKIEEVD
Sbjct  559  EGICNPIIAKMYQ-GAGADMAGGMDED---DAPPAGGSGAGPKIEEVD  602



>ref|XP_006378714.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|ERP56511.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT+KDEKISSKL  DDKKKIEDAI+QAIQWLD NQLAEADEF+DKMKEL
Sbjct  546  NSLENYAYNMRNTVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAGPD+  GMD+D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGPDMGGGMDDD----APPSGGSGAGPKIEEVD  648



>ref|XP_002884912.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61171.1| hypothetical protein ARALYDRAFT_897465 [Arabidopsis lyrata subsp. 
lyrata]
Length=650

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 152/170 (89%), Gaps = 7/170 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAI+WLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIA+MYQ GAGPD+  AAGMD+D      +    GAGPKIEEVD
Sbjct  606  ESICNPIIARMYQ-GAGPDMGGAAGMDDD----APASGSGGAGPKIEEVD  650



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 149/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL PDDKKKIEDAIE+AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLSPDDKKKIEDAIEEAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ GAG D+   MDED         G+GAGPKIEEVD
Sbjct  606  ESVCNPIIAKMYQ-GAGGDMGGSMDED----APPSGGSGAGPKIEEVD  648



>gb|EAY98319.1| hypothetical protein OsI_20227 [Oryza sativa Indica Group]
Length=410

 Score =   256 bits (654),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 147/168 (88%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  249  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  308

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDKK+IEDAI+ AI WLD NQLAEADEFEDKMKEL
Sbjct  309  NALENYAYNMRNTIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKMKEL  368

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ G G D+A GMDED         G+GAGPKIEEVD
Sbjct  369  EGICNPIIAKMYQ-GPGADMAGGMDED-----APAGGSGAGPKIEEVD  410



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT+KDEKISSKL  DDKKKIEDAI+QAIQWLD NQLAEADEF+DKMKEL
Sbjct  546  NSLENYAYNMRNTVKDEKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAGPD+  GMD+D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGPDMGGGMDDD----APPAGGSGAGPKIEEVD  648



>ref|XP_006297173.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
 gb|EOA30071.1| hypothetical protein CARUB_v10013177mg [Capsella rubella]
Length=650

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 153/170 (90%), Gaps = 7/170 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDKKKIEDAI+QAI+WLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLDADDKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIA+MYQ GAGPD+  A GMD+D      +G   GAGPKIEEVD
Sbjct  606  ESLCNPIIARMYQ-GAGPDMGGAGGMDDD----APAGGSGGAGPKIEEVD  650



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAED+EHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKIS+KL   DKKKIEDAIE+AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQGG G D  A MDED      +G G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGG-GADAGASMDED---GPSAGAGSGAGPKIEEVD  649



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAED+EHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKIS+KL   DKKKIEDAIE+AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQGG G D  A MDED      +G G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGG-GADAGASMDED---GPSAGAGSGAGPKIEEVD  649



>gb|EAZ19310.1| hypothetical protein OsJ_34853 [Oryza sativa Japonica Group]
Length=632

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  469  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  528

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEF+DKMKEL
Sbjct  529  NALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKEL  588

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D+A GMDED         G+GAGPKIEEVD
Sbjct  589  EGICNPIIAKMYQ-GAGADMAGGMDED---DAPPAGGSGAGPKIEEVD  632



>tpg|DAA44672.1| TPA: hsp70 protein [Zea mays]
Length=544

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEH+KKV AK
Sbjct  381  MDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHQKKVNAK  440

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTI+D+KI+SKL  DDKKKI+DA+E AI WLD NQLAE DEFEDKMKEL
Sbjct  441  NTLENYAYNMRNTIRDDKIASKLPEDDKKKIDDAVEGAINWLDNNQLAEVDEFEDKMKEL  500

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQG AGPD+A GMD+D         G+GAGPKIEEVD
Sbjct  501  EGICNPIIAKMYQGAAGPDMAGGMDQD----ASPAGGSGAGPKIEEVD  544



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 150/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI +KL P DKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGAKLTPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAGPD+   M++D        +G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGPDMGGPMEDD----VPPASGSGAGPKIEEVD  648



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 150/169 (89%), Gaps = 6/169 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKK EAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKAEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT+KDEKI SKL PDDKKKIEDAI+ A+QWLDGNQLAEADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTVKDEKIGSKLSPDDKKKIEDAIDGAVQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV-AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAGPD+  AGM +D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGPDMGGAGMADD----IPPAGGSGAGPKIEEVD  649



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 148/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI SKL PDDKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG +  A MD+D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGGEAGAPMDDD----APPAGGSGAGPKIEEVD  648



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 150/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDE+HKKKVEAK
Sbjct  487  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEDHKKKVEAK  546

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI++KL   DKKKIEDAIE+AI WLDGNQLAEADEFEDKMKEL
Sbjct  547  NALENYAYNMRNTIKDEKIAAKLPAADKKKIEDAIEKAISWLDGNQLAEADEFEDKMKEL  606

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D+A GMDED    G +  G+ AGPKIEEVD
Sbjct  607  EGICNPIIAKMYQ-GAGADMAGGMDED----GPTTGGSSAGPKIEEVD  649



>gb|KHG00348.1| Heat shock 70 kDa 4 -like protein [Gossypium arboreum]
Length=570

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 150/169 (89%), Gaps = 5/169 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  406  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  465

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTIKDEKISSKL   DKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  466  NGLENYAYNMRNTIKDEKISSKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  525

Query  241  ESICNPIIAKMYQGGAGPDVAAG-MDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D+ AG MD+D       G G+GAGPKIEEVD
Sbjct  526  EGICNPIIAKMYQ-GAGGDMGAGPMDDD---GPSVGGGSGAGPKIEEVD  570



>gb|AEP40944.1| heat shock protein 70 family protein [Posidonia oceanica]
Length=200

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 146/168 (87%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKK+E+K
Sbjct  39   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKIESK  98

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKIS KL   DKKKIEDAI++AIQWLD NQL EADEF+DKMKEL
Sbjct  99   NALENYAYNMRNTIRDEKISEKLAAADKKKIEDAIDEAIQWLDNNQLGEADEFDDKMKEL  158

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E++CNPIIAKMYQ GAG DV  GMDED     G    +G GPKIEEVD
Sbjct  159  ENVCNPIIAKMYQ-GAGGDVDGGMDED-----GLSAPSGPGPKIEEVD  200



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEF+DKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D+A GMDED         G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQ-GAGADMAGGMDED---DAPPAGGSGAGPKIEEVD  649



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEF+DKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D+A GMDED         G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQ-GAGADMAGGMDED---DAPPAGGSGAGPKIEEVD  649



>gb|KJB73858.1| hypothetical protein B456_011G256600 [Gossypium raimondii]
Length=652

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 149/170 (88%), Gaps = 5/170 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI SKL PDDKKKIEDAI+ AI WLD NQ AEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDAAINWLDANQSAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNP+IAKMYQGGAGPD+  A GM +D      S  G GAGPKIEEVD
Sbjct  606  ESLCNPVIAKMYQGGAGPDMGRAGGMADD---VPPSRGGGGAGPKIEEVD  652



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKISSKL   DKKKIEDAIE AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKISSKLPAADKKKIEDAIEGAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPD  185
            ESICNPIIAKMYQG  GPD
Sbjct  606  ESICNPIIAKMYQGAGGPD  624



>gb|AGZ15406.1| heat shock cognate 70 kDa protein [Phaseolus vulgaris]
Length=651

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 147/167 (88%), Gaps = 2/167 (1%)
 Frame = -1

Query  598  DANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAKN  419
            DANGILNVS EDKTTGQKNKITITNDKGRLSK++IEKMVQEAE+YK+EDEEHKKKVEAKN
Sbjct  487  DANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAKN  546

Query  418  ALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELE  239
            ALENYAYNMRNT+KDEKI  KL P DKKKIEDAIEQ+IQWLD NQLAEADEFEDKMKELE
Sbjct  547  ALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAIEQSIQWLDSNQLAEADEFEDKMKELE  606

Query  238  SICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            SICNPIIAKMYQGGAGPD+      D  +      G+GAGPKIEEVD
Sbjct  607  SICNPIIAKMYQGGAGPDMGGAPPAD--TEYTPSGGSGAGPKIEEVD  651



>gb|AAS57914.1| 70 kDa heat shock cognate protein 3 [Vigna radiata]
Length=650

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KD+KI  KL P DKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTVKDDKIGGKLDPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQGGAGPD+      D         G+GAGPKIEEVD
Sbjct  605  ESVCNPIIAKMYQGGAGPDMGGAPPAD--DEYTPSGGSGAGPKIEEVD  650



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK++IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI  KL P DKKKIEDAIEQ+IQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAIEQSIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGAGPD+      D  +      G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGGAGPDMGGAPPAD--TEYTPSGGSGAGPKIEEVD  651



>ref|XP_010918390.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=649

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 3/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNV+ EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKK+EAK
Sbjct  485  IDANGILNVTAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKIEAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI++KL P DKKKIED+IE+AI WLDGNQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTIRDEKIAAKLPPADKKKIEDSIEEAINWLDGNQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG  +A GMDED      +G+  GAGPKIEEVD
Sbjct  605  ESICNPIIAKMYQ-GAGAGMADGMDED--VPTAAGSSGGAGPKIEEVD  649



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEE KKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEVKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAIEQAIQWLDGNQLAEA+E++DK+KEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLDAGDKKKIEDAIEQAIQWLDGNQLAEAEEYDDKVKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQGGA PD+  GMDED         G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGGAAPDMGGGMDED----VPPAGGSGAGPKIEEVD  649



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   260 bits (664),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 150/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI D+KI+SKL   DKKKIEDAIEQAIQWLDGNQLAEADEF+DKMKEL
Sbjct  546  NALENYAYNMRNTINDDKIASKLAAADKKKIEDAIEQAIQWLDGNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG D+A GMD+D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGADMAGGMDDD----APPAGGSGAGPKIEEVD  648



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   259 bits (663),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 148/168 (88%), Gaps = 7/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI +KL P DKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGAKLPPADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG D+  GMDED         G GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGADM-GGMDED-----VPAGGNGAGPKIEEVD  646



>ref|XP_010911697.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c, partial [Elaeis guineensis]
Length=238

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 1/147 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNV  ED+TTGQKNKIT+ NDKGRLSKEEIEKMVQ+AE+Y++EDEEHKKKVEAK
Sbjct  76   IDANGILNVLAEDETTGQKNKITMINDKGRLSKEEIEKMVQDAEKYESEDEEHKKKVEAK  135

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIED IEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  136  NALENYAYNMRNTIKDDKIASKLPASDKKKIEDPIEQAIQWLDGNQLAEADEFEDKMKEL  195

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ESICNPIIA MYQ GAG D+A GMD+D
Sbjct  196  ESICNPIIAGMYQ-GAGADMAGGMDDD  221



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 150/168 (89%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE MVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   D+KKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLAAADRKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG D+A  MD+D      +  G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGADMAGEMDDD----VPAAGGSGAGPKIEEVD  648



>ref|NP_187864.1| heat shock protein 70-4 [Arabidopsis thaliana]
 sp|Q9LHA8.1|MD37C_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37c; AltName: Full=Heat shock 70 kDa protein 4; 
AltName: Full=Heat shock cognate 70 kDa protein 4; AltName: 
Full=Heat shock cognate protein 70-4; Short=AtHsc70-4; AltName: 
Full=Heat shock protein 70-4; Short=AtHsp70-4 [Arabidopsis 
thaliana]
 gb|AAG51030.1|AC069474_29 heat shock protein 70; 34105-36307 [Arabidopsis thaliana]
 dbj|BAB02269.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AAL06844.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL06851.1| AT3g12580/T2E22_110 [Arabidopsis thaliana]
 gb|AAL24367.1| 70 kDa heat shock protein [Arabidopsis thaliana]
 gb|AEE75218.1| heat shock protein 70-4 [Arabidopsis thaliana]
Length=650

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 152/170 (89%), Gaps = 7/170 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAI+WLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIA+MYQ GAGPD+  A GMD+D      +G   GAGPKIEEVD
Sbjct  606  ESLCNPIIARMYQ-GAGPDMGGAGGMDDD----TPAGGSGGAGPKIEEVD  650



>gb|ABD32895.1| Heat shock protein Hsp70 [Medicago truncatula]
 gb|AES81705.2| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+ KL  DDKKKIED IE AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIAGKLDSDDKKKIEDTIEAAIQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E +CNPIIAKMYQGGAGPD+ A   +D           GAGPKIEEVD
Sbjct  606  EGVCNPIIAKMYQGGAGPDMGAAPGDD----DAPSHAGGAGPKIEEVD  649



>emb|CAA05547.1| heat shock protein 70 [Arabidopsis thaliana]
Length=650

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 152/170 (89%), Gaps = 7/170 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAI+WLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIA+MYQ GAGPD+  A GMD+D      +G   GAGPKIEEVD
Sbjct  606  ESLCNPIIARMYQ-GAGPDMGGAGGMDDD----TPAGGSGGAGPKIEEVD  650



>ref|XP_010465032.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 152/170 (89%), Gaps = 7/170 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAI+WLDGNQLAEADEF+DKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIA+MYQ GAGPD+  A GMDED      +G   GAGPKIEEVD
Sbjct  606  ESLCNPIIARMYQ-GAGPDMGGAGGMDED----APAGGSGGAGPKIEEVD  650



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQ AE+YK+EDEEHKKKVE+K
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQGAEKYKSEDEEHKKKVESK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEF+DKMKEL
Sbjct  545  NALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D+A GMDED         G+GAGPKIEEVD
Sbjct  605  EGICNPIIAKMYQ-GAGADMAGGMDED---DAPPAGGSGAGPKIEEVD  648



>ref|XP_004492129.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=542

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 134/142 (94%), Gaps = 2/142 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAK
Sbjct  381  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAK  440

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKD+KISSKL P DKK IEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  441  NSLENYAYNMRNTIKDDKISSKLSPSDKKLIEDAIEQAIQWLDANQLAEADEFEDKMKEL  500

Query  241  ESICNPIIAKMYQGGA--GPDV  182
            E+ICNPIIAKMYQGGA  GP+V
Sbjct  501  ETICNPIIAKMYQGGAGEGPEV  522



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 152/168 (90%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTIKD+KI+SKL   DKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NTLENYAYNMRNTIKDDKIASKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMY+ GAG D+A GMD+D      +G G+GAGPKIEEVD
Sbjct  606  ESVCNPIIAKMYE-GAGADMAGGMDDD---GPSAGGGSGAGPKIEEVD  649



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 151/169 (89%), Gaps = 5/169 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKINSKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAG-MDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D+ AG MD+D       G G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQ-GAGGDMGAGPMDDD---GPSVGGGSGAGPKIEEVD  650



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL  DDKKKIEDAI+QAIQWLDGNQLAEADEF+DKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLAADDKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            E +CNPIIAKMYQ GAG ++A GMDED
Sbjct  606  EGLCNPIIAKMYQ-GAGANMAGGMDED  631



>ref|NP_001148198.1| heat shock cognate 70 kDa protein 2 [Zea mays]
 gb|ACG30152.1| heat shock cognate 70 kDa protein 2 [Zea mays]
 tpg|DAA44671.1| TPA: hsp70 protein [Zea mays]
Length=649

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEH+KKV AK
Sbjct  486  MDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHQKKVNAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTI+D+KI+SKL  DDKKKI+DA+E AI WLD NQLAE DEFEDKMKEL
Sbjct  546  NTLENYAYNMRNTIRDDKIASKLPEDDKKKIDDAVEGAINWLDNNQLAEVDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQG AGPD+A GMD+D         G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGAAGPDMAGGMDQD----ASPAGGSGAGPKIEEVD  649



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 146/168 (87%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI SKL  DDKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG +  A MD+D         G+ AGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGGEAGAPMDDD----APPAGGSSAGPKIEEVD  648



>ref|XP_002468097.1| hypothetical protein SORBIDRAFT_01g039530 [Sorghum bicolor]
 gb|EER95095.1| hypothetical protein SORBIDRAFT_01g039530 [Sorghum bicolor]
Length=649

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  MDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTI+D+KI+SKL   DKKKI+DAIE AI WLD NQLAE DEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIRDDKIASKLPEADKKKIDDAIEGAINWLDNNQLAEVDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQG AGPD+A GMD+D         G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGAAGPDMAGGMDQD----APPAGGSGAGPKIEEVD  649



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 146/168 (87%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI SKL  DDKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG +  A MD+D         G+ AGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGGEAGAPMDDD----APPAGGSSAGPKIEEVD  648



>ref|NP_001167696.1| heat shock cognate 70 kDa protein 2 [Zea mays]
 gb|ACG43177.1| heat shock cognate 70 kDa protein 2 [Zea mays]
Length=649

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 145/168 (86%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEH+KKV AK
Sbjct  486  MDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHQKKVNAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTI+D+KI+SKL  DDKKKI+DA+E AI WLD NQLAE DEFEDKMKEL
Sbjct  546  NTLENYAYNMRNTIRDDKIASKLPVDDKKKIDDAVEGAINWLDNNQLAEVDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQG AGPD+A GMD D         G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGAAGPDMAGGMDRD----ASPAGGSGAGPKIEEVD  649



>ref|XP_004307259.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Fragaria vesca subsp. vesca]
Length=649

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 151/168 (90%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKK+EDAIEQAIQWLDGNQLAEA+E++DK+KEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLDAADKKKVEDAIEQAIQWLDGNQLAEAEEYDDKVKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQGGA PD+A G+DE+         G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGGAPPDMAGGIDEE----VPPSGGSGAGPKIEEVD  649



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 150/169 (89%), Gaps = 4/169 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YK+EDEE KKKVEAK
Sbjct  487  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKKKVEAK  546

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI  KL P+DKKKIE+AIEQAIQWL+GNQLAE DE EDKMKEL
Sbjct  547  NALENYAYNMRNTIRDEKIGEKLGPEDKKKIEEAIEQAIQWLEGNQLAEVDELEDKMKEL  606

Query  241  ESICNPIIAKMYQGGAG-PDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG AG PD+A GMD+D        +G+GAGPKIEEVD
Sbjct  607  ESICNPIIAKMYQGSAGAPDMAGGMDDD---HVPPSSGSGAGPKIEEVD  652



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI SKL  DDKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG +  A MD+D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGGEAGAPMDDD----APPAGGSGAGPKIEEVD  648



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   258 bits (658),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 147/171 (86%), Gaps = 7/171 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE MVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL P DKKKIEDAI+ AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLDPTDKKKIEDAIDGAIQWLDNNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGA---GPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG     G D+ AGMD+D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGADMGADMGAGMDDD----APPAGGSGAGPKIEEVD  652



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   258 bits (658),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KISSKL  DDKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKISSKLSADDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ GAG +  A MD+D          TGAGPKIEEVD
Sbjct  606  ESLCNPIIAKMYQ-GAGGEAGAPMDDD---DAPPAGSTGAGPKIEEVD  649



>ref|XP_010499184.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   257 bits (657),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 151/170 (89%), Gaps = 7/170 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAI+QAI+WLDGNQLAE DEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKITSKLDAADKKKIEDAIDQAIEWLDGNQLAETDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIA+MYQ GAGPD+  A GM+ED      +G   GAGPKIEEVD
Sbjct  606  ESLCNPIIARMYQ-GAGPDMGGAGGMEED----APAGGSGGAGPKIEEVD  650



>ref|XP_004493886.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Cicer arietinum]
Length=650

 Score =   257 bits (657),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 149/169 (88%), Gaps = 5/169 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+ KL   DKKKIED+IEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIAGKLDSADKKKIEDSIEQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV-AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQGGAGPD+  A  DE+         G+GAGPKIEEVD
Sbjct  606  ESVCNPIIAKMYQGGAGPDMGGAAADEE----YAPSGGSGAGPKIEEVD  650



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   257 bits (657),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 148/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLPAADKKKIEDAIEQAIQWLDNNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIA+MYQ GAG DVA GM +D         G+GAGPKIEEVD
Sbjct  606  EGICNPIIARMYQ-GAGADVAGGMGDD----SPPAGGSGAGPKIEEVD  648



>gb|EAY89457.1| hypothetical protein OsI_10990 [Oryza sativa Indica Group]
Length=415

 Score =   251 bits (641),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 2/147 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTG+KNKITITNDKGRLSKEEIE+MVQEAE+YKAEDE+ + KVEA+
Sbjct  249  IDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKAEDEQVRHKVEAR  308

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT++DEKI+SKL  DDKKKIEDAIE AI+WLDGNQLAEADEFEDKMKEL
Sbjct  309  NALENYAYNMRNTVRDEKIASKLPADDKKKIEDAIEDAIKWLDGNQLAEADEFEDKMKEL  368

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ES+CNPII+KMYQGGAG    AGMDED
Sbjct  369  ESLCNPIISKMYQGGAGG--PAGMDED  393



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 147/168 (88%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDKK+IEDAI+ AI WLD NQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTIKDEKIASKLAADDKKRIEDAIDGAISWLDTNQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ G G D+A GMDED         G+GAGPKIEEVD
Sbjct  605  EGICNPIIAKMYQ-GPGADMAGGMDED-----APAGGSGAGPKIEEVD  646



>ref|NP_001049719.2| Os03g0277300 [Oryza sativa Japonica Group]
 dbj|BAF11633.2| Os03g0277300 [Oryza sativa Japonica Group]
Length=398

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 2/147 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTG+KNKITITNDKGRLSKEEIE+MVQEAE+YKAEDE+ + KVEA+
Sbjct  232  IDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKAEDEQVRHKVEAR  291

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT++DEKI+SKL  DDKKKIEDAIE AI+WLDGNQLAEADEFEDKMKEL
Sbjct  292  NALENYAYNMRNTVRDEKIASKLPADDKKKIEDAIEDAIKWLDGNQLAEADEFEDKMKEL  351

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ES+CNPII+KMYQGGAG    AGMDED
Sbjct  352  ESLCNPIISKMYQGGAGG--PAGMDED  376



>ref|XP_003625487.1| Heat shock protein [Medicago truncatula]
Length=719

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+ KL  DDKKKIED IE AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIAGKLDSDDKKKIEDTIEAAIQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            E +CNPIIAKMYQGGAGPD+ A   +D
Sbjct  606  EGVCNPIIAKMYQGGAGPDMGAAPGDD  632



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 144/168 (86%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDE+HKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEDHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL  DDKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLSVDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D  A MD+D          + AGPKIEEVD
Sbjct  606  EGICNPIIAKMYQ-GAGGDAGAPMDDD----VPPAGASSAGPKIEEVD  648



>ref|XP_004493999.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=661

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 137/148 (93%), Gaps = 1/148 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+ KL   DKKKIED+IEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIAGKLDSADKKKIEDSIEQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV-AAGMDED  161
            ES+CNPIIAKMYQGGAGPD+  A  DE+
Sbjct  606  ESVCNPIIAKMYQGGAGPDMGGAAADEE  633



>ref|XP_010486980.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Camelina sativa]
Length=650

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 151/170 (89%), Gaps = 7/170 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAI+QAI+WLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ GAGPD+  A  MD+D      +G   GAGPKIEEVD
Sbjct  606  ESLCNPIIAKMYQ-GAGPDMGGAGAMDDD----APAGGSGGAGPKIEEVD  650



>gb|EMS50129.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=736

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 148/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  574  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESK  633

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL  DDKKKIEDAI+QAIQWLDGNQLAEADEF+DKMKEL
Sbjct  634  NALENYAYNMRNTIKDDKIASKLAADDKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKEL  693

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E +CNPIIAKMYQ GAG D+A  MDED           GAGPKIEEVD
Sbjct  694  EGLCNPIIAKMYQ-GAGADMAGAMDED----DAPPAAGGAGPKIEEVD  736



>gb|EAY89450.1| hypothetical protein OsI_10982 [Oryza sativa Indica Group]
Length=438

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 148/168 (88%), Gaps = 3/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  274  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDAK  333

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKD+KI+SKL   DKKKIEDAI+ AI WLD NQLAEA+EFEDKMKEL
Sbjct  334  NSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEEFEDKMKEL  393

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E +CNPIIAKMYQ GAG D+A GMDED  +   +G  +G GPKIEEVD
Sbjct  394  EGVCNPIIAKMYQ-GAGADMAGGMDED--APAAAGGSSGPGPKIEEVD  438



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 149/168 (89%), Gaps = 7/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI  KL P DKKKIEDAI++AI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGEKLTPADKKKIEDAIDEAIAWLDTNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E++CNPIIAKMYQGGAG   AAGMDE+      + +G GAGPKIEEVD
Sbjct  606  ENVCNPIIAKMYQGGAGE--AAGMDEE-----PAPSGGGAGPKIEEVD  646



>ref|XP_004492128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=647

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 134/142 (94%), Gaps = 2/142 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKD+KISSKL P DKK IEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIKDDKISSKLSPSDKKLIEDAIEQAIQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGA--GPDV  182
            E+ICNPIIAKMYQGGA  GP+V
Sbjct  606  ETICNPIIAKMYQGGAGEGPEV  627



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMV+EAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL P DKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLNPADKKKIEDAIDQAIHWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG  G D+   MDED      S  G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGD-GADMGGRMDED----APSTGGSGAGPKIEEVD  648



>ref|XP_009374678.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=647

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 146/168 (87%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI +KL P DKKKIED+IE AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG D A  +D+D        + +G GPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGGDGAGPVDDD-----APPSASGPGPKIEEVD  647



>emb|CAA83548.1| PsHSC71.0 [Pisum sativum]
Length=647

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK++IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+ KL  +DKKKIED IEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTIKDDKIAGKLDSEDKKKIEDTIEQAIQWLDSNQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVA  179
            ES+CNPIIAKMYQGGAGPD+ 
Sbjct  605  ESVCNPIIAKMYQGGAGPDMG  625



>gb|EMS52605.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=647

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNTIKDEKI+SKL  DDKKKIEDAI+ AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E++CNPIIAKMYQ GAG D+  GMD+D           GAGPKIEEVD
Sbjct  606  EALCNPIIAKMYQ-GAGADMEGGMDDD-----TPAASGGAGPKIEEVD  647



>gb|EMT07406.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=647

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 146/168 (87%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNTIKDEKI+SKL  DDKKKIEDAI+ AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E++CNPIIAKMYQ GAG D+  GMD+D           G GPKIEEVD
Sbjct  606  EALCNPIIAKMYQ-GAGADMEGGMDDD-----TPAASGGPGPKIEEVD  647



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKISSKL   DKKKIEDAIEQA+QWLDGNQLAEADEF+DKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKISSKLSEADKKKIEDAIEQAVQWLDGNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQG A  D+   MDED       G  +GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGSA--DMGGQMDED---GPAPGGASGAGPKIEEVD  648



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   255 bits (651),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKK++AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKIDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKISSKL PDDKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKISSKLSPDDKKKIEDAIEQAIQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_003578898.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Brachypodium 
distachyon]
Length=648

 Score =   254 bits (650),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 147/169 (87%), Gaps = 7/169 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNTIKDEKI+SKL  DDKKKIEDAI+ AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV-AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ GAG D+  +GMDED           G GPKIEEVD
Sbjct  606  ESLCNPIIAKMYQ-GAGADMEGSGMDED-----TPAASGGPGPKIEEVD  648



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 150/168 (89%), Gaps = 7/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI+SKL   DKKKIEDAIE +IQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIASKLPAADKKKIEDAIESSIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG DV   MD+D      + +G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGGDVP--MDDD----APAPSGSGAGPKIEEVD  646



>tpg|DAA55190.1| TPA: heat shock protein70-4 [Zea mays]
Length=521

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 146/170 (86%), Gaps = 8/170 (5%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AE+YK+EDEEHKKKVEAK
Sbjct  358  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAK  417

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENY+YNMRNTIKDEKI+SKL  DDKKKIEDAI+ AI WLD NQLAEADEFEDKMKEL
Sbjct  418  NSLENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAISWLDANQLAEADEFEDKMKEL  477

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ GAG D+  A GMDED           G GPKIEEVD
Sbjct  478  ESLCNPIIAKMYQ-GAGEDMGGAGGMDED-----APAGSGGPGPKIEEVD  521



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI SKL PDDKKKIED I++AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIRDEKIGSKLSPDDKKKIEDTIDEAIQWLDNNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGA  194
            ESICNPIIAKMYQG A
Sbjct  606  ESICNPIIAKMYQGSA  621



>ref|XP_006644983.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=649

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 151/171 (88%), Gaps = 9/171 (5%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKM-VQEAEQYKAEDEEHKKKVEA  425
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKM VQEAE+YK+EDEEHKKKV+A
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMMVQEAEKYKSEDEEHKKKVDA  544

Query  424  KNALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKE  245
            KN+LENYAYNMRNTIKD+KI+SKL  DDKKKIEDAI+ AI WLDGNQLAEADEFEDKMKE
Sbjct  545  KNSLENYAYNMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDGNQLAEADEFEDKMKE  604

Query  244  LESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            LESICNPIIAKMYQ GAGPD+  A GMDED         G+GAGPKIEEVD
Sbjct  605  LESICNPIIAKMYQ-GAGPDMGGATGMDED-----VPAGGSGAGPKIEEVD  649



>gb|AAL85887.1|AF479058_1 70 kDa heat shock protein [Sandersonia aurantiaca]
Length=336

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 134/147 (91%), Gaps = 4/147 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  174  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESK  233

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAI+QAIQWLD NQLAEADEF+DKMKEL
Sbjct  234  NALENYAYNMRNTIKDDKIASKLPAADKKKIEDAIDQAIQWLDNNQLAEADEFDDKMKEL  293

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ESICNPIIAKMYQG      A G++ED
Sbjct  294  ESICNPIIAKMYQGAG----AGGVEED  316



>gb|AEO13403.1| heat shock 70 [Glycine max]
Length=560

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  397  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  456

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTIKD+KI+SKL  DDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  457  NTLENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  516

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  517  ESICNPIIAKMYQ  529



>ref|XP_004984739.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  MDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTI+D+KI+SKL   DKKKI++AIE AI WLD NQLAE DEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIRDDKIASKLPEADKKKIDEAIEGAITWLDNNQLAEVDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQG AGPD+A GM ED      +  G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGAAGPDMAGGMAED----APAAGGSGAGPKIEEVD  649



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 148/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEK+VQEAE++KAEDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKIS KL P DKKKIEDA+EQAIQWLD NQLAE+DEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIRDEKISGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGA    AA M++D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGGADMGSAA-MNDD----APPSGGSGAGPKIEEVD  648



>ref|XP_009338761.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Pyrus x bretschneideri]
Length=656

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 146/168 (87%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  494  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  553

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI +KL P DKKKIED+IE AIQWLD NQLAEADEFEDKMKEL
Sbjct  554  NALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKEL  613

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG D A  +D+D        + +G GPKIEEVD
Sbjct  614  ESICNPIIAKMYQ-GAGGDGAGPVDDD----DAPPSASGPGPKIEEVD  656



>ref|XP_004302715.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Fragaria vesca subsp. vesca]
Length=647

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 144/168 (86%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI  KL   DKKKIEDAIE AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGEKLPGADKKKIEDAIEAAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ G+GPD A  +D+D           GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GSGPDGAGPVDDD-----VPAGSGGAGPKIEEVD  647



>ref|XP_010231300.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brachypodium distachyon]
Length=649

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 148/170 (87%), Gaps = 7/170 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDKKK+EDAI+ AI WLD NQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTIKDEKIASKLGADDKKKVEDAIDGAISWLDTNQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVAA--GMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GA PD+    GMDED      +G  +GAGPKIEEVD
Sbjct  605  EGICNPIIAKMYQ-GAAPDMGGGMGMDED----APAGGSSGAGPKIEEVD  649



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 146/168 (87%), Gaps = 7/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAIE +IQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIESSIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG  G    A MD+D    G +   +G GPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGG---EAPMDDD----GPAPGASGPGPKIEEVD  646



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 149/170 (88%), Gaps = 6/170 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEE KKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEVKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAIEQAIQWLDGNQLAEA+E++DK+KEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEAEEYDDKVKEL  605

Query  241  ESICNPIIAKMYQGGAGPD--VAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQGGA PD  +  GMDED         G+GAGPKIEEVD
Sbjct  606  EGICNPIIAKMYQGGAAPDMGMGGGMDED----VPPAGGSGAGPKIEEVD  651



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DD+ KIEDAIEQAIQWLDGNQLAEA+EFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQLAEAEEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAG  191
            ES+CNPIIAKMYQG  G
Sbjct  606  ESLCNPIIAKMYQGAGG  622



>dbj|BAJ91305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=647

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 146/168 (87%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNTIKDEKI+SKL  DDKKKIE+AI+ AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYSYNMRNTIKDEKIASKLPADDKKKIEEAIDAAIQWLDTNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E++CNPIIAKMYQ GAG D+  GMD+D           G GPKIEEVD
Sbjct  606  EALCNPIIAKMYQ-GAGADMEGGMDDD-----TPAASGGPGPKIEEVD  647



>ref|XP_002805956.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Macaca mulatta]
Length=224

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHK+KVE+K
Sbjct  58   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKRKVESK  117

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKDEKI++K+ P DKKKI+DAIEQAIQWLD NQLAEADEF+DKMKEL
Sbjct  118  NSLENYAYNMRNTIKDEKIAAKVDPSDKKKIDDAIEQAIQWLDNNQLAEADEFDDKMKEL  177

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  178  ESICNPIIAKMYQ  190



>ref|XP_003621886.1| Heat shock protein [Medicago truncatula]
 gb|AES78104.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 145/168 (86%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKDEKISSKL   DKK+IEDAIE AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIKDEKISSKLSGGDKKQIEDAIEGAIQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E+ICNPIIAKMYQGGAG     G + D  +A       GAGPKIEEVD
Sbjct  606  ETICNPIIAKMYQGGAG----EGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI +KL P+DKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGAKLPPEDKKKIEDAIEQAIQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ES+CNPIIAKMYQG  G D    MDED
Sbjct  606  ESLCNPIIAKMYQGSGGGDFGGAMDED  632



>ref|NP_001140835.1| uncharacterized protein LOC100272911 [Zea mays]
 gb|ACF84762.1| unknown [Zea mays]
Length=562

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTG+KNKITITNDKGRLSKEEIE+MVQEAE+YK EDEE K+KVEA+
Sbjct  397  IDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKTEDEEVKRKVEAR  456

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT++DEKI+SKL  DDKKKIED IE AI+WLDGNQLAEA+EFEDKMKEL
Sbjct  457  NALENYAYNMRNTVRDEKIASKLPADDKKKIEDTIEDAIKWLDGNQLAEAEEFEDKMKEL  516

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ESICNPII++MYQGGAG   AAGMDED
Sbjct  517  ESICNPIISQMYQGGAG---AAGMDED  540



>gb|AII99890.1| heat shock protein [Cicer arietinum]
Length=847

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 134/142 (94%), Gaps = 2/142 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAK
Sbjct  686  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAK  745

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKD+KISSKL P DKK IEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  746  NSLENYAYNMRNTIKDDKISSKLSPSDKKLIEDAIEQAIQWLDANQLAEADEFEDKMKEL  805

Query  241  ESICNPIIAKMYQGGA--GPDV  182
            E+ICNPIIAKMYQGGA  GP+V
Sbjct  806  ETICNPIIAKMYQGGAGEGPEV  827



>gb|AAV98051.1| heat shock protein 70 [Medicago sativa]
Length=649

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 145/168 (86%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKDEKISSKL   DKK+IEDAIE AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIKDEKISSKLSGGDKKQIEDAIEGAIQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E+ICNPIIAKMYQGGAG     G + D  +A       GAGPKIEEVD
Sbjct  606  ETICNPIIAKMYQGGAG----EGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>dbj|BAK00257.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=648

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 146/170 (86%), Gaps = 8/170 (5%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVDAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI+SKL  DDKKK+EDA+E  I WLDGNQLAEA+EFEDKMKEL
Sbjct  545  NALENYAYNMRNTVKDEKIASKLGADDKKKVEDAVEGTISWLDGNQLAEAEEFEDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVAA--GMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GA PD+    GMDED         G GAGPKIEEVD
Sbjct  605  EGICNPIIAKMYQ-GAAPDMGGGMGMDED-----MPAGGGGAGPKIEEVD  648



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 136/149 (91%), Gaps = 6/149 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+Y++EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYRSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KISSKLQP DKKKIEDAI++AI+WLD NQL EADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKISSKLQPADKKKIEDAIDEAIKWLDANQLGEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAG--PDVAAGMDED  161
            E ICNPIIAKMYQGG G  PD    MD+D
Sbjct  606  EGICNPIIAKMYQGGEGGAPD----MDDD  630



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 151/168 (90%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL P DKKKIEDAI+ AI WLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLPPADKKKIEDAIDSAIHWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG  G DV  GMDED    G SG G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGGADVGGGMDED----GPSGGGSGAGPKIEEVD  649



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAERYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNTIKD+KISSKL  +DKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYSYNMRNTIKDDKISSKLSAEDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ GAG +  A MD+D          TGAGPKIEEVD
Sbjct  606  ESLCNPIIAKMYQ-GAGGEAGAPMDDD---DAPPAGSTGAGPKIEEVD  649



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL  DDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLSSDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  483  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  542

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL  DDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  543  NALENYAYNMRNTIKDDKIASKLSSDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  602

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  603  ESICNPIIAKMYQ  615



>gb|EMS45385.1| Heat shock cognate 70 kDa protein 1 [Triticum urartu]
Length=762

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 146/168 (87%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  601  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  660

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNTIKDEKI+SKL  DDKKKIEDAI+ AIQWLD NQLAEADEFEDKMKEL
Sbjct  661  NALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADEFEDKMKEL  720

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E++CNPIIAKMYQ GAG D+  GMD+D           G GPKIEEVD
Sbjct  721  EALCNPIIAKMYQ-GAGADMEGGMDDD-----TPAASGGPGPKIEEVD  762



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   252 bits (644),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 145/168 (86%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI +KL P DKKKIED+IE AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG D A  +D++          +G GPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGADGAGPVDDE-----APAGASGPGPKIEEVD  647



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   252 bits (643),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 145/168 (86%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  474  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  533

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI +KL P DKKKIED+IE AIQWLD NQLAEADEFEDKMKEL
Sbjct  534  NALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKEL  593

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG D A  +D++          +G GPKIEEVD
Sbjct  594  ESICNPIIAKMYQ-GAGADGAGPVDDE-----APAGASGPGPKIEEVD  635



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 145/170 (85%), Gaps = 7/170 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIE+MVQEAE+YK+EDE+HKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIERMVQEAEKYKSEDEDHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI  KL  DDKKKIED+IE AI+WL+GNQLAE DEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIRDEKIGEKLAADDKKKIEDSIEGAIEWLEGNQLAECDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAG--PDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGG G  P  + GMD+D        +  G GPKIEEVD
Sbjct  606  ESICNPIIAKMYQGGEGGVPGASGGMDDD-----APPSTGGPGPKIEEVD  650



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTIKD+KI+SKL  DDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NTLENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_004142750.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156713.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=613

 Score =   251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEK+VQEAE++KAEDEEHKKKVE+K
Sbjct  451  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKKKVESK  510

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI  KL P DKKKIEDA+EQAIQWLD NQLAE+DEFEDKMKEL
Sbjct  511  NALENYAYNMRNTIRDEKIGGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFEDKMKEL  570

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGA    AA M++D         G+GAGPKIEEVD
Sbjct  571  ESICNPIIAKMYQGGADMGGAA-MNDD----APPSGGSGAGPKIEEVD  613



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL P +KKKIEDAI+QAI WLD NQLAEADEFEDKMKE+
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLNPAEKKKIEDAIDQAIHWLDSNQLAEADEFEDKMKEV  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAK+YQG  G D+   MDED      S  G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKIYQGD-GADMGGRMDED----APSTGGSGAGPKIEEVD  648



>gb|ACT34017.1| heat shock cognate 70 kDa protein [Cenchrus americanus]
 gb|ACY00390.1| heat shock cognate 70 kDa protein [Cenchrus americanus]
Length=649

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKV+AK
Sbjct  486  MDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTI+D+KI+SKL   DKKKI++AIE AI WLD NQLAE DEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIRDDKIASKLPEADKKKIDEAIEGAITWLDNNQLAEVDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIA+MYQG AGPD+A GM ED      +  G+GAGPKIEEVD
Sbjct  606  EGICNPIIARMYQGAAGPDMAGGMAED----APAAGGSGAGPKIEEVD  649



>ref|XP_003563611.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=648

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 144/168 (86%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK++IEKMVQ+AE+YK+EDEEHKKKVEAK
Sbjct  487  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQDAEKYKSEDEEHKKKVEAK  546

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTI DEKI+SKL  DDKKKIEDA++QAIQWLD NQLAE DEFEDKMKEL
Sbjct  547  NTLENYAYNMRNTISDEKIASKLPADDKKKIEDAVDQAIQWLDNNQLAEVDEFEDKMKEL  606

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E +CNPIIAKMYQ GAG D+  GMDED           GAGPKIEEVD
Sbjct  607  EGLCNPIIAKMYQ-GAGADMPGGMDED-----APAASGGAGPKIEEVD  648



>dbj|BAA34919.1| heat shock protein 70 cognate [Salix gilgiana]
Length=408

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  246  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESK  305

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT+KDEKISSKL  DDKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  306  NSLENYAYNMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  365

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  366  ESICNPIIAKMYQ  378



>gb|AEO22185.1| CytHSP70 [Triticum aestivum]
Length=540

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YKAEDEEHKKKV++K
Sbjct  375  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDSK  434

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAIE AI WLD NQLAEADEF+DKMKEL
Sbjct  435  NALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMKEL  494

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG ++  GMDED   A  +G  +G GPKIEEVD
Sbjct  495  EGICNPIIAKMYQ-GAGAEMPGGMDED-APASAAGGSSGPGPKIEEVD  540



>gb|AAK59628.2| putative dnaK-type molecular chaperone hsc70.1 protein [Arabidopsis 
thaliana]
Length=215

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 132/162 (81%), Gaps = 22/162 (14%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  50   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAK  109

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI  KL   DKKKIED+IEQAIQWL+GNQLAEADEFEDKMKEL
Sbjct  110  NALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKEL  169

Query  241  ESICNPIIAKMYQ----------------------GGAGPDV  182
            ESICNPIIAKMYQ                      GGAGP +
Sbjct  170  ESICNPIIAKMYQGAGGEAGGPGASGMDDDAPPASGGAGPKI  211



>emb|CAA67588.1| 70 kD heatshockprotein [Medicago sativa]
Length=214

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+E+ EHKKKVEAK
Sbjct  51   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEETEHKKKVEAK  110

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL  DDKKKIEDAIE AIQWLDGNQL EADEFEDKMKEL
Sbjct  111  NALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADEFEDKMKEL  170

Query  241  ESICNPIIAKMYQ  203
            E ICNPII KMYQ
Sbjct  171  EGICNPIIGKMYQ  183



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   252 bits (643),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG  GPDV  GMDED         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGGPDVGGGMDED----VPPAGGSGAGPKIEEVD  649



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEK+VQEAE++KAEDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI  KL P DKKKIEDA+EQAIQWLD NQLAE+DEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIRDEKIGGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGA    AA M++D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGGADMGGAA-MNDD----APPSGGSGAGPKIEEVD  648



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   252 bits (643),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG  GPDV  GMDED         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGGPDVGGGMDED----VPPPGGSGAGPKIEEVD  649



>ref|XP_006649850.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Oryza brachyantha]
Length=655

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 148/168 (88%), Gaps = 3/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  491  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  550

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKD+KI+SKL   DKKKIEDAI+ AI WLD NQLAEA+EFEDKMKEL
Sbjct  551  NSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEEFEDKMKEL  610

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E +CNPIIAKMYQ GAG D+A GMDED  +   +G  +G GPKIEEVD
Sbjct  611  EGVCNPIIAKMYQ-GAGADMAGGMDED--APPAAGGSSGPGPKIEEVD  655



>ref|XP_004981251.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Setaria 
italica]
Length=648

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 147/168 (88%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQ+AE+YK+EDEEHKKKVEAK
Sbjct  487  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQDAEKYKSEDEEHKKKVEAK  546

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTI+DEKI+SKL  DDKKKIEDA+EQAIQWLD NQLAE +EFEDKMKEL
Sbjct  547  NSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDSNQLAEVEEFEDKMKEL  606

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E +CNPIIAKMYQ GAG D+A GM++D           GAGPKIEEVD
Sbjct  607  EGLCNPIIAKMYQ-GAGADMAGGMEDD-----APAAPGGAGPKIEEVD  648



>gb|AHW48175.1| heat shock protein 70, partial [Triticum aestivum]
Length=539

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YKAEDEEHKKKV++K
Sbjct  374  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDSK  433

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAIE AI WLD NQLAEADEF+DKMKEL
Sbjct  434  NALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMKEL  493

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG ++  GMDED   A  +G  +G GPKIEEVD
Sbjct  494  EGICNPIIAKMYQ-GAGAEMPGGMDED-APASAAGGSSGPGPKIEEVD  539



>gb|ACJ85522.1| unknown [Medicago truncatula]
 gb|AFK38758.1| unknown [Medicago truncatula]
Length=649

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKDEKISSKL   DKK+IEDAIE A QWLD NQLAEADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIKDEKISSKLSGGDKKQIEDAIEGAFQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E+ICNPIIAKMYQGGAG     G + D  +A       GAGPKIEEVD
Sbjct  606  ETICNPIIAKMYQGGAG----EGPEVDDDAAPPPSGSGGAGPKIEEVD  649



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANG LNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGTLNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DD+ KIEDAIEQAIQWLDGNQLAEA+EFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQLAEAEEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAG  191
            ES+CNPIIAKMYQG  G
Sbjct  606  ESLCNPIIAKMYQGAGG  622



>emb|CAA55183.1| heat shock protein 70 kDa [Zea mays]
Length=219

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 142/170 (84%), Gaps = 8/170 (5%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AE+YK+EDEEHKKKVEAK
Sbjct  56   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAK  115

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENY+YNMRNTIKDEKI+SKL  DDKKKIEDAI+ AI WLD +Q AEADEFE KMKEL
Sbjct  116  NSLENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAISWLDADQPAEADEFEYKMKEL  175

Query  241  ESICNPIIAKMYQGGAGPDVA--AGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMY+ GAG D+    GMDED             GPKIEEVD
Sbjct  176  ESLCNPIIAKMYK-GAGEDMGRPGGMDED-----APAGSAAPGPKIEEVD  219



>ref|XP_008674324.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|ACL53191.1| unknown [Zea mays]
 tpg|DAA55191.1| TPA: heat shock protein70-4 isoform 1 [Zea mays]
 tpg|DAA55192.1| TPA: heat shock protein70-4 isoform 2 [Zea mays]
 tpg|DAA55193.1| TPA: heat shock protein70-4 isoform 3 [Zea mays]
Length=649

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 146/170 (86%), Gaps = 8/170 (5%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENY+YNMRNTIKDEKI+SKL  DDKKKIEDAI+ AI WLD NQLAEADEFEDKMKEL
Sbjct  546  NSLENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAISWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ GAG D+  A GMDED           G GPKIEEVD
Sbjct  606  ESLCNPIIAKMYQ-GAGEDMGGAGGMDED-----APAGSGGPGPKIEEVD  649



>ref|XP_011027180.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=649

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KD+KISSKL  DDKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQG  200
            ESICNPIIAKMYQG
Sbjct  606  ESICNPIIAKMYQG  619



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   D+KKIE+AIEQAIQWLD NQLAE+DEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLPEADRKKIEEAIEQAIQWLDANQLAESDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG D+ A M +D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGGDMGADMGDD---GPAPSGGSGAGPKIEEVD  649



>ref|XP_003552695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Glycine 
max]
 gb|KHN13895.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=647

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEGK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKISSKL  +DK KI++AIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKISSKLSSEDKTKIDNAIEQAIQWLDTNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAG  191
            E ICNPIIAKMYQGGAG
Sbjct  606  EGICNPIIAKMYQGGAG  622



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   D+KKIE+AIEQAIQWLD NQLAE+DEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLPEADRKKIEEAIEQAIQWLDANQLAESDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQ GAG D+ A M +D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQ-GAGGDMGADMGDD---GPAPSGGSGAGPKIEEVD  649



>gb|ACJ54890.1| heat shock protein 70 [Oryza sativa Japonica Group]
Length=653

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 2/147 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTG+KNKITITNDKGRLSKEEIE+MVQEAE+YKAEDE+ + KVEA+
Sbjct  487  IDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKAEDEQVRHKVEAR  546

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT++DEKI+SKL  DDKKKIEDAIE AI+WLDGNQLAEADEFEDKMKEL
Sbjct  547  NALENYAYNMRNTVRDEKIASKLPADDKKKIEDAIEDAIKWLDGNQLAEADEFEDKMKEL  606

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ES+CNPII+KMYQGGAG    AGMDED
Sbjct  607  ESLCNPIISKMYQGGAGG--PAGMDED  631



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKI ITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKIPITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DD+ KIEDAIEQAIQWLDGNQLAEA+EFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQLAEAEEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAG  191
            ES+CNPIIAKMYQG  G
Sbjct  606  ESLCNPIIAKMYQGAGG  622



>gb|ABF95267.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ26449.1| hypothetical protein OsJ_10337 [Oryza sativa Japonica Group]
Length=653

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 2/147 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTG+KNKITITNDKGRLSKEEIE+MVQEAE+YKAEDE+ + KVEA+
Sbjct  487  IDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKAEDEQVRHKVEAR  546

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT++DEKI+SKL  DDKKKIEDAIE AI+WLDGNQLAEADEFEDKMKEL
Sbjct  547  NALENYAYNMRNTVRDEKIASKLPADDKKKIEDAIEDAIKWLDGNQLAEADEFEDKMKEL  606

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ES+CNPII+KMYQGGAG    AGMDED
Sbjct  607  ESLCNPIISKMYQGGAGG--PAGMDED  631



>ref|XP_008658250.1| PREDICTED: uncharacterized protein LOC100272911 isoform X1 [Zea 
mays]
 gb|AFW88811.1| hypothetical protein ZEAMMB73_832667 [Zea mays]
Length=652

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTG+KNKITITNDKGRLSKEEIE+MVQEAE+YK EDEE K+KVEA+
Sbjct  487  IDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKTEDEEVKRKVEAR  546

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT++DEKI+SKL  DDKKKIED IE AI+WLDGNQLAEA+EFEDKMKEL
Sbjct  547  NALENYAYNMRNTVRDEKIASKLPADDKKKIEDTIEDAIKWLDGNQLAEAEEFEDKMKEL  606

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ESICNPII++MYQGGAG   AAGMDED
Sbjct  607  ESICNPIISQMYQGGAG---AAGMDED  630



>gb|AFW88810.1| hypothetical protein ZEAMMB73_832667 [Zea mays]
Length=782

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 152/169 (90%), Gaps = 4/169 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTG+KNKITITNDKGRLSKEEIE+MVQEAE+YK EDEE K+KVEA+
Sbjct  617  IDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKTEDEEVKRKVEAR  676

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT++DEKI+SKL  DDKKKIED IE AI+WLDGNQLAEA+EFEDKMKEL
Sbjct  677  NALENYAYNMRNTVRDEKIASKLPADDKKKIEDTIEDAIKWLDGNQLAEAEEFEDKMKEL  736

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgp-saggsgtgtgagPKIEEVD  98
            ESICNPII++MYQGGAG   AAGMDED P    G+G G+GAGPKIEEVD
Sbjct  737  ESICNPIISQMYQGGAG---AAGMDEDVPGGGAGNGGGSGAGPKIEEVD  782



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KISSKL   DKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKISSKLPAADKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>gb|ABP01597.1| heat shock protein 70 [Ageratina adenophora]
Length=301

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 131/160 (82%), Gaps = 20/160 (13%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  138  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  197

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI  KL P DKKKIEDAI++AI WLD NQLAEADEFEDKMKEL
Sbjct  198  NALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAIAWLDANQLAEADEFEDKMKEL  257

Query  241  ESICNPIIAKMYQ--------------------GGAGPDV  182
            E++CNPIIAKMYQ                    GGAGP +
Sbjct  258  ENVCNPIIAKMYQGGAGDAAGAGGMDEEPAPSGGGAGPKI  297



>gb|KDO67650.1| hypothetical protein CISIN_1g0212722mg, partial [Citrus sinensis]
Length=206

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  39   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  98

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD++I SKL   DKK+IED IE+A+QWLD NQLAEADEFEDKMKEL
Sbjct  99   NALENYAYNMRNTIKDDQIGSKLSAADKKRIEDTIEEAMQWLDSNQLAEADEFEDKMKEL  158

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  159  ESICNPIIAKMYQ  171



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMV+EAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVEEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI +KL P DKKKIEDAI+QAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGAKLDPADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQG  200
            E ICNPIIA+MYQG
Sbjct  606  EGICNPIIARMYQG  619



>emb|CDY40362.1| BnaA10g27060D [Brassica napus]
Length=454

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 143/167 (86%), Gaps = 7/167 (4%)
 Frame = -1

Query  598  DANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAKN  419
            DANGILNVS EDKTTGQKNKITITNDKGRLSK++IEKMVQEAE+YK+EDEEHKKKVEAKN
Sbjct  295  DANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAKN  354

Query  418  ALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELE  239
            ALENYAYNMRNTI+DEKI  KL   DKKKIE++IEQAIQWL+ NQL EADEFEDKMKELE
Sbjct  355  ALENYAYNMRNTIQDEKIGEKLPAADKKKIEESIEQAIQWLENNQLGEADEFEDKMKELE  414

Query  238  SICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            SICNPIIAKMYQG  G   AAGMD+D           GAGPKIEEVD
Sbjct  415  SICNPIIAKMYQGAGGE--AAGMDDD-----APPASGGAGPKIEEVD  454



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  MDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKDEKI+SKL  DDKKKIEDAI+QAIQWLDGNQL EADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIKDEKIASKLPADDKKKIEDAIDQAIQWLDGNQLGEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|NP_001049712.1| Os03g0276500 [Oryza sativa Japonica Group]
 gb|ABF95258.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11626.1| Os03g0276500 [Oryza sativa Japonica Group]
 gb|EAZ26443.1| hypothetical protein OsJ_10329 [Oryza sativa Japonica Group]
 dbj|BAG93163.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADR66978.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=650

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 148/168 (88%), Gaps = 3/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKD+KI+SKL   DKKKIEDAI+ AI WLD NQLAEA+EFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAISWLDSNQLAEAEEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E +CNPIIAKMYQ GAG D+A GMDED  +   +G  +G GPKIEEVD
Sbjct  606  EGVCNPIIAKMYQ-GAGADMAGGMDED--APAAAGGSSGPGPKIEEVD  650



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 149/168 (89%), Gaps = 6/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTIKDEKI+SKL  DDKKKIEDAI+QAIQWL+ NQLAEADEF+DKMKEL
Sbjct  546  NTLENYAYNMRNTIKDEKIASKLAADDKKKIEDAIDQAIQWLESNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAGPD+  GM +D      +G G+ AGPKIEEVD
Sbjct  606  EGICNPIIAKMYQ-GAGPDM-GGMPDD----IPTGGGSSAGPKIEEVD  647



>gb|EMS68426.1| Heat shock cognate 70 kDa protein 4 [Triticum urartu]
Length=648

 Score =   250 bits (639),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 144/170 (85%), Gaps = 8/170 (5%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVDAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KD+KI+SKL  DDKKK+E+AIE  I WLD NQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTVKDDKIASKLGADDKKKVEEAIEGTISWLDANQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVAA--GMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GA PD+    GMDED           GAGPKIEEVD
Sbjct  605  EGICNPIIAKMYQ-GAAPDMGGGMGMDED-----MPAGAGGAGPKIEEVD  648



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 134/159 (84%), Gaps = 19/159 (12%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  353  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESK  412

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT+KDEKISSKL  DDKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  413  NSLENYAYNMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  472

Query  241  ESICNPIIAKMYQ-------------------GGAGPDV  182
            ESICNPIIAKMYQ                   GGAGP +
Sbjct  473  ESICNPIIAKMYQGAGADMGGGMEEDAPPAGSGGAGPKI  511



>gb|AAB99745.1| HSP70 [Triticum aestivum]
 gb|EMT04103.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=648

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 145/170 (85%), Gaps = 8/170 (5%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKAEDEEHKKKVDAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KD+KI+SKL  DDKKK+E+AIE  I WLD NQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTVKDDKIASKLGADDKKKVEEAIEGTISWLDANQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVAA--GMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GA PD+    GMDED         G GAGPKIEEVD
Sbjct  605  EGICNPIIAKMYQ-GAAPDMGGGMGMDED-----MPAGGGGAGPKIEEVD  648



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 145/168 (86%), Gaps = 8/168 (5%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI  KL P+DKKKIEDAI+ A+ WLD NQLAEA EFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGEKLSPEDKKKIEDAIDGAVSWLDNNQLAEAGEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E++CNPIIAKMYQGGAG    A MD+D         G+GAGPKIEEVD
Sbjct  606  ENVCNPIIAKMYQGGAGD---AAMDDD-----VPAGGSGAGPKIEEVD  645



>ref|XP_004156719.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 2 [Cucumis 
sativus]
Length=547

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKA+DEEHKKKVEAK
Sbjct  381  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAK  440

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT++DEK SSKL P DKKKIEDAIEQA+QWLD NQLAEADEFEDKMKEL
Sbjct  441  NSLENYAYNMRNTVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADEFEDKMKEL  500

Query  241  ESICNPIIAKMYQ  203
            ESICNPI+AKMYQ
Sbjct  501  ESICNPIVAKMYQ  513



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI SKL P DKKKIEDAI+QAIQWLDGNQLAEADEF+DKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIGSKLDPADKKKIEDAIDQAIQWLDGNQLAEADEFKDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIA+MYQ
Sbjct  606  ESICNPIIARMYQ  618



>ref|XP_008660826.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 tpg|DAA47114.1| TPA: heat shock protein 70 [Zea mays]
Length=649

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 146/170 (86%), Gaps = 8/170 (5%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKDEKI+SKL  DDKKKIEDAI+ AI WLD NQLAEADEF+DKMKEL
Sbjct  546  NSLENYAYNMRNTIKDEKIASKLAADDKKKIEDAIDAAISWLDANQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDV--AAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ GAG D+  + GMDED           G GPKIEEVD
Sbjct  606  ESLCNPIIAKMYQ-GAGADMGGSGGMDED-----APAGSGGPGPKIEEVD  649



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL P DKKKIEDAI+ AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>gb|AAP42157.1|AF509339_1 heat shock protein 70 [Saussurea medusa]
Length=427

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 131/158 (83%), Gaps = 18/158 (11%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  266  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  325

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI  KL P DKKKIEDAI++AI WLD NQLAEADEFEDKMKEL
Sbjct  326  NALENYAYNMRNTVKDEKIGEKLTPGDKKKIEDAIDEAISWLDSNQLAEADEFEDKMKEL  385

Query  241  ESICNPIIAKMYQ------------------GGAGPDV  182
            E++CNPIIAKMYQ                  GGAGP +
Sbjct  386  ENVCNPIIAKMYQGGAGDAAGGMDEDAAPSGGGAGPKI  423



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL P DKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLDPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>dbj|BAJ86014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YKAEDEEHKKKV++K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDSK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAIE AI WLD NQLAEADEF+DKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLPEADKKKIEDAIEGAITWLDNNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG ++  GMDED   A  +G  +G GPKIEEVD
Sbjct  606  EGICNPIIAKMYQ-GAGAEMPGGMDED-APASAAGGSSGPGPKIEEVD  651



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL  DDKKKIEDAI+QAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLSTDDKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            E ICNPIIA+MYQ
Sbjct  606  EGICNPIIARMYQ  618



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKDEKI SKL P DKKKIEDAI+ AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIKDEKIGSKLDPADKKKIEDAIDGAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>gb|KJB20110.1| hypothetical protein B456_003G133400 [Gossypium raimondii]
Length=648

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 1/143 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI +KL P DKK+IEDA+EQ I WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGAKLNPADKKRIEDAVEQTINWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAG  173
            E++CNPIIAKMYQ GAG + AAG
Sbjct  606  ENMCNPIIAKMYQ-GAGGEPAAG  627



>gb|ABR13285.1| putative dnaK-type molecular chaperone hsc70.1 [Prunus dulcis]
Length=179

 Score =   234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKV AK
Sbjct  49   IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVGAK  108

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI +KL P DKKKIED+IE AIQWLD NQLAEADEFEDKMKEL
Sbjct  109  NALENYAYNMRNTIKDEKIGAKLPPADKKKIEDSIETAIQWLDSNQLAEADEFEDKMKEL  168

Query  241  ESICNPIIAKM  209
            ESICNPIIAKM
Sbjct  169  ESICNPIIAKM  179



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE MVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIENMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKIS+KL P DKKKIEDA+EQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKISAKLPPADKKKIEDAVEQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  455  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  514

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKISSKL   DKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  515  NALENYAYNMRNTIKDEKISSKLAAADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  574

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  575  ESICNPIIAKMYQ  587



>emb|CAA31663.1| hsp70 (AA 6 - 651) [Petunia x hybrida]
Length=646

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 151/169 (89%), Gaps = 4/169 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YK+EDEE KKKVEAK
Sbjct  481  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKKKVEAK  540

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+S+L   DKK+IEDAI++AI+WLD NQLAEADEFEDKMKEL
Sbjct  541  NALENYAYNMRNTIKDDKINSQLSAADKKRIEDAIDEAIKWLDNNQLAEADEFEDKMKEL  600

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDg-psaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGAG    A MDEDG    G +G+ TGAGPKIEEVD
Sbjct  601  ESICNPIIAKMYQGGAG---GATMDEDGPSVGGSAGSQTGAGPKIEEVD  646



>gb|EEC71767.1| hypothetical protein OsI_04375 [Oryza sativa Indica Group]
Length=423

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  260  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  319

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL  DDKKKIEDAI+ AI WLD NQLAEADEFEDKMKEL
Sbjct  320  NALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIDGAINWLDSNQLAEADEFEDKMKEL  379

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  380  ESICNPIIAKMYQ  392



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 132/140 (94%), Gaps = 1/140 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKV+AK
Sbjct  579  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAK  638

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKIS+KL   DKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  639  NALENYAYNMRNTIKDEKISAKLSEGDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  698

Query  241  ESICNPIIAKMYQGGAGPDV  182
            ESICNPIIAKMYQ GAG D+
Sbjct  699  ESICNPIIAKMYQ-GAGADM  717



>ref|XP_009357719.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=649

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  605  ESICNPIIAKMYQ  617



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 146/168 (87%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL   DKKKIEDAIE +IQWLD NQLAE+DEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIEASIQWLDANQLAESDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG  G    A MD+D   A  S  G+ AGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGG---EAPMDDD--EAAPSHGGSTAGPKIEEVD  648



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL P DKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLAPADKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 151/169 (89%), Gaps = 4/169 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YK+EDEE KKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+S+L   DKK+IEDAI++AI+WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKINSQLSAADKKRIEDAIDEAIKWLDNNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDg-psaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGAG    A MDEDG    G +G+ TGAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGGAG---GATMDEDGPSVGGSAGSQTGAGPKIEEVD  651



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KISSKL  DDKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 133/151 (88%), Gaps = 6/151 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKK+VEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKRVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI++KL   DKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIAAKLDAADKKKIEDAIEQAIQWLDNNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQG------GAGPDVAAGMD  167
            E+ICNPIIAKMYQ       G+ P  A G D
Sbjct  606  ETICNPIIAKMYQAGGADMPGSAPPFAGGAD  636



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI +KL P DKKKIEDAIE AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGAKLSPADKKKIEDAIESAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDE+HKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEDHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL  DDKKKIEDAIEQAIQWL+GNQL EADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAIEQAIQWLEGNQLGEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL   DKKKIEDAI+QAIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLDAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_003558228.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=651

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKD+KI+SKL   DKKKIEDAI+ AI WLD NQLAEADEF+DKMKEL
Sbjct  546  NSLENYAYNMRNTIKDDKIASKLPEADKKKIEDAIDGAITWLDNNQLAEADEFDDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG ++  GMDED   A  +G  +G GPKIEEVD
Sbjct  606  EGICNPIIAKMYQ-GAGAEMPGGMDED-TPASTAGGSSGPGPKIEEVD  651



>gb|EMT15100.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=1430

 Score =   255 bits (651),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -1

Query  598  DANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAKN  419
            DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+KN
Sbjct  487  DANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKN  546

Query  418  ALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKELE  239
            ALENY+YNMRNTIKDEKI+SKL  DDKKKIEDAI+ AIQWLD NQLAEADEFEDKMKELE
Sbjct  547  ALENYSYNMRNTIKDEKIASKLPADDKKKIEDAIDAAIQWLDTNQLAEADEFEDKMKELE  606

Query  238  SICNPIIAKMYQGGAGPDVAAGMDED  161
            ++CNPIIAKMYQ GAG D+  GMD+D
Sbjct  607  ALCNPIIAKMYQ-GAGADMEGGMDDD  631



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK+EIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI SKL P DKKKIEDAI+QAI WLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGSKLSPADKKKIEDAIDQAISWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  486  MDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKDEKI+SKL  +DKKKIEDAI+QAIQWLDGNQL EADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTIKDEKIASKLPAEDKKKIEDAIDQAIQWLDGNQLGEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ES+CNPIIAKMYQ
Sbjct  606  ESLCNPIIAKMYQ  618



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL  DDK KI+DAIEQAIQWLDGNQLAEA+EFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLSADDKTKIDDAIEQAIQWLDGNQLAEAEEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ES+CNPIIAKMYQ
Sbjct  606  ESLCNPIIAKMYQ  618



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI +KL P DKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGAKLPPADKKKIEDAIEQAIQWLDNNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKA+DEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT++DEK SSKL P DKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTVRDEKFSSKLDPADKKKIEDAIEQAIQWLDNNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPI+AKMYQ
Sbjct  606  ESICNPIVAKMYQ  618



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNTIKD+KISSKL   DKKKIEDAI+ AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYSYNMRNTIKDDKISSKLDAADKKKIEDAIDGAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAG  191
            ESICNPIIAKMYQG  G
Sbjct  606  ESICNPIIAKMYQGAGG  622



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 142/168 (85%), Gaps = 7/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITIT DKGRLSK++IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITTDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI  KL   DKKKIEDAIEQAIQWL+ NQL EADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTIQDEKIGEKLPAADKKKIEDAIEQAIQWLENNQLGEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG  G   AAGMD+D           GAGPKIEEVD
Sbjct  605  ESICNPIIAKMYQGAGGE--AAGMDDD-----APPASGGAGPKIEEVD  645



>ref|XP_002465468.1| hypothetical protein SORBIDRAFT_01g039390 [Sorghum bicolor]
 gb|EER92466.1| hypothetical protein SORBIDRAFT_01g039390 [Sorghum bicolor]
Length=652

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 137/147 (93%), Gaps = 3/147 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTG+KNKITITNDKGRLSKEEIE+MVQEAE+YKAEDEE K+KVEA+
Sbjct  487  IDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKAEDEEVKRKVEAR  546

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT++DEKI+SKL  +DKKKIED +E AI+WLDGNQLAEA+EFED+MKEL
Sbjct  547  NALENYAYNMRNTVRDEKIASKLPAEDKKKIEDTVEDAIKWLDGNQLAEAEEFEDEMKEL  606

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            E++CNPII+KMYQGGAG   AAGMDED
Sbjct  607  ENVCNPIISKMYQGGAG---AAGMDED  630



>ref|XP_004984743.1| PREDICTED: heat shock cognate 70 kDa protein-like [Setaria italica]
Length=650

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 3/168 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTG+KNKITITNDKGRLSKEEIE+MVQEAE+YKAEDEE K+KVEA+
Sbjct  486  IDANGILNVSAEDKTTGKKNKITITNDKGRLSKEEIERMVQEAEKYKAEDEEVKRKVEAR  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT++D+KI+SKL  +D+KKIED IE AI+WLDGNQLAEA+EFEDKMKEL
Sbjct  546  NALENYAYNMRNTVRDDKIASKLPAEDRKKIEDTIEDAIKWLDGNQLAEAEEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPII+KMYQG  G   AAGMDED P+  G+G G+GAGPKIEEVD
Sbjct  606  EGICNPIISKMYQGEGG---AAGMDEDVPNGAGTGGGSGAGPKIEEVD  650



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KD+KISSKL  DDKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 142/168 (85%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEE KKKVEAK
Sbjct  488  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEELKKKVEAK  547

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT+KDEKI SKL  DDKKKIEDA++QAI WL+ NQLAE DEFEDKMKEL
Sbjct  548  NSLENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDEFEDKMKEL  607

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D    MD+D         G+ AGPKIEEVD
Sbjct  608  EGICNPIIAKMYQ-GAGGDAGVPMDDD----APPSGGSSAGPKIEEVD  650



>ref|XP_009122774.1| PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa protein 18 
[Brassica rapa]
Length=577

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 143/168 (85%), Gaps = 7/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK++IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  417  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAK  476

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI  KL   DKKKIE++IEQAIQWL+ NQL EADEFEDKMKEL
Sbjct  477  NALENYAYNMRNTIQDEKIGEKLPAADKKKIEESIEQAIQWLENNQLGEADEFEDKMKEL  536

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG  G   AAGMD+D           GAGPKIEEVD
Sbjct  537  ESICNPIIAKMYQGAGGE--AAGMDDD-----APPASGGAGPKIEEVD  577



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKA+DEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT++DEK SSKL P DKKKIEDAIEQA+QWLD NQLAEADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPI+AKMYQ
Sbjct  606  ESICNPIVAKMYQ  618



>ref|XP_008802766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKVEAK
Sbjct  485  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI++KL   DKKKIEDAIEQAI WLDGNQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTIRDEKIAAKLPQADKKKIEDAIEQAINWLDGNQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  605  ESICNPIIAKMYQ  617



>ref|XP_004156718.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
Length=659

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKA+DEEHKKKVEAK
Sbjct  493  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAK  552

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT++DEK SSKL P DKKKIEDAIEQA+QWLD NQLAEADEFEDKMKEL
Sbjct  553  NSLENYAYNMRNTVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADEFEDKMKEL  612

Query  241  ESICNPIIAKMYQ  203
            ESICNPI+AKMYQ
Sbjct  613  ESICNPIVAKMYQ  625



>ref|XP_004250959.1| PREDICTED: heat shock cognate 70 kDa protein [Solanum lycopersicum]
Length=654

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YK+EDEE KKKVEAK
Sbjct  488  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKKKVEAK  547

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTIKD+K+SS+L   DKKKIEDAI++AI+WLD NQLAEADEFEDKMKEL
Sbjct  548  NGLENYAYNMRNTIKDDKVSSQLPAADKKKIEDAIDEAIKWLDSNQLAEADEFEDKMKEL  607

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ES+CNPIIAKMYQGGAG    A MDED
Sbjct  608  ESVCNPIIAKMYQGGAG---GATMDED  631



>ref|XP_009135236.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Brassica rapa]
Length=652

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL+  DKKKIEDAI+QAI+WLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLEAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ES+CNPIIA+MYQ
Sbjct  606  ESVCNPIIARMYQ  618



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 148/168 (88%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI  KL P DKKKIEDA+EQ IQWLD NQL EADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAVEQTIQWLDSNQLGEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQGGAGPD+  GMD+D         G+GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGGAGPDMGGGMDDD-----VPAGGSGAGPKIEEVD  648



>emb|CDX73815.1| BnaA03g32320D [Brassica napus]
Length=652

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL+  DKKKIEDAI+QAI+WLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLEAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ES+CNPIIA+MYQ
Sbjct  606  ESVCNPIIARMYQ  618



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKA+DEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKADDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT++DEK SSKL P DKKKIEDAIEQA+QWLD NQLAEADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTVRDEKFSSKLDPADKKKIEDAIEQAVQWLDNNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPI+AKMYQ
Sbjct  606  ESICNPIVAKMYQ  618



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 142/168 (85%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEE KKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEELKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT+KDEKI SKL  DDKKKIEDA++QAI WL+ NQLAE DEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            E ICNPIIAKMYQ GAG D    MD+D         G+ AGPKIEEVD
Sbjct  606  EGICNPIIAKMYQ-GAGGDAGVPMDDD----APPSGGSSAGPKIEEVD  648



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNT+KDEKI+SKL  +DKKKIEDAIE+AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYSYNMRNTVKDEKIASKLSAEDKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            E ICNPIIAKMYQ
Sbjct  606  EGICNPIIAKMYQ  618



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNTIKD+KISSKL  DDKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYSYNMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_006349004.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 134/147 (91%), Gaps = 3/147 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YK+EDEE KKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTIKD+K+SS+L   DKKKIEDAI++AI+WLD NQLAEADEFEDKMKEL
Sbjct  546  NGLENYAYNMRNTIKDDKVSSQLPAADKKKIEDAIDEAIKWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            ES+CNPIIAKMYQGGAG    A MDED
Sbjct  606  ESVCNPIIAKMYQGGAG---GATMDED  629



>ref|XP_009380663.1| PREDICTED: heat shock cognate 70 kDa protein-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   246 bits (629),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 143/168 (85%), Gaps = 5/168 (3%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNV+ EDKTTG KNKITITNDKGRLSKEEIEKMV+E+E+YKA+DEEHKKKVEAK
Sbjct  485  IDANGILNVTAEDKTTGHKNKITITNDKGRLSKEEIEKMVRESEKYKADDEEHKKKVEAK  544

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+D+KISSKL P DKKKIEDAI++ I+WLD NQLAEADEFEDKMKEL
Sbjct  545  NALENYAYNMRNTIRDDKISSKLSPGDKKKIEDAIDETIKWLDNNQLAEADEFEDKMKEL  604

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ES+CNPIIAKMYQ G      AGMDE     G +    GAGP IEEVD
Sbjct  605  ESLCNPIIAKMYQNG-----GAGMDEGRAKGGATAGAGGAGPTIEEVD  647



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+ DEKI +KL P DKKKIEDAIEQ+IQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVNDEKIGAKLSPADKKKIEDAIEQSIQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 134/159 (84%), Gaps = 19/159 (12%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVESK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNT+KDEKISSKL  DDKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NSLENYAYNMRNTVKDEKISSKLGADDKKKIEDAIDQAIQWLDTNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ-------------------GGAGPDV  182
            ESICNPIIAKMYQ                   GGAGP +
Sbjct  606  ESICNPIIAKMYQGAGADMGGGMEEDAPPAGSGGAGPKI  644



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNT+KDEKI +KL P DKKKIEDAIE AIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYSYNMRNTVKDEKIGAKLSPADKKKIEDAIEAAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 143/168 (85%), Gaps = 7/168 (4%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSK++IEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTI+DEKI  KL   DKKKIE++IEQAIQWL+ NQL EADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIQDEKIGEKLPAADKKKIEESIEQAIQWLENNQLGEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDEDgpsaggsgtgtgagPKIEEVD  98
            ESICNPIIAKMYQG  G   AAGMD+D           GAGPKIEEVD
Sbjct  606  ESICNPIIAKMYQGAGGE--AAGMDDD-----APPASGGAGPKIEEVD  646



>emb|CDY00784.1| BnaC03g37680D [Brassica napus]
Length=650

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YKAEDEEHKKKV+AK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKDEKI+SKL+  DKKKIEDAI+QAI+WLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDEKIASKLEAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ES+CNPIIA+MYQ
Sbjct  606  ESLCNPIIARMYQ  618



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KI+SKL  DDKKKIEDAIE AIQWLDGNQL EADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKIASKLSADDKKKIEDAIEGAIQWLDGNQLGEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            E ICNPIIA+MYQ
Sbjct  606  EGICNPIIARMYQ  618



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKE+IEKMVQEAE+YK+EDEEHKKKVE K
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVETK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KISSKL  DDKKKIEDAI+QAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKISSKLAADDKKKIEDAIDQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/133 (92%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAERYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+KDEKI +KL   DKKKIEDAIEQAIQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVKDEKIGAKLPAADKKKIEDAIEQAIQWLDSNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>gb|ADN03965.1| heat shock cognate 70 kDa protein [Phytolacca acinosa]
Length=588

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YK+EDEEHKKKVEAK
Sbjct  423  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAERYKSEDEEHKKKVEAK  482

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTIKD+KIS+KL  D+KKKIEDAI+QAIQWLDGNQLAE DEFEDKMKEL
Sbjct  483  NGLENYAYNMRNTIKDDKISAKLPADEKKKIEDAIDQAIQWLDGNQLAEVDEFEDKMKEL  542

Query  241  ESICNPIIAKMYQ  203
            ES+CNPIIAKMYQ
Sbjct  543  ESVCNPIIAKMYQ  555



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENY+YNMRNT+KDEKI+SKL  +DKKKIEDAIE+AIQWLDGNQLAEADEFEDKMKEL
Sbjct  546  NALENYSYNMRNTVKDEKIASKLSAEDKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            E +CNPIIAKMYQ
Sbjct  606  EGLCNPIIAKMYQ  618



>ref|XP_009604213.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana tomentosiformis]
Length=651

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 133/147 (90%), Gaps = 3/147 (2%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIE+MVQEAE+YK+EDEE KKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNTIKD+KISS+L   DKKKIEDAI++AI+WLD NQLAE DEFEDKMKEL
Sbjct  546  NALENYAYNMRNTIKDDKISSQLPAADKKKIEDAIDEAIKWLDSNQLAEVDEFEDKMKEL  605

Query  241  ESICNPIIAKMYQGGAGPDVAAGMDED  161
            E ICNPIIAKMYQGGAG    A MDED
Sbjct  606  EGICNPIIAKMYQGGAG---GATMDED  629



>gb|AEX55235.1| heat shock protein 70 [Allium sativum]
Length=367

 Score =   239 bits (609),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVE+K
Sbjct  205  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESK  264

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N LENYAYNMRNTIKD+KI+SKL  +DKKKIEDAI++AIQWLD NQLAEADEF+DKMKEL
Sbjct  265  NTLENYAYNMRNTIKDDKIASKLSGEDKKKIEDAIDEAIQWLDSNQLAEADEFDDKMKEL  324

Query  241  ESICNPIIAKMYQ  203
            ES+CNPIIAKMYQ
Sbjct  325  ESLCNPIIAKMYQ  337



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+ DEKI +KL P DKKKI+DAIEQ+IQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQEAE+YK+EDEEHKKKVEAK
Sbjct  486  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAK  545

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            NALENYAYNMRNT+ DEKI +KL P DKKKI+DAIEQ+IQWLD NQLAEADEFEDKMKEL
Sbjct  546  NALENYAYNMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADEFEDKMKEL  605

Query  241  ESICNPIIAKMYQ  203
            ESICNPIIAKMYQ
Sbjct  606  ESICNPIIAKMYQ  618



>gb|AAX07349.1| heat shock protein 70 [Zea mays]
Length=373

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -1

Query  601  FDANGILNVSXEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEQYKAEDEEHKKKVEAK  422
             DANGILNVS EDKTTGQKNKITITNDKGRLSKEEIEKMVQ+AE+YK+EDEEHKKKVE+K
Sbjct  210  IDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKKKVESK  269

Query  421  NALENYAYNMRNTIKDEKISSKLQPDDKKKIEDAIEQAIQWLDGNQLAEADEFEDKMKEL  242
            N+LENYAYNMRNTIKDEKI+SKL  DDKKKIEDAI+ AI WLD NQLAEADEF+DKMKEL
Sbjct  270  NSLENYAYNMRNTIKDEKIASKLAADDKKKIEDAIDAAISWLDANQLAEADEFDDKMKEL  329

Query  241  ESICNPIIAKMYQ  203
            ES+CNPIIAKMYQ
Sbjct  330  ESLCNPIIAKMYQ  342



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375