BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF020O02

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011071172.1|  PREDICTED: ultraviolet-B receptor UVR8             298   6e-95   Sesamum indicum [beniseed]
gb|KJB31071.1|  hypothetical protein B456_005G174500                    287   1e-92   Gossypium raimondii
emb|CDP13270.1|  unnamed protein product                                292   2e-92   Coffea canephora [robusta coffee]
ref|XP_003551939.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    291   3e-92   Glycine max [soybeans]
gb|KDO82119.1|  hypothetical protein CISIN_1g009463mg                   287   3e-92   Citrus sinensis [apfelsine]
gb|KHN24115.1|  E3 ubiquitin-protein ligase HERC2                       291   6e-92   Glycine soja [wild soybean]
ref|XP_006341781.1|  PREDICTED: probable E3 ubiquitin-protein lig...    291   6e-92   Solanum tuberosum [potatoes]
ref|XP_002285332.1|  PREDICTED: ultraviolet-B receptor UVR8             291   7e-92   Vitis vinifera
gb|KJB31067.1|  hypothetical protein B456_005G174500                    287   1e-91   Gossypium raimondii
ref|XP_003601870.1|  RCC1 domain-containing protein                     286   2e-91   
ref|XP_010248751.1|  PREDICTED: ultraviolet-B receptor UVR8-like        290   2e-91   Nelumbo nucifera [Indian lotus]
gb|KDO82113.1|  hypothetical protein CISIN_1g009463mg                   286   2e-91   Citrus sinensis [apfelsine]
ref|XP_006438171.1|  hypothetical protein CICLE_v10031198mg             286   2e-91   
ref|XP_004239161.1|  PREDICTED: ultraviolet-B receptor UVR8             289   3e-91   Solanum lycopersicum
ref|XP_007044920.1|  Regulator of chromosome condensation (RCC1) ...    286   3e-91   
ref|XP_009586986.1|  PREDICTED: ultraviolet-B receptor UVR8             288   5e-91   Nicotiana tomentosiformis
gb|KDP26718.1|  hypothetical protein JCGZ_17876                         288   1e-90   Jatropha curcas
ref|XP_003601869.1|  RCC1 domain-containing protein                     288   1e-90   Medicago truncatula
gb|KJB31063.1|  hypothetical protein B456_005G174500                    287   2e-90   Gossypium raimondii
gb|KDO82112.1|  hypothetical protein CISIN_1g009463mg                   287   2e-90   Citrus sinensis [apfelsine]
ref|XP_006438172.1|  hypothetical protein CICLE_v10031198mg             287   2e-90   Citrus clementina [clementine]
ref|XP_004310005.1|  PREDICTED: ultraviolet-B receptor UVR8             286   3e-90   Fragaria vesca subsp. vesca
gb|KJB31065.1|  hypothetical protein B456_005G174500                    286   3e-90   Gossypium raimondii
ref|XP_007044919.1|  Regulator of chromosome condensation (RCC1) ...    286   3e-90   
ref|XP_008221955.1|  PREDICTED: ultraviolet-B receptor UVR8             286   5e-90   Prunus mume [ume]
ref|XP_007222374.1|  hypothetical protein PRUPE_ppa004014mg             286   5e-90   Prunus persica
ref|XP_004502353.1|  PREDICTED: probable E3 ubiquitin-protein lig...    286   7e-90   
ref|XP_009769667.1|  PREDICTED: ultraviolet-B receptor UVR8             285   1e-89   Nicotiana sylvestris
gb|KHN44387.1|  Putative E3 ubiquitin-protein ligase HERC4              281   6e-89   Glycine soja [wild soybean]
ref|XP_010682363.1|  PREDICTED: probable E3 ubiquitin-protein lig...    283   1e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006591478.1|  PREDICTED: probable E3 ubiquitin-protein lig...    282   2e-88   Glycine max [soybeans]
gb|KHG17032.1|  putative E3 ubiquitin-protein ligase HERC4              281   2e-88   Gossypium arboreum [tree cotton]
ref|XP_008361816.1|  PREDICTED: ultraviolet-B receptor UVR8-like        282   2e-88   
ref|XP_010100324.1|  hypothetical protein L484_027632                   281   2e-88   
gb|KJB60985.1|  hypothetical protein B456_009G334300                    278   3e-88   Gossypium raimondii
ref|XP_011044684.1|  PREDICTED: ultraviolet-B receptor UVR8-like        281   4e-88   Populus euphratica
ref|XP_008446114.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    281   5e-88   Cucumis melo [Oriental melon]
ref|XP_002321983.2|  hypothetical protein POPTR_0015s01170g             280   8e-88   
gb|KHG25634.1|  E3 ubiquitin-protein ligase HERC2                       279   1e-87   Gossypium arboreum [tree cotton]
gb|EYU22552.1|  hypothetical protein MIMGU_mgv1a004258mg                279   3e-87   Erythranthe guttata [common monkey flower]
gb|KJB60986.1|  hypothetical protein B456_009G334300                    278   4e-87   Gossypium raimondii
ref|XP_009359259.1|  PREDICTED: ultraviolet-B receptor UVR8             278   4e-87   Pyrus x bretschneideri [bai li]
gb|KJB60980.1|  hypothetical protein B456_009G334300                    278   4e-87   Gossypium raimondii
ref|XP_009387758.1|  PREDICTED: ultraviolet-B receptor UVR8-like        278   6e-87   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN77314.1|  hypothetical protein VITISV_008041                     278   7e-87   Vitis vinifera
ref|XP_011024876.1|  PREDICTED: ultraviolet-B receptor UVR8-like        278   9e-87   Populus euphratica
ref|XP_008389759.1|  PREDICTED: ultraviolet-B receptor UVR8             277   1e-86   
ref|XP_008796028.1|  PREDICTED: ultraviolet-B receptor UVR8             276   2e-86   
ref|XP_010929984.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    276   3e-86   Elaeis guineensis
ref|XP_004135288.1|  PREDICTED: probable E3 ubiquitin-protein lig...    276   4e-86   Cucumis sativus [cucumbers]
ref|XP_002317792.2|  hypothetical protein POPTR_0012s02560g             276   4e-86   
ref|XP_004962592.1|  PREDICTED: ultraviolet-B receptor UVR8-like        276   4e-86   Setaria italica
ref|XP_002515036.1|  RCC1 and BTB domain-containing protein, puta...    275   7e-86   
ref|XP_010929983.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    275   1e-85   
gb|ABA97468.1|  regulator of chromosome condensation, putative, e...    271   4e-85   Oryza sativa Japonica Group [Japonica rice]
emb|CDY04192.1|  BnaA09g19700D                                          271   2e-84   
emb|CDY39172.1|  BnaC09g21720D                                          270   2e-84   Brassica napus [oilseed rape]
ref|XP_003578713.1|  PREDICTED: ultraviolet-B receptor UVR8             271   3e-84   Brachypodium distachyon [annual false brome]
gb|EEC69101.1|  hypothetical protein OsI_38005                          271   3e-84   Oryza sativa Indica Group [Indian rice]
ref|NP_566789.1|  regulator of chromosome condensation repeat-con...    268   4e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114097.1|  PREDICTED: ultraviolet-B receptor UVR8-like        270   4e-84   Brassica rapa
ref|NP_001066582.1|  Os12g0284000                                       270   6e-84   
ref|XP_010250918.1|  PREDICTED: ultraviolet-B receptor UVR8             269   1e-83   Nelumbo nucifera [Indian lotus]
ref|XP_006290882.1|  hypothetical protein CARUB_v10016992mg             265   4e-83   
ref|XP_010044521.1|  PREDICTED: ultraviolet-B receptor UVR8             268   4e-83   Eucalyptus grandis [rose gum]
ref|NP_974362.1|  regulator of chromosome condensation repeat-con...    268   4e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663947.1|  PREDICTED: probable E3 ubiquitin-protein lig...    268   5e-83   Oryza brachyantha
ref|XP_006852257.1|  hypothetical protein AMTR_s00049p00167370          268   5e-83   Amborella trichopoda
ref|XP_009415993.1|  PREDICTED: ultraviolet-B receptor UVR8-like        268   6e-83   
ref|XP_010912915.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    267   1e-82   Elaeis guineensis
ref|XP_009152081.1|  PREDICTED: ultraviolet-B receptor UVR8             267   1e-82   Brassica rapa
emb|CDY13609.1|  BnaA06g33140D                                          266   1e-82   Brassica napus [oilseed rape]
emb|CDX83586.1|  BnaC07g23260D                                          266   2e-82   
ref|XP_006290883.1|  hypothetical protein CARUB_v10016992mg             265   5e-82   Capsella rubella
ref|XP_010514248.1|  PREDICTED: ultraviolet-B receptor UVR8-like        264   1e-81   Camelina sativa [gold-of-pleasure]
ref|XP_002875307.1|  regulator of chromosome condensation family ...    263   3e-81   
dbj|BAK00885.1|  predicted protein                                      263   3e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX99731.1|  BnaC02g35890D                                          263   4e-81   
ref|XP_010425280.1|  PREDICTED: ultraviolet-B receptor UVR8-like        263   5e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010502511.1|  PREDICTED: ultraviolet-B receptor UVR8-like        263   5e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009129568.1|  PREDICTED: ultraviolet-B receptor UVR8-like        263   5e-81   
ref|XP_007159624.1|  hypothetical protein PHAVU_002G253100g             257   8e-79   Phaseolus vulgaris [French bean]
ref|XP_007159625.1|  hypothetical protein PHAVU_002G253200g             255   3e-78   Phaseolus vulgaris [French bean]
ref|XP_006395588.1|  hypothetical protein EUTSA_v10003973mg             249   9e-76   Eutrema salsugineum [saltwater cress]
gb|EPS68069.1|  hypothetical protein M569_06703                         245   6e-75   Genlisea aurea
emb|CDY40988.1|  BnaA02g27780D                                          247   8e-75   Brassica napus [oilseed rape]
ref|XP_003531318.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    246   2e-74   
ref|XP_010528070.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    245   2e-74   Tarenaya hassleriana [spider flower]
gb|KHN29007.1|  E3 ubiquitin-protein ligase HERC2                       245   3e-74   Glycine soja [wild soybean]
ref|XP_002987735.1|  hypothetical protein SELMODRAFT_426505             243   2e-73   Selaginella moellendorffii
ref|XP_002987523.1|  hypothetical protein SELMODRAFT_126315             241   4e-73   
gb|KHN06528.1|  E3 ubiquitin-protein ligase HERC2                       240   3e-72   Glycine soja [wild soybean]
ref|XP_003524245.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    239   3e-72   Glycine max [soybeans]
ref|XP_010556194.1|  PREDICTED: ultraviolet-B receptor UVR8-like        239   3e-72   Tarenaya hassleriana [spider flower]
ref|XP_010528066.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    240   4e-72   
ref|XP_009105322.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    204   8e-59   Brassica rapa
ref|XP_009105326.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    204   1e-58   Brassica rapa
emb|CDX96062.1|  BnaA07g26690D                                          200   2e-57   
ref|XP_006391226.1|  hypothetical protein EUTSA_v10018382mg             200   3e-57   
ref|XP_006391225.1|  hypothetical protein EUTSA_v10018382mg             199   6e-57   
emb|CDY01845.1|  BnaC06g28850D                                          199   6e-57   
ref|XP_008798796.1|  PREDICTED: probable E3 ubiquitin-protein lig...    197   4e-56   
ref|XP_002887142.1|  predicted protein                                  189   7e-53   
ref|XP_009105101.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    188   1e-52   Brassica rapa
emb|CDY56518.1|  BnaA07g38600D                                          186   6e-52   Brassica napus [oilseed rape]
ref|XP_010927591.1|  PREDICTED: probable E3 ubiquitin-protein lig...    186   8e-52   
ref|XP_009105098.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    186   9e-52   Brassica rapa
emb|CDY28863.1|  BnaC06g26510D                                          184   2e-51   Brassica napus [oilseed rape]
ref|XP_010511732.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    184   4e-51   
ref|XP_010511729.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    183   1e-50   
ref|XP_010415359.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    182   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010470700.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    181   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010470697.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    180   9e-50   
ref|XP_006647457.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    175   9e-48   Oryza brachyantha
ref|NP_001047324.1|  Os02g0597000                                       174   1e-47   
gb|EEE57302.1|  hypothetical protein OsJ_07379                          174   3e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73526.1|  hypothetical protein OsI_07916                          174   4e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_009387708.1|  PREDICTED: probable E3 ubiquitin-protein lig...    168   1e-45   
ref|NP_001145799.1|  uncharacterized protein LOC100279306               157   4e-41   Zea mays [maize]
ref|XP_008446119.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...    155   7e-41   
gb|KDO82118.1|  hypothetical protein CISIN_1g009463mg                   152   2e-40   Citrus sinensis [apfelsine]
gb|KJB31066.1|  hypothetical protein B456_005G174500                    153   4e-40   Gossypium raimondii
ref|XP_007222373.1|  hypothetical protein PRUPE_ppa004014mg             152   1e-39   
ref|XP_002454125.1|  hypothetical protein SORBIDRAFT_04g024990          152   2e-39   Sorghum bicolor [broomcorn]
ref|XP_004952987.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...    152   2e-39   
ref|XP_006653534.1|  PREDICTED: ultraviolet-B receptor UVR8-like        149   2e-38   
gb|KJB60983.1|  hypothetical protein B456_009G334300                    148   3e-38   Gossypium raimondii
ref|XP_010912917.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...    147   8e-38   
gb|AFK41653.1|  unknown                                                 135   3e-36   Lotus japonicus
ref|XP_004975996.1|  PREDICTED: probable E3 ubiquitin-protein lig...    143   3e-36   Setaria italica
ref|XP_006395589.1|  hypothetical protein EUTSA_v10003973mg             139   5e-35   
ref|XP_003579993.1|  PREDICTED: probable E3 ubiquitin-protein lig...    136   1e-33   Brachypodium distachyon [annual false brome]
gb|AEW08936.1|  hypothetical protein CL2350Contig1_01                   122   7e-32   Pinus lambertiana
gb|AEW08937.1|  hypothetical protein CL2350Contig1_01                   122   1e-31   Pinus radiata
gb|KHN02047.1|  Putative E3 ubiquitin-protein ligase HERC2              108   2e-26   Glycine soja [wild soybean]
gb|KFK41183.1|  hypothetical protein AALP_AA2G096500                    110   2e-25   Arabis alpina [alpine rockcress]
ref|XP_002448071.1|  hypothetical protein SORBIDRAFT_06g020490          113   2e-25   Sorghum bicolor [broomcorn]
gb|EMT06491.1|  hypothetical protein F775_19352                         108   6e-24   
ref|NP_608388.2|  HECT and RLD domain containing protein 2 ortholog   84.3    5e-15   Drosophila melanogaster
ref|XP_002039536.1|  GM23027                                          84.3    6e-15   Drosophila sechellia
ref|XP_001977881.1|  GG19286                                          82.8    2e-14   Drosophila erecta
ref|XP_001355626.2|  GA11166                                          82.8    2e-14   
ref|XP_006084722.1|  PREDICTED: E3 ISG15--protein ligase HERC5-like   82.0    2e-14   
ref|XP_006084723.1|  PREDICTED: E3 ISG15--protein ligase HERC5        82.0    2e-14   Myotis lucifugus
ref|XP_002011008.1|  GI16306                                          82.4    2e-14   
ref|XP_008579308.1|  PREDICTED: E3 ISG15--protein ligase HERC5        81.6    3e-14   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008141914.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--pr...  81.3    5e-14   
ref|XP_002025047.1|  GL26839                                          81.6    5e-14   
ref|XP_004756145.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--pr...  80.9    6e-14   Mustela putorius furo [black ferret]
ref|XP_001966082.1|  GF19414                                          81.3    7e-14   Drosophila ananassae
ref|XP_005835300.1|  hypothetical protein GUITHDRAFT_162457           80.1    8e-14   Guillardia theta CCMP2712
ref|XP_011354609.1|  PREDICTED: E3 ISG15--protein ligase HERC5        80.5    8e-14   
ref|XP_007074874.1|  PREDICTED: E3 ISG15--protein ligase HERC5        80.5    9e-14   
ref|XP_002101897.1|  GE17877                                          80.5    1e-13   
ref|XP_002058164.1|  GJ15642                                          80.1    1e-13   
ref|XP_006910823.1|  PREDICTED: E3 ISG15--protein ligase HERC5        79.7    2e-13   
gb|ELK13686.1|  Putative E3 ubiquitin-protein ligase HERC5            79.3    2e-13   Pteropus alecto
ref|XP_001995753.1|  GH17927                                          79.7    2e-13   Drosophila grimshawi
ref|XP_004590688.1|  PREDICTED: E3 ISG15--protein ligase HERC5        79.0    2e-13   
ref|XP_005639229.1|  PREDICTED: E3 ISG15--protein ligase HERC5 is...  79.0    3e-13   
ref|XP_005639228.1|  PREDICTED: E3 ISG15--protein ligase HERC5 is...  79.0    3e-13   
ref|XP_008705354.1|  PREDICTED: E3 ISG15--protein ligase HERC5        78.6    3e-13   Ursus maritimus [white bear]
ref|XP_006727131.1|  PREDICTED: E3 ISG15--protein ligase HERC5        78.2    5e-13   Leptonychotes weddellii
ref|XP_004665453.1|  PREDICTED: E3 ISG15--protein ligase HERC5        77.8    5e-13   Jaculus jaculus
ref|XP_004348355.1|  regulator of chromosome condensation (RCC1) ...  77.0    6e-13   Acanthamoeba castellanii str. Neff
ref|XP_011021217.1|  PREDICTED: ultraviolet-B receptor UVR8           76.6    6e-13   Populus euphratica
ref|WP_042122221.1|  hypothetical protein                             75.9    6e-13   
ref|XP_005781906.1|  E3 ubiquitin ligase                              76.6    6e-13   Emiliania huxleyi CCMP1516
ref|XP_008209737.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  78.2    7e-13   
ref|XP_008209736.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  77.8    7e-13   
ref|XP_008209733.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  77.8    8e-13   Nasonia vitripennis
ref|XP_011230877.1|  PREDICTED: E3 ISG15--protein ligase HERC5        77.4    9e-13   
ref|XP_006373448.1|  regulator of chromosome condensation family ...  75.9    9e-13   Populus trichocarpa [western balsam poplar]
ref|XP_002064396.1|  GK20144                                          77.8    9e-13   
ref|XP_002182991.1|  predicted protein                                75.1    1e-12   Phaeodactylum tricornutum CCAP 1055/1
gb|KJB43031.1|  hypothetical protein B456_007G180500                  74.7    1e-12   Gossypium raimondii
ref|XP_004681471.1|  PREDICTED: E3 ISG15--protein ligase HERC5        77.0    1e-12   Condylura cristata
ref|XP_003898997.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--pr...  77.0    1e-12   
ref|XP_006182667.1|  PREDICTED: E3 ISG15--protein ligase HERC5        77.0    1e-12   
ref|XP_004391581.1|  PREDICTED: E3 ISG15--protein ligase HERC5        77.0    1e-12   Odobenus rosmarus divergens
ref|XP_008055693.1|  PREDICTED: E3 ISG15--protein ligase HERC5        77.0    1e-12   
ref|XP_007997417.1|  PREDICTED: E3 ISG15--protein ligase HERC5        77.0    1e-12   Chlorocebus sabaeus
ref|XP_005555451.1|  PREDICTED: E3 ISG15--protein ligase HERC5        77.0    1e-12   Macaca fascicularis [crab eating macaque]
gb|EHH53834.1|  E3 ISG15--protein ligase HERC5                        76.6    1e-12   Macaca fascicularis [crab eating macaque]
ref|XP_011011190.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  75.5    1e-12   Populus euphratica
ref|XP_010592357.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--pr...  76.6    1e-12   
gb|KGN52576.1|  hypothetical protein Csa_5G644530                     75.5    1e-12   Cucumis sativus [cucumbers]
ref|XP_004156186.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  75.5    1e-12   
ref|XP_004141502.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  75.5    1e-12   
gb|KHG04352.1|  putative E3 ubiquitin-protein ligase HERC4            75.1    1e-12   Gossypium arboreum [tree cotton]
gb|KDP32937.1|  hypothetical protein JCGZ_12968                       75.1    2e-12   Jatropha curcas
gb|ENN75748.1|  hypothetical protein YQE_07708                        76.6    2e-12   Dendroctonus ponderosae
ref|XP_005761231.1|  hypothetical protein EMIHUDRAFT_358730           73.6    2e-12   Emiliania huxleyi CCMP1516
gb|ERL87037.1|  hypothetical protein D910_04439                       76.6    2e-12   Dendroctonus ponderosae
ref|XP_011203204.1|  PREDICTED: probable E3 ubiquitin-protein lig...  76.6    2e-12   
gb|KEH17300.1|  chromosome condensation regulator RCC1 repeat pro...  75.1    2e-12   Medicago truncatula
gb|KJB43030.1|  hypothetical protein B456_007G180500                  74.7    2e-12   Gossypium raimondii
gb|KFN08373.1|  fibronectin type III domain protein                   76.3    2e-12   Paenibacillus macerans
ref|XP_004788941.1|  PREDICTED: E3 ISG15--protein ligase HERC5        76.3    2e-12   
gb|EPS68557.1|  hypothetical protein M569_06211                       74.3    3e-12   Genlisea aurea
ref|XP_010355204.1|  PREDICTED: E3 ISG15--protein ligase HERC5        75.5    3e-12   Rhinopithecus roxellana
ref|XP_003708187.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  75.9    4e-12   
gb|EEZ97761.1|  hect domain and RLD 2-like protein                    75.9    4e-12   
ref|XP_008459465.1|  PREDICTED: ultraviolet-B receptor UVR8           73.9    4e-12   Cucumis melo [Oriental melon]
ref|XP_008199122.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  75.5    4e-12   
pdb|4O2W|A  Chain A, Crystal Structure Of The Third Rcc1-like Dom...  73.9    4e-12   Homo sapiens [man]
ref|XP_002602062.1|  hypothetical protein BRAFLDRAFT_94436            75.5    5e-12   Branchiostoma floridae
ref|XP_004928781.1|  PREDICTED: probable E3 ubiquitin-protein lig...  75.5    5e-12   
ref|XP_004516679.1|  PREDICTED: ultraviolet-B receptor UVR8-like      73.9    5e-12   Cicer arietinum [garbanzo]
ref|XP_002305965.2|  hypothetical protein POPTR_0004s10130g           73.6    5e-12   Populus trichocarpa [western balsam poplar]
ref|XP_001661249.1|  AAEL002306-PA                                    75.5    5e-12   
ref|XP_011403674.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2     75.1    5e-12   
ref|XP_011099566.1|  PREDICTED: ultraviolet-B receptor UVR8           73.6    5e-12   Sesamum indicum [beniseed]
ref|XP_002516745.1|  Ran GTPase binding protein, putative             73.6    5e-12   Ricinus communis
ref|XP_002283479.1|  PREDICTED: ultraviolet-B receptor UVR8           73.6    6e-12   Vitis vinifera
ref|XP_003310459.1|  PREDICTED: E3 ISG15--protein ligase HERC5        74.7    6e-12   
ref|XP_008961909.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--pr...  74.7    6e-12   Pan paniscus [bonobo]
ref|XP_011280084.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--pr...  74.7    6e-12   
gb|EHJ72511.1|  hypothetical protein KGM_11261                        75.1    7e-12   
ref|XP_007240764.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.9    7e-12   
ref|XP_001861523.1|  hect E3 ubiquitin ligase                         74.7    8e-12   Culex quinquefasciatus
ref|XP_002745648.1|  PREDICTED: E3 ISG15--protein ligase HERC5        74.3    8e-12   Callithrix jacchus [common marmoset]
ref|XP_003924055.1|  PREDICTED: E3 ISG15--protein ligase HERC5        74.3    8e-12   Saimiri boliviensis boliviensis
ref|XP_006867837.1|  PREDICTED: E3 ISG15--protein ligase HERC5        74.3    8e-12   Chrysochloris asiatica
ref|XP_010032623.1|  PREDICTED: ultraviolet-B receptor UVR8           73.2    8e-12   Eucalyptus grandis [rose gum]
ref|XP_011176997.1|  PREDICTED: probable E3 ubiquitin-protein lig...  74.7    9e-12   
gb|ETN64680.1|  hect E3 ubiquitin ligase                              74.7    9e-12   Anopheles darlingi [American malaria mosquito]
emb|CCA14713.1|  regulator of chromosome condensation (RCC1)like ...  73.2    9e-12   Albugo laibachii Nc14
ref|XP_011293627.1|  PREDICTED: probable E3 ubiquitin-protein lig...  74.7    9e-12   Musca domestica
ref|XP_003265940.1|  PREDICTED: E3 ISG15--protein ligase HERC5        74.3    9e-12   
ref|WP_036628254.1|  hypothetical protein                             73.9    9e-12   
ref|XP_011479995.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  74.3    1e-11   
ref|XP_011293631.1|  PREDICTED: probable E3 ubiquitin-protein lig...  74.3    1e-11   Musca domestica
emb|CCI44832.1|  unnamed protein product                              73.6    1e-11   Albugo candida
emb|CCI44833.1|  unnamed protein product                              73.6    1e-11   Albugo candida
emb|CCA17552.1|  regulator of chromosome condensation (RCC1)like ...  73.6    1e-11   Albugo laibachii Nc14
ref|XP_005833902.1|  hypothetical protein GUITHDRAFT_86569            72.0    1e-11   Guillardia theta CCMP2712
gb|EFA86701.1|  hypothetical protein PPL_00504                        70.9    1e-11   Heterostelium album PN500
ref|XP_007033301.1|  Regulator of chromosome condensation (RCC1) ...  72.8    1e-11   
ref|XP_552411.3|  AGAP011823-PA                                       74.3    1e-11   Anopheles gambiae str. PEST
ref|XP_002998335.1|  conserved hypothetical protein                   73.9    1e-11   Phytophthora infestans T30-4
ref|XP_006143351.1|  PREDICTED: E3 ISG15--protein ligase HERC5        73.9    1e-11   
ref|NP_001061858.1|  Os08g0430700                                     72.8    1e-11   
gb|EEC83614.1|  hypothetical protein OsI_29322                        72.4    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_008478281.1|  PREDICTED: protein pim1-like                     73.2    1e-11   
ref|XP_006659424.1|  PREDICTED: ultraviolet-B receptor UVR8-like      72.4    1e-11   Oryza brachyantha
gb|KFO20813.1|  Putative E3 ubiquitin-protein ligase HERC6            73.6    1e-11   Fukomys damarensis [Damara mole rat]
ref|XP_006629113.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.9    1e-11   
ref|XP_004916028.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.9    2e-11   
ref|XP_010608801.1|  PREDICTED: E3 ISG15--protein ligase HERC5        73.6    2e-11   Fukomys damarensis [Damara mole rat]
ref|XP_004916029.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.9    2e-11   
ref|XP_004916027.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.9    2e-11   
ref|XP_004916026.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.9    2e-11   Xenopus tropicalis [western clawed frog]
ref|XP_002908726.1|  conserved hypothetical protein                   73.6    2e-11   Phytophthora infestans T30-4
ref|XP_008862359.1|  hypothetical protein, variant 2                  72.4    2e-11   Aphanomyces invadans
ref|XP_002934599.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.6    2e-11   
ref|XP_006039886.1|  PREDICTED: probable E3 ubiquitin-protein lig...  69.7    2e-11   
ref|XP_005401507.1|  PREDICTED: E3 ISG15--protein ligase HERC5-like   73.2    2e-11   
ref|XP_008609568.1|  hypothetical protein SDRG_05620                  72.8    2e-11   Saprolegnia diclina VS20
ref|XP_008609567.1|  hypothetical protein, variant                    72.8    2e-11   Saprolegnia diclina VS20
ref|XP_006823770.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.6    2e-11   Saccoglossus kowalevskii
ref|XP_011011188.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  72.0    2e-11   Populus euphratica
ref|XP_011500573.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  73.6    2e-11   Ceratosolen solmsi marchali
ref|XP_010886893.1|  PREDICTED: probable E3 ubiquitin-protein lig...  73.6    2e-11   
ref|XP_005762970.1|  hypothetical protein EMIHUDRAFT_58534            68.6    2e-11   Emiliania huxleyi CCMP1516
ref|XP_011099677.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  72.0    2e-11   Sesamum indicum [beniseed]
ref|XP_003555124.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  72.0    2e-11   Glycine max [soybeans]
emb|CDX69479.1|  BnaA10g18280D                                        72.0    2e-11   
ref|XP_002902385.1|  regulator of chromosome condensation (RCC1)-...  72.4    2e-11   Phytophthora infestans T30-4
ref|XP_011099678.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  72.0    2e-11   Sesamum indicum [beniseed]
gb|KDO58961.1|  hypothetical protein CISIN_1g0386102mg                70.9    2e-11   Citrus sinensis [apfelsine]
ref|XP_010463662.1|  PREDICTED: ultraviolet-B receptor UVR8-like      71.6    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008842893.1|  PREDICTED: E3 ISG15--protein ligase HERC5        72.8    3e-11   Nannospalax galili
ref|XP_004520385.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  73.2    3e-11   
ref|XP_007246132.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  73.2    3e-11   
ref|XP_004848117.1|  PREDICTED: E3 ISG15--protein ligase HERC5-like   72.8    3e-11   
gb|EGW07163.1|  putative E3 ubiquitin-protein ligase HERC1            72.8    3e-11   Cricetulus griseus [Chinese hamsters]
ref|XP_004646641.1|  PREDICTED: E3 ISG15--protein ligase HERC5        72.8    3e-11   Octodon degus
ref|XP_007151644.1|  hypothetical protein PHAVU_004G064300g           71.6    3e-11   Phaseolus vulgaris [French bean]
gb|KFK37711.1|  hypothetical protein AALP_AA3G019100                  71.6    3e-11   
ref|XP_008527171.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_005658634.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_009121524.1|  PREDICTED: ultraviolet-B receptor UVR8           71.6    3e-11   
ref|XP_008862358.1|  hypothetical protein, variant 1                  71.6    3e-11   
ref|XP_003418394.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_010596338.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_010596337.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_010596336.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_010596335.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_006209635.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_006184048.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_008379526.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  71.2    3e-11   
ref|XP_004480611.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--pr...  72.4    3e-11   
ref|XP_009601671.1|  PREDICTED: ultraviolet-B receptor UVR8           71.2    3e-11   
ref|XP_011361666.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_004716349.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
gb|ELK24881.1|  Putative E3 ubiquitin-protein ligase HERC1            72.8    3e-11   
ref|XP_009003283.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_009003274.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_009003273.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
dbj|BAA88519.1|  cyclin-E binding protein 1                           72.4    3e-11   
gb|AAI40717.1|  Hect domain and RLD 5                                 72.4    3e-11   
ref|NP_057407.2|  E3 ISG15--protein ligase HERC5                      72.4    3e-11   
ref|XP_010991828.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  72.8    3e-11   
ref|XP_007956174.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_009003278.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
gb|AAR00320.1|  HECT E3 ubiquitin ligase                              72.4    3e-11   
ref|XP_006831913.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  72.8    3e-11   
ref|XP_009003277.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_009003272.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_008903094.1|  hypothetical protein PPTG_10207                  72.0    3e-11   
gb|KFO26013.1|  Putative E3 ubiquitin-protein ligase HERC1            72.8    3e-11   
ref|XP_006920339.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_005393839.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_005393838.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_005393841.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_006511166.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_009003279.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_007949901.1|  PREDICTED: E3 ISG15--protein ligase HERC5        72.4    3e-11   
ref|XP_006045016.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_008706845.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  72.8    3e-11   
ref|XP_004615347.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_006511171.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_006511170.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_005393837.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    3e-11   
ref|XP_006043316.1|  PREDICTED: E3 ISG15--protein ligase HERC5 is...  72.4    4e-11   
gb|ELK05350.1|  Putative E3 ubiquitin-protein ligase HERC1            72.8    4e-11   
ref|XP_005393843.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006511167.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_001075834.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_005393844.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006043315.1|  PREDICTED: E3 ISG15--protein ligase HERC5 is...  72.4    4e-11   
ref|XP_007534078.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
gb|EDL26121.1|  mCG130390                                             72.8    4e-11   
ref|XP_004466732.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_001514757.2|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006226512.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_005393840.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_004421728.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_005393842.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006899693.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_004466733.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_011281221.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_004466731.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006511168.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_008379527.1|  PREDICTED: ultraviolet-B receptor UVR8 isofo...  71.2    4e-11   
ref|XP_004578404.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
gb|AAI72910.1|  guanine nucleotide exchange factor p532               72.4    4e-11   
ref|XP_006736682.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_005963320.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_001927286.4|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_544717.3|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ubi...  72.8    4e-11   
ref|XP_007111067.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006226514.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006226511.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_004466729.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_008267135.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_004903202.1|  PREDICTED: E3 ISG15--protein ligase HERC5-like   72.4    4e-11   
ref|XP_005685728.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_007467273.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|NP_663592.3|  probable E3 ubiquitin-protein ligase HERC1          72.8    4e-11   
ref|XP_010639499.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_004409486.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006511169.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_010639496.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_010639495.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_011216739.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_004687578.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_004010589.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_004374703.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_003499388.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_009003282.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_004628887.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_002914279.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006226513.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006770859.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_010639497.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_008267139.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_011216743.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_005347796.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_007608103.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  72.8    4e-11   
ref|XP_005861139.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_011216737.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.8    4e-11   
ref|XP_006770860.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_010639498.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_007084558.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_007084557.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_007084556.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_006770857.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_009003280.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_006770862.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_010838527.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008567082.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008056746.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_005861143.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_003987103.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_011281222.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_010838524.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_010838523.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008267140.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_006770856.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_005861138.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_005861137.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
gb|EFX81111.1|  hypothetical protein DAPPUDRAFT_50378                 72.4    4e-11   
ref|XP_005007260.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  72.4    4e-11   
ref|XP_010953418.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  72.4    4e-11   
ref|XP_007111070.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008056747.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008267143.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_010838525.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_009003281.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008267141.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_005861140.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_011216744.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_006770861.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_005316727.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_005861142.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
gb|EFB22894.1|  hypothetical protein PANDA_002155                     72.4    4e-11   
ref|XP_004881854.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008056748.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_005894588.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_002718216.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008137365.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_007084559.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_010838521.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008267142.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_005861141.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_006770854.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_006093479.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_004758794.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_011216740.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_006770855.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_005075660.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008851223.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_001918080.2|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  72.4    4e-11   
ref|XP_004758793.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_006770858.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_011216741.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_006093478.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_010838526.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_004758792.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_011216738.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_011216742.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_010838520.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_010838515.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_006141813.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_004855825.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_011259664.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  72.4    4e-11   
ref|XP_011259663.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  72.4    4e-11   
ref|XP_010768840.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  68.6    4e-11   
ref|XP_005559806.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_008014524.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
ref|XP_003784693.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    4e-11   
gb|EDL95854.1|  rCG58270                                              72.4    4e-11   
ref|XP_008862357.1|  hypothetical protein H310_01110                  71.6    4e-11   
ref|XP_008014518.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_008014516.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_008014515.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_005559803.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_010353762.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_008014521.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_010932608.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  70.9    5e-11   
gb|KDO32822.1|  hypothetical protein SPRG_02515                       71.2    5e-11   
ref|XP_008014522.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_008014520.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_003394376.1|  PREDICTED: LOW QUALITY PROTEIN: e3 ubiquitin...  72.4    5e-11   
ref|XP_005559802.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
gb|EHH63136.1|  hypothetical protein EGM_16043                        72.4    5e-11   
ref|XP_008014519.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_006979377.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
gb|EHH27387.1|  hypothetical protein EGK_17574                        72.4    5e-11   
ref|XP_010265208.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  70.9    5e-11   
ref|XP_005254804.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_008014523.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_009116224.1|  PREDICTED: ultraviolet-B receptor UVR8-like      71.2    5e-11   
ref|XP_003487554.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  72.4    5e-11   
ref|XP_006979376.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_004056386.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_004274775.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
gb|AAD12586.1|  p532                                                  72.4    5e-11   
ref|XP_003755677.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_009514529.1|  hypothetical protein PHYSODRAFT_358246           71.2    5e-11   
ref|XP_007480162.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_005254803.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.4    5e-11   
ref|XP_001702277.1|  hypothetical protein CHLREDRAFT_122886           70.9    5e-11   
ref|NP_003913.3|  probable E3 ubiquitin-protein ligase HERC1          72.4    5e-11   
ref|XP_006720791.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.0    5e-11   
ref|XP_009248169.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  72.0    5e-11   
ref|XP_006430800.1|  hypothetical protein CICLE_v10011926mg           70.9    5e-11   
ref|XP_006482273.1|  PREDICTED: E3 ubiquitin-protein ligase HERC2...  70.9    5e-11   
ref|XP_008230391.1|  PREDICTED: ultraviolet-B receptor UVR8           70.9    5e-11   
ref|XP_005401528.1|  PREDICTED: E3 ISG15--protein ligase HERC5-like   71.6    5e-11   
ref|XP_003901090.2|  PREDICTED: probable E3 ubiquitin-protein lig...  72.0    5e-11   
ref|XP_009208622.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.0    5e-11   
ref|XP_009208621.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.0    5e-11   
ref|XP_002804832.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.0    5e-11   
ref|XP_010932607.1|  PREDICTED: ultraviolet-B receptor UVR8-like ...  70.9    5e-11   
ref|XP_009208623.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.0    5e-11   
ref|XP_009208619.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.0    5e-11   
ref|XP_005559805.1|  PREDICTED: probable E3 ubiquitin-protein lig...  72.0    5e-11   



>ref|XP_011071172.1| PREDICTED: ultraviolet-B receptor UVR8 [Sesamum indicum]
Length=534

 Score =   298 bits (764),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FR LNLQPVVVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNEDCES PKVVEA SN+K 
Sbjct  355  FRTLNLQPVVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEDCESVPKVVEALSNVKA  414

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGESSSLGHN    D Q NRH+N+LSPELVTSLKQV 
Sbjct  415  VHVATGDYTTFVVSDDGDVYSFGCGESSSLGHNTAAADEQGNRHTNVLSPELVTSLKQVN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALT+  KL+AFGAGDKGQLGV L ANQTERANPERV++DLS
Sbjct  475  ERVVQISLTNSIYWNAHTFALTDSDKLYAFGAGDKGQLGVELVANQTERANPERVDIDLS  534


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 72/149 (48%), Gaps = 19/149 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   ++G    G LGHG  D ES P+V+ A   I+ +H A G   T ++S+ G  Y+FG 
Sbjct  163  GAVYSFGSNSSGQLGHGTTDEESRPRVIRALQGIRIIHAAAGAGRTMLISDAGLVYAFG-  221

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
                S G       G    +  + +P++V SLK +   VVQ ++ N       T  L+  
Sbjct  222  --KDSFGEAEYGAQG----NKLVTTPQIVESLKDIF--VVQAAIGNFF-----TAVLSRE  268

Query  201  GKLFAFGAGDKGQLGVALSANQTERANPE  115
            G ++ F  G++ +LG     +QTE  + E
Sbjct  269  GMIYTFSWGNESKLG-----HQTEPTDLE  292



>gb|KJB31071.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
Length=354

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNEDCES PKVVEA SN+K 
Sbjct  176  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEDCESVPKVVEALSNVKA  235

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN    +GQ NRH+N+LSPELV SLKQV 
Sbjct  236  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHN-TAGEGQGNRHANVLSPELVMSLKQVN  294

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L+ NQTER NPERV++DL+
Sbjct  295  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELANNQTERGNPERVDIDLN  354



>emb|CDP13270.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNEDCES PKVVEA SN+K 
Sbjct  368  FQNLNLQPVVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEDCESIPKVVEALSNVKA  427

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            V+VATGDYTTFVVS+ GD YSFGCGESSSLGHN    DGQVNRH+N+LSPE+VTSLKQV 
Sbjct  428  VNVATGDYTTFVVSDAGDVYSFGCGESSSLGHNTGAVDGQVNRHTNVLSPEIVTSLKQVN  487

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALT+ GKL+AFGAGDKGQLG+ L +NQTERA PERV++DLS
Sbjct  488  ERVVQISLTNSIYWNAHTFALTDSGKLYAFGAGDKGQLGIELVSNQTERAKPERVDIDLS  547



>ref|XP_003551939.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Glycine 
max]
 ref|XP_006601920.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Glycine 
max]
 ref|XP_006601921.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X3 [Glycine 
max]
Length=535

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA SN+K 
Sbjct  356  FGLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHNA   D Q NRH+N+LSPELVTSLKQ+ 
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNAAGNDEQGNRHANVLSPELVTSLKQIN  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER NPERVE+DL
Sbjct  476  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERGNPERVEIDL  534



>gb|KDO82119.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
Length=384

 Score =   287 bits (734),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A +++K 
Sbjct  206  FQLLNLQPVVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKA  265

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVSEDGD YSFGCGES+SLGHNA+  DGQ NRH+N+L+P+LVTSLKQV 
Sbjct  266  IHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIA-DGQGNRHANVLTPQLVTSLKQVN  324

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L  NQTER NPERV++DLS
Sbjct  325  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNNQTERGNPERVDIDLS  384



>gb|KHN24115.1| E3 ubiquitin-protein ligase HERC2 [Glycine soja]
Length=546

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA SN+K 
Sbjct  367  FGLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSNVKA  426

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHNA   D Q NRH+N+LSPELVTSLKQ+ 
Sbjct  427  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNAAGNDEQGNRHANVLSPELVTSLKQIN  486

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER NPERVE+DL
Sbjct  487  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERGNPERVEIDL  545



>ref|XP_006341781.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341782.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Solanum tuberosum]
Length=533

 Score =   291 bits (744),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LN+QP VVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNEDCESAPKVVEA SN+K 
Sbjct  354  FQTLNIQPAVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEDCESAPKVVEALSNVKA  413

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            V+VATGDYTTFVVS+DG  YSFGCGESSSLGHN    + Q NRHSN+L PE+VTSLKQ+ 
Sbjct  414  VYVATGDYTTFVVSDDGSVYSFGCGESSSLGHNTAAAEAQGNRHSNVLFPEVVTSLKQLN  473

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLGV LSANQTERA PER+++DLS
Sbjct  474  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGVELSANQTERAIPERIDIDLS  533



>ref|XP_002285332.1| PREDICTED: ultraviolet-B receptor UVR8 [Vitis vinifera]
 ref|XP_010650906.1| PREDICTED: ultraviolet-B receptor UVR8 [Vitis vinifera]
 ref|XP_010650911.1| PREDICTED: ultraviolet-B receptor UVR8 [Vitis vinifera]
 ref|XP_010650917.1| PREDICTED: ultraviolet-B receptor UVR8 [Vitis vinifera]
 emb|CBI16837.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FR LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA  N+K 
Sbjct  356  FRILNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALINVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGESSSLGHN    DGQ NRH+NILSPELVTSLKQ+ 
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESSSLGHNN-GPDGQGNRHANILSPELVTSLKQIK  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLGV L ANQTER NPERV++DLS
Sbjct  475  ERMVQISLTNSIYWNAHTFALTETGKLYAFGAGDKGQLGVELVANQTERGNPERVDIDLS  534



>gb|KJB31067.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
 gb|KJB31069.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
Length=432

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNEDCES PKVVEA SN+K 
Sbjct  254  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEDCESVPKVVEALSNVKA  313

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN    +GQ NRH+N+LSPELV SLKQV 
Sbjct  314  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHN-TAGEGQGNRHANVLSPELVMSLKQVN  372

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L+ NQTER NPERV++DL+
Sbjct  373  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELANNQTERGNPERVDIDLN  432



>ref|XP_003601870.1| RCC1 domain-containing protein [Medicago truncatula]
Length=432

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+V++AGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CE+APKVV+A +N+K 
Sbjct  254  FQTLNLQPMVISAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECEAAPKVVDALTNVKA  313

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVV+EDGD YSFGCGES+SLGHNAV+ D + NRH+N+L+PELVTSLKQ+ 
Sbjct  314  VHVATGDYTTFVVAEDGDVYSFGCGESASLGHNAVI-DAEGNRHANVLNPELVTSLKQIN  372

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER NPE+V++DL
Sbjct  373  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERVNPEQVDIDL  431



>ref|XP_010248751.1| PREDICTED: ultraviolet-B receptor UVR8-like [Nelumbo nucifera]
 ref|XP_010248752.1| PREDICTED: ultraviolet-B receptor UVR8-like [Nelumbo nucifera]
 ref|XP_010248754.1| PREDICTED: ultraviolet-B receptor UVR8-like [Nelumbo nucifera]
 ref|XP_010248755.1| PREDICTED: ultraviolet-B receptor UVR8-like [Nelumbo nucifera]
Length=534

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 161/180 (89%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FRALNLQP+ VAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA S +K 
Sbjct  356  FRALNLQPIEVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSKVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGESSSLGHN    DGQ  RH+N+LSPELVTSLKQV 
Sbjct  416  VHVATGDYTTFVVSEDGDVYSFGCGESSSLGHNTGAADGQ-GRHTNVLSPELVTSLKQVN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L A+Q ER NPERV++DLS
Sbjct  475  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVADQNERGNPERVDIDLS  534



>gb|KDO82113.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
 gb|KDO82114.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
 gb|KDO82115.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
 gb|KDO82116.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
 gb|KDO82117.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
Length=432

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A +++K 
Sbjct  254  FQLLNLQPVVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKA  313

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVSEDGD YSFGCGES+SLGHNA+  DGQ NRH+N+L+P+LVTSLKQV 
Sbjct  314  IHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIA-DGQGNRHANVLTPQLVTSLKQVN  372

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L  NQTER NPERV++DLS
Sbjct  373  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNNQTERGNPERVDIDLS  432



>ref|XP_006438171.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 ref|XP_006438173.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 ref|XP_006438174.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 gb|ESR51411.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 gb|ESR51413.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 gb|ESR51414.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
Length=432

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A +++K 
Sbjct  254  FQLLNLQPVVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKA  313

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVSEDGD YSFGCGES+SLGHNA+  DGQ NRH+N+L+P+LVTSLKQV 
Sbjct  314  IHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIA-DGQGNRHANVLTPQLVTSLKQVN  372

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L  NQTER NPERV++DLS
Sbjct  373  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNNQTERGNPERVDIDLS  432



>ref|XP_004239161.1| PREDICTED: ultraviolet-B receptor UVR8 [Solanum lycopersicum]
Length=533

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LN+QP VVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNEDCESAPKVVEA SN+K 
Sbjct  354  FQTLNIQPAVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEDCESAPKVVEALSNVKA  413

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            V+VATGDYTTFVVS+DG+ YSFGCGESSSLGHN    + Q NRHSN+L PE+VT+LKQ+ 
Sbjct  414  VYVATGDYTTFVVSDDGNVYSFGCGESSSLGHNTAAAEAQGNRHSNVLFPEVVTTLKQLN  473

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLGV LS NQTERA PERV++DLS
Sbjct  474  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGVELSVNQTERAIPERVDIDLS  533



>ref|XP_007044920.1| Regulator of chromosome condensation (RCC1) family protein isoform 
2 [Theobroma cacao]
 gb|EOY00752.1| Regulator of chromosome condensation (RCC1) family protein isoform 
2 [Theobroma cacao]
Length=432

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA S +K 
Sbjct  254  FQLLNLQPVVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSKVKA  313

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN+V  +GQ NRH+N+LSPELVTSLKQV 
Sbjct  314  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNSVA-EGQGNRHANVLSPELVTSLKQVN  372

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L  NQTER NPERV++DL+
Sbjct  373  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNNQTERGNPERVDIDLN  432



>ref|XP_009586986.1| PREDICTED: ultraviolet-B receptor UVR8 [Nicotiana tomentosiformis]
Length=535

 Score =   288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNEDCE+APKVVEA SN+K 
Sbjct  356  FQTLNLQPAVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEDCEAAPKVVEALSNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            ++VATGDYTTFVVS++G+ YSFGCGESSSLGHN  V + Q NRHSN+L PE+VTSLKQ+ 
Sbjct  416  IYVATGDYTTFVVSDEGNVYSFGCGESSSLGHNTAVAEEQGNRHSNVLFPEVVTSLKQLN  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLGV LSANQTERA PERV++DL
Sbjct  476  ERVVQISLTNSIYWNAHTFALTETGKLYAFGAGDKGQLGVELSANQTERAIPERVDIDL  534



>gb|KDP26718.1| hypothetical protein JCGZ_17876 [Jatropha curcas]
Length=538

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 162/183 (89%), Gaps = 3/183 (2%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+ VAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA S +K 
Sbjct  356  FQLLNLQPMEVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSKVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNA---VVXDGQVNRHSNILSPELVTSLK  283
            VHVATGDYTTFVVS++GD YSFGCGESSSLGHNA      DGQ NRH+N+LSPELVTSLK
Sbjct  416  VHVATGDYTTFVVSDEGDVYSFGCGESSSLGHNAGAGAPADGQGNRHTNVLSPELVTSLK  475

Query  282  QVXERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEV  103
            +V ERVVQISLTNSIYWNAHTFALTE GKLFAFGAGDKGQLG+ L  NQTER NPERV++
Sbjct  476  EVNERVVQISLTNSIYWNAHTFALTESGKLFAFGAGDKGQLGIELENNQTERGNPERVDI  535

Query  102  DLS  94
            DLS
Sbjct  536  DLS  538



>ref|XP_003601869.1| RCC1 domain-containing protein [Medicago truncatula]
 gb|AES72120.1| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=535

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+V++AGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CE+APKVV+A +N+K 
Sbjct  357  FQTLNLQPMVISAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECEAAPKVVDALTNVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVV+EDGD YSFGCGES+SLGHNAV+ D + NRH+N+L+PELVTSLKQ+ 
Sbjct  417  VHVATGDYTTFVVAEDGDVYSFGCGESASLGHNAVI-DAEGNRHANVLNPELVTSLKQIN  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER NPE+V++DL
Sbjct  476  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERVNPEQVDIDL  534



>gb|KJB31063.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
 gb|KJB31064.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
 gb|KJB31068.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
 gb|KJB31070.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
Length=534

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNEDCES PKVVEA SN+K 
Sbjct  356  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEDCESVPKVVEALSNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN    +GQ NRH+N+LSPELV SLKQV 
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHN-TAGEGQGNRHANVLSPELVMSLKQVN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L+ NQTER NPERV++DL+
Sbjct  475  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELANNQTERGNPERVDIDLN  534



>gb|KDO82112.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
Length=534

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A +++K 
Sbjct  356  FQLLNLQPVVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVSEDGD YSFGCGES+SLGHNA+  DGQ NRH+N+L+P+LVTSLKQV 
Sbjct  416  IHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIA-DGQGNRHANVLTPQLVTSLKQVN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L  NQTER NPERV++DLS
Sbjct  475  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNNQTERGNPERVDIDLS  534



>ref|XP_006438172.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
 ref|XP_006484001.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006484002.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Citrus sinensis]
 gb|ESR51412.1| hypothetical protein CICLE_v10031198mg [Citrus clementina]
Length=534

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A +++K 
Sbjct  356  FQLLNLQPVVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVSEDGD YSFGCGES+SLGHNA+  DGQ NRH+N+L+P+LVTSLKQV 
Sbjct  416  IHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIA-DGQGNRHANVLTPQLVTSLKQVN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L  NQTER NPERV++DLS
Sbjct  475  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNNQTERGNPERVDIDLS  534



>ref|XP_004310005.1| PREDICTED: ultraviolet-B receptor UVR8 [Fragaria vesca subsp. 
vesca]
 ref|XP_011457427.1| PREDICTED: ultraviolet-B receptor UVR8 [Fragaria vesca subsp. 
vesca]
 ref|XP_011457428.1| PREDICTED: ultraviolet-B receptor UVR8 [Fragaria vesca subsp. 
vesca]
Length=535

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CESAPKVVEA SN+K 
Sbjct  357  FQLLNLQPKVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESAPKVVEALSNVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSE+GD YSFGCGES+SLGHN+   DGQ NRH+N+L+PELV+SLKQV 
Sbjct  417  VHVATGDYTTFVVSEEGDVYSFGCGESASLGHNSAA-DGQGNRHANVLAPELVSSLKQVN  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER NPE V++DL
Sbjct  476  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERGNPELVDIDL  534


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 64/145 (44%), Gaps = 16/145 (11%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   ++G    G LGHG  + E  PK + +   I+ +H A G   T ++S+ G  Y FG 
Sbjct  165  GTAYSFGSNSSGQLGHGTTEEEWRPKPIRSLQGIRIIHAAAGAGRTMLISDAGKVYHFG-  223

Query  381  GESSSLGHNAVVXDGQVNRHSNILS-PELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
                S G       G     S ++S P+LV SLK +   VVQ ++ N       T  L+ 
Sbjct  224  --KDSFGETEYGVQG-----SKLVSTPQLVESLKDIF--VVQAAIGNFF-----TAVLSR  269

Query  204  XGKLFAFGAGDKGQLGVALSANQTE  130
             G+++    G   +LG     N  E
Sbjct  270  EGRVYTISWGSDDKLGHQTEPNDVE  294



>gb|KJB31065.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
Length=535

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNEDCES PKVVEA SN+K 
Sbjct  356  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEDCESVPKVVEALSNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN      Q NRH+N+LSPELV SLKQV 
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNTAGEGQQGNRHANVLSPELVMSLKQVN  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L+ NQTER NPERV++DL+
Sbjct  476  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELANNQTERGNPERVDIDLN  535



>ref|XP_007044919.1| Regulator of chromosome condensation (RCC1) family protein isoform 
1 [Theobroma cacao]
 gb|EOY00751.1| Regulator of chromosome condensation (RCC1) family protein isoform 
1 [Theobroma cacao]
Length=534

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA S +K 
Sbjct  356  FQLLNLQPVVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSKVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN+V  +GQ NRH+N+LSPELVTSLKQV 
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNSVA-EGQGNRHANVLSPELVTSLKQVN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L  NQTER NPERV++DL+
Sbjct  475  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVNNQTERGNPERVDIDLN  534



>ref|XP_008221955.1| PREDICTED: ultraviolet-B receptor UVR8 [Prunus mume]
 ref|XP_008221956.1| PREDICTED: ultraviolet-B receptor UVR8 [Prunus mume]
 ref|XP_008221958.1| PREDICTED: ultraviolet-B receptor UVR8 [Prunus mume]
Length=535

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA SN+K 
Sbjct  357  FQLLNLQPMVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSNVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+    DGQ NRH+N+L+PELVTSLKQV 
Sbjct  417  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHSTAT-DGQGNRHANVLAPELVTSLKQVN  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER NPE+V++DL
Sbjct  476  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERGNPEQVDIDL  534



>ref|XP_007222374.1| hypothetical protein PRUPE_ppa004014mg [Prunus persica]
 gb|EMJ23573.1| hypothetical protein PRUPE_ppa004014mg [Prunus persica]
Length=535

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA SN+K 
Sbjct  357  FQLLNLQPMVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSNVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+    DGQ NRH+N+L+PELVTSLKQV 
Sbjct  417  VHVATGDYTTFVVSKDGDVYSFGCGESASLGHSTAT-DGQGNRHANVLAPELVTSLKQVN  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER NPE+V++DL
Sbjct  476  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERGNPEQVDIDL  534



>ref|XP_004502353.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502354.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502355.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X3 [Cicer arietinum]
 ref|XP_004502356.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X4 [Cicer arietinum]
 ref|XP_004502357.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X5 [Cicer arietinum]
Length=536

 Score =   286 bits (731),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CE+APKVV+A +N+K 
Sbjct  358  FQTLNLQPMVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECEAAPKVVDALTNVKA  417

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGES+SLGHNA V D Q NRH+N+L+PELVTSLKQ+ 
Sbjct  418  VHVATGDYTTFVVSEDGDVYSFGCGESASLGHNA-VNDAQGNRHANVLNPELVTSLKQIN  476

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER NPE+V++ L
Sbjct  477  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERVNPEKVDIHL  535



>ref|XP_009769667.1| PREDICTED: ultraviolet-B receptor UVR8 [Nicotiana sylvestris]
Length=535

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNEDCESAPKVVEA +N+K 
Sbjct  356  FQTLNLQPAVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEDCESAPKVVEALNNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            V+VATGDYTTFVVS++G+ YSFGCGESSSLGHN  V + Q  RHSN+L PE+VTSLKQ+ 
Sbjct  416  VYVATGDYTTFVVSDEGNVYSFGCGESSSLGHNTAVAEEQGIRHSNVLFPEVVTSLKQLN  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLGV LSANQTERA PERV++DL
Sbjct  476  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGVELSANQTERAIPERVDIDL  534



>gb|KHN44387.1| Putative E3 ubiquitin-protein ligase HERC4 [Glycine soja]
Length=475

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA SN+K 
Sbjct  296  FGLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSNVKA  355

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCG+S+SLGHNA   D Q NRH+ +L PELVTSLKQ+ 
Sbjct  356  VHVATGDYTTFVVSDDGDVYSFGCGQSASLGHNAAGNDEQGNRHAKVLDPELVTSLKQIN  415

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTN  YWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER NPERVE+DL
Sbjct  416  ERVVQISLTNCNYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERGNPERVEIDL  474



>ref|XP_010682363.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682364.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682365.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4 [Beta vulgaris 
subsp. vulgaris]
Length=541

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ALNLQP+VVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNEDCES PKVVEA S++K 
Sbjct  362  FQALNLQPMVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEDCESVPKVVEALSDVKA  421

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVS+DGD YSFGCGESSSLGHN+   DG+ NRH+N+L PELVTSLKQV 
Sbjct  422  IHVATGDYTTFVVSDDGDVYSFGCGESSSLGHNSGA-DGEGNRHANVLKPELVTSLKQVK  480

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSI+WNAHTFALTE GKL+AFGAGDKGQLG  L  NQ ER NPE VE+DL
Sbjct  481  ERVVQISLTNSIFWNAHTFALTESGKLYAFGAGDKGQLGTKLGENQIERGNPEAVEIDL  539



>ref|XP_006591478.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Glycine max]
 ref|XP_003538581.2| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Glycine max]
Length=531

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA SN+K 
Sbjct  352  FGLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSNVKA  411

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCG+S+SLGHNA   D Q NRH+ +L PELVTSLKQ+ 
Sbjct  412  VHVATGDYTTFVVSDDGDVYSFGCGQSASLGHNAAGNDEQGNRHAKVLDPELVTSLKQIN  471

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTN  YWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER NPERVE+DL
Sbjct  472  ERVVQISLTNCNYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERGNPERVEIDL  530



>gb|KHG17032.1| putative E3 ubiquitin-protein ligase HERC4 [Gossypium arboreum]
Length=519

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA  ++K 
Sbjct  340  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALRDVKA  399

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN      Q NRH+N+LSPELV SLKQV 
Sbjct  400  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNTAGEGQQGNRHANVLSPELVMSLKQVN  459

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L+ NQTER NPERV++DL+
Sbjct  460  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELANNQTERGNPERVDIDLN  519



>ref|XP_008361816.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361817.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361818.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361819.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361820.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361822.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361823.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361824.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361825.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
 ref|XP_008361826.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica]
Length=534

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA S +K 
Sbjct  356  FQVLNLQPMVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSQVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+    DGQ NRH+N+L+PELVTSLKQV 
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHS-TAADGQGNRHANVLAPELVTSLKQVN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER  PE V++DL
Sbjct  475  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERGKPELVDIDL  533


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 69/149 (46%), Gaps = 19/149 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   ++G    G LGHG  + E  P+ + +   I+ +H A G   T ++S+ G  Y+FG 
Sbjct  164  GSVYSFGSNSSGQLGHGTTEEEXRPQPIRSLQGIRIIHAAAGAGRTMLISDAGKVYAFG-  222

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
                S G       G       + +P+LV SLK +   VVQ ++ N       T  L+  
Sbjct  223  --KDSFGETEYGVQGS----KLVTTPQLVESLKDIF--VVQAAIGNFF-----TAVLSRE  269

Query  201  GKLFAFGAGDKGQLGVALSANQTERANPE  115
            G+++ F  G+  +LG     +QTE  + E
Sbjct  270  GRVYTFSWGNDAKLG-----HQTEPTDVE  293



>ref|XP_010100324.1| hypothetical protein L484_027632 [Morus notabilis]
 gb|EXB82458.1| hypothetical protein L484_027632 [Morus notabilis]
Length=524

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CESAPKVVEA S +K 
Sbjct  345  FQHLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESAPKVVEALSKVKA  404

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSE+GD YSFGCGES+SLGHN    DG+  RH+N+L+PELVT+LK+V 
Sbjct  405  VHVATGDYTTFVVSEEGDVYSFGCGESASLGHNNAGADGEGVRHANVLTPELVTALKEVN  464

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L  +QTER NPERV++DLS
Sbjct  465  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVGSQTERGNPERVDIDLS  524



>gb|KJB60985.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
 gb|KJB60987.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
Length=421

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FR LNLQP+VVA GAWHAAVV +DGR CTWGWGRYGCLGHGNE+CES PKVVEA   +K 
Sbjct  244  FRLLNLQPMVVATGAWHAAVVARDGRVCTWGWGRYGCLGHGNEECESVPKVVEALIKVKA  303

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFV+SEDGD YSFGCGES+SLGHN    +GQ NRH+N+LSPELV SLKQV 
Sbjct  304  VHVATGDYTTFVLSEDGDVYSFGCGESASLGHNTAA-EGQGNRHANVLSPELVKSLKQVK  362

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            E+VVQISLTNSI+WNAHTFALTE GKL+AFGAGDKGQLGV L  NQTER NPERV++DL
Sbjct  363  EKVVQISLTNSIHWNAHTFALTESGKLYAFGAGDKGQLGVELMNNQTERVNPERVDIDL  421



>ref|XP_011044684.1| PREDICTED: ultraviolet-B receptor UVR8-like [Populus euphratica]
Length=536

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A S +K 
Sbjct  358  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVDALSKVKA  417

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHNA   DGQ NRH+N+LSPELVTSLK+V 
Sbjct  418  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNA-DDDGQGNRHTNVLSPELVTSLKEVK  476

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNS+YWNAHTFALTE GKLFAFGAGDKGQLG+ L  NQTER NPE V+VDL
Sbjct  477  ERVVQISLTNSVYWNAHTFALTESGKLFAFGAGDKGQLGMELVNNQTERGNPELVDVDL  535



>ref|XP_008446114.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Cucumis melo]
 ref|XP_008446116.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Cucumis melo]
 ref|XP_008446117.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Cucumis melo]
 ref|XP_008446118.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Cucumis melo]
Length=534

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES+PKVVEA  N+K 
Sbjct  356  FQLLNLQPVVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESSPKVVEALINVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN VV + Q NR  ++LSPELV SLKQ+ 
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNVVVPEEQGNRQPHVLSPELVRSLKQIN  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLGV L ANQTER NPERV++DL
Sbjct  476  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGVEL-ANQTERGNPERVDIDL  533



>ref|XP_002321983.2| hypothetical protein POPTR_0015s01170g [Populus trichocarpa]
 gb|EEF06110.2| hypothetical protein POPTR_0015s01170g [Populus trichocarpa]
Length=540

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A S +K 
Sbjct  362  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVDALSKVKA  421

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN    DGQ NRH+N+LSPELVTSLK+V 
Sbjct  422  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNG-DGDGQGNRHTNVLSPELVTSLKEVK  480

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNS+YWNAHTFALTE GKLFAFGAGDKGQLG+ L  NQTER NPE+V+VDL
Sbjct  481  ERVVQISLTNSVYWNAHTFALTESGKLFAFGAGDKGQLGMELVNNQTERGNPEQVDVDL  539



>gb|KHG25634.1| E3 ubiquitin-protein ligase HERC2 [Gossypium arboreum]
Length=515

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FR LNLQP+VVAAGAWHAAVV +DGR CTWGWGRYGCLGHGNE+CES PKVVEA S +K 
Sbjct  337  FRLLNLQPMVVAAGAWHAAVVAQDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSKVKA  396

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFV+SEDGD YSFGCGES+SLGHN    +GQ NRH+N+LSPELV SLKQV 
Sbjct  397  VHVATGDYTTFVLSEDGDVYSFGCGESASLGHN-TAAEGQGNRHANVLSPELVKSLKQVK  455

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            E+VVQISLTNSI+WNAHTFALTE GKL+AFGAGDKGQLGV L  NQTER NPER+++DL
Sbjct  456  EKVVQISLTNSIHWNAHTFALTESGKLYAFGAGDKGQLGVELMNNQTERINPERIDIDL  514



>gb|EYU22552.1| hypothetical protein MIMGU_mgv1a004258mg [Erythranthe guttata]
Length=537

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 163/186 (88%), Gaps = 6/186 (3%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F++LNLQP+VVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNEDCESAPKVVEA S++K 
Sbjct  352  FQSLNLQPMVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEDCESAPKVVEALSDVKA  411

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGH------NAVVXDGQVNRHSNILSPELVT  292
            VHVATGDYTTFVVS++G+ YSFGCGESSSLGH       A   D Q NRH N+L+PELVT
Sbjct  412  VHVATGDYTTFVVSDEGEVYSFGCGESSSLGHNNNAAVVAAAADEQGNRHLNVLTPELVT  471

Query  291  SLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
            SLKQV E+VVQISLTNSIYWNAHTFALTE  KLFAFGAGDKGQLGV L  NQTERANPER
Sbjct  472  SLKQVKEKVVQISLTNSIYWNAHTFALTESDKLFAFGAGDKGQLGVQLVDNQTERANPER  531

Query  111  VEVDLS  94
            V+++LS
Sbjct  532  VDINLS  537


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 68/137 (50%), Gaps = 16/137 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G   ++G    G LGHG  D E  P+++ +   I+ +H A G   T ++S+ G  YSFG
Sbjct  159  NGAVYSFGSNSSGQLGHGTTDEEPRPRIIRSMQGIRIIHAAAGAGRTMLISDAGRVYSFG  218

Query  384  CGESSSLGHNAVVXDGQVNRHSNIL-SPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
                 S G       G     SN++ +P++V SLK +    VQ ++ N       T  L+
Sbjct  219  ---KDSFGEVEYGAQG-----SNLVTTPQIVESLKDIF--AVQAAIGNFF-----TAVLS  263

Query  207  EXGKLFAFGAGDKGQLG  157
              G+++ F  GD+ +LG
Sbjct  264  REGRVYTFSWGDESKLG  280



>gb|KJB60986.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
Length=534

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FR LNLQP+VVA GAWHAAVV +DGR CTWGWGRYGCLGHGNE+CES PKVVEA   +K 
Sbjct  357  FRLLNLQPMVVATGAWHAAVVARDGRVCTWGWGRYGCLGHGNEECESVPKVVEALIKVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFV+SEDGD YSFGCGES+SLGHN    +GQ NRH+N+LSPELV SLKQV 
Sbjct  417  VHVATGDYTTFVLSEDGDVYSFGCGESASLGHN-TAAEGQGNRHANVLSPELVKSLKQVK  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            E+VVQISLTNSI+WNAHTFALTE GKL+AFGAGDKGQLGV L  NQTER NPERV++DL
Sbjct  476  EKVVQISLTNSIHWNAHTFALTESGKLYAFGAGDKGQLGVELMNNQTERVNPERVDIDL  534



>ref|XP_009359259.1| PREDICTED: ultraviolet-B receptor UVR8 [Pyrus x bretschneideri]
Length=534

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGW RYGCLGHGNE+CES PKVVEA S +K 
Sbjct  356  FQVLNLQPMVVAAGAWHAAVVGQDGRVCTWGWVRYGCLGHGNEECESVPKVVEALSQVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+    DGQ NRH+N+L+PELVTSLKQV 
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHS-TAADGQGNRHANVLAPELVTSLKQVN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER  PE V++DL
Sbjct  475  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERGKPELVDIDL  533


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 69/149 (46%), Gaps = 19/149 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   ++G    G LGHG  + E  P+ + +   I+ +H A G   T ++S+ G  Y+FG 
Sbjct  164  GSVYSFGSNSSGQLGHGTTEEEXXPQPIRSLQGIRIIHAAAGAGRTMLISDAGKVYAFG-  222

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
                S G       G       + +P+LV SLK +   VVQ ++ N       T  L+  
Sbjct  223  --KDSFGETEYGVQGS----KLVTTPQLVESLKDIF--VVQAAIGNFF-----TAVLSRE  269

Query  201  GKLFAFGAGDKGQLGVALSANQTERANPE  115
            G+++ F  G+  +LG     +QTE  + E
Sbjct  270  GRVYTFSWGNDAKLG-----HQTEPTDVE  293



>gb|KJB60980.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
 gb|KJB60984.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
Length=533

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FR LNLQP+VVA GAWHAAVV +DGR CTWGWGRYGCLGHGNE+CES PKVVEA   +K 
Sbjct  356  FRLLNLQPMVVATGAWHAAVVARDGRVCTWGWGRYGCLGHGNEECESVPKVVEALIKVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFV+SEDGD YSFGCGES+SLGHN    +GQ NRH+N+LSPELV SLKQV 
Sbjct  416  VHVATGDYTTFVLSEDGDVYSFGCGESASLGHN-TAAEGQGNRHANVLSPELVKSLKQVK  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            E+VVQISLTNSI+WNAHTFALTE GKL+AFGAGDKGQLGV L  NQTER NPERV++DL
Sbjct  475  EKVVQISLTNSIHWNAHTFALTESGKLYAFGAGDKGQLGVELMNNQTERVNPERVDIDL  533



>ref|XP_009387758.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009387759.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
Length=534

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ALNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNEDCES PKVVE+  NIK 
Sbjct  356  FQALNLQPTVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEDCESVPKVVESLDNIKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVS+ GD YSFGCGESSSLGH+  + DGQ NRH+N+LSP LVTSLK + 
Sbjct  416  IHVATGDYTTFVVSDTGDVYSFGCGESSSLGHSTAI-DGQGNRHANVLSPRLVTSLKDIN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALT+ G+L+AFGAGDKGQLGV L A QTER  PE VE+DLS
Sbjct  475  ERVVQISLTNSIYWNAHTFALTDSGRLYAFGAGDKGQLGVELVAQQTERETPECVEIDLS  534



>emb|CAN77314.1| hypothetical protein VITISV_008041 [Vitis vinifera]
Length=541

 Score =   278 bits (711),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA  N+K 
Sbjct  358  FQILNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALINVKA  417

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGESSSLGHN    DGQ NRH+NILSPELVTSLKQ+ 
Sbjct  418  VHVATGDYTTFVVSDDGDVYSFGCGESSSLGHNN-GPDGQGNRHANILSPELVTSLKQIK  476

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
            ER+VQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLGV L  NQTER NPER
Sbjct  477  ERMVQISLTNSIYWNAHTFALTETGKLYAFGAGDKGQLGVELVXNQTERGNPER  530



>ref|XP_011024876.1| PREDICTED: ultraviolet-B receptor UVR8-like [Populus euphratica]
 ref|XP_011024877.1| PREDICTED: ultraviolet-B receptor UVR8-like [Populus euphratica]
 ref|XP_011024878.1| PREDICTED: ultraviolet-B receptor UVR8-like [Populus euphratica]
 ref|XP_011024879.1| PREDICTED: ultraviolet-B receptor UVR8-like [Populus euphratica]
Length=538

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA S +K 
Sbjct  360  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSKVKA  419

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            V+VATGDYTTFVVS+DGD YSFGCGES+SLGHNA   D Q NRH N+LSPELVTSLK+V 
Sbjct  420  VNVATGDYTTFVVSDDGDVYSFGCGESASLGHNAAA-DEQGNRHVNVLSPELVTSLKEVK  478

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L  NQ+ER NPERV+VDL
Sbjct  479  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGMELVNNQSERGNPERVDVDL  537



>ref|XP_008389759.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
 ref|XP_008389760.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
 ref|XP_008389761.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
 ref|XP_008389762.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
 ref|XP_008389763.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
 ref|XP_008389764.1| PREDICTED: ultraviolet-B receptor UVR8 [Malus domestica]
Length=534

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 158/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LN QP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA S +K 
Sbjct  356  FQVLNJQPMVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSQVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+ GD YSFGCGES+SLGH+    DGQ NRH+N+L+PELVTSLKQV 
Sbjct  416  VHVATGDYTTFVVSDVGDVYSFGCGESASLGHS-TAADGQGNRHANVLAPELVTSLKQVN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L ANQTER  PE V++DL
Sbjct  475  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIELVANQTERGKPELVDIDL  533



>ref|XP_008796028.1| PREDICTED: ultraviolet-B receptor UVR8 [Phoenix dactylifera]
 ref|XP_008796029.1| PREDICTED: ultraviolet-B receptor UVR8 [Phoenix dactylifera]
Length=534

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA SN+K 
Sbjct  356  FQTLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVV+E GD YSFGCGESSSLGH +   DGQ NRH+N+LSPELVTSLK++ 
Sbjct  416  VHVATGDYTTFVVAETGDVYSFGCGESSSLGH-STGADGQANRHTNVLSPELVTSLKKIN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALT+ GKL+AFGA DKGQLG+ L   Q ER +PERV++DLS
Sbjct  475  ERVVQISLTNSIYWNAHTFALTDSGKLYAFGAADKGQLGIELVGQQNERGSPERVDIDLS  534



>ref|XP_010929984.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Elaeis guineensis]
Length=534

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA SNIK 
Sbjct  356  FQTLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSNIKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVV+E GD YSFGCGESSSLGH +   DGQ NRH+N+LSPELVTSLK++ 
Sbjct  416  VHVATGDYTTFVVAETGDVYSFGCGESSSLGH-STGADGQANRHTNVLSPELVTSLKKIN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALT+ G+L+AFGA DKGQLG+ L   Q ER  PERV++DLS
Sbjct  475  ERVVQISLTNSIYWNAHTFALTDSGELYAFGAADKGQLGIELVGQQNERGTPERVDIDLS  534



>ref|XP_004135288.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like [Cucumis 
sativus]
 ref|XP_004159669.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like [Cucumis 
sativus]
 gb|KGN51719.1| hypothetical protein Csa_5G593320 [Cucumis sativus]
Length=534

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNEDCES+PKVVEA  N+K 
Sbjct  356  FQLLNLQPVVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEDCESSPKVVEALINVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN V+ + + NR  ++L PELV SLKQ+ 
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNVVLPEEEGNRQPHVLKPELVRSLKQIS  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLGV L ANQTER NPE V++DL
Sbjct  476  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGVEL-ANQTERGNPELVDIDL  533



>ref|XP_002317792.2| hypothetical protein POPTR_0012s02560g [Populus trichocarpa]
 gb|EEE96012.2| hypothetical protein POPTR_0012s02560g [Populus trichocarpa]
Length=538

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA S +K 
Sbjct  360  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSKVKA  419

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            V+VATGDYTTFVVS++GD YSFGCGES+SLGHNA   D Q NRH N+LSPELVTSLK+V 
Sbjct  420  VNVATGDYTTFVVSDEGDVYSFGCGESASLGHNAAA-DEQGNRHVNVLSPELVTSLKEVK  478

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+ L  NQ+ER NPERV+VDL
Sbjct  479  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGMELVNNQSERGNPERVDVDL  537



>ref|XP_004962592.1| PREDICTED: ultraviolet-B receptor UVR8-like [Setaria italica]
Length=534

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 158/180 (88%), Gaps = 2/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FR+LN+QPVVVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNE+CES PKVVEA S +K 
Sbjct  357  FRSLNIQPVVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSGVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+ GD YSFGCGESSSLGHN +      NRH+N+LSPELVTSLK V 
Sbjct  417  VHVATGDYTTFVVSDKGDVYSFGCGESSSLGHNTITEGN--NRHTNVLSPELVTSLKGVN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNSIYWNAHTFALT+ GKL+AFGAGDKGQLG  L A Q+ER NPERVEVDL+
Sbjct  475  ERMVQISLTNSIYWNAHTFALTDSGKLYAFGAGDKGQLGTELVAQQSERGNPERVEVDLN  534


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 69/144 (48%), Gaps = 14/144 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G    G LGHGN + E  P+V+ +   I+ +  A G   T +VS+ G  Y+FG 
Sbjct  165  GAVYTFGSNNSGQLGHGNLEEEWRPRVIRSLQGIRIIQAAAGAGRTMLVSDAGRVYAFG-  223

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
                S G   V   GQ +R   + +P++V SLK     +VQ ++ N       T  L+  
Sbjct  224  --KDSFGE--VEYGGQGSR--VVTTPQMVESLKDTY--IVQAAIGNFF-----TAVLSRE  270

Query  201  GKLFAFGAGDKGQLGVALSANQTE  130
            G+++ F  G+  +LG     N  +
Sbjct  271  GRVYTFSWGNDTRLGHQTEPNDVQ  294



>ref|XP_002515036.1| RCC1 and BTB domain-containing protein, putative [Ricinus communis]
 gb|EEF47590.1| RCC1 and BTB domain-containing protein, putative [Ricinus communis]
Length=537

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 161/183 (88%), Gaps = 4/183 (2%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A SNIK 
Sbjct  356  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVDALSNIKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGH---NAVVXDGQVNRHSNILSPELVTSLK  283
            VHVATGDYTTFVVSE+GD YSFGCGES+SLGH    A   DGQ  RH+N+LSPELVTSLK
Sbjct  416  VHVATGDYTTFVVSEEGDVYSFGCGESASLGHNAAAAANADGQ-GRHANVLSPELVTSLK  474

Query  282  QVXERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEV  103
            +V ERVVQISLTNSIYWNAHTFALT+ GKL+AFGAGDKGQLG  L  NQTER NPERV++
Sbjct  475  EVNERVVQISLTNSIYWNAHTFALTDSGKLYAFGAGDKGQLGTELVNNQTERGNPERVDI  534

Query  102  DLS  94
            DLS
Sbjct  535  DLS  537



>ref|XP_010929983.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Elaeis guineensis]
Length=556

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA SNIK 
Sbjct  378  FQTLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSNIKA  437

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVV+E GD YSFGCGESSSLGH +   DGQ NRH+N+LSPELVTSLK++ 
Sbjct  438  VHVATGDYTTFVVAETGDVYSFGCGESSSLGH-STGADGQANRHTNVLSPELVTSLKKIN  496

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALT+ G+L+AFGA DKGQLG+ L   Q ER  PERV++DLS
Sbjct  497  ERVVQISLTNSIYWNAHTFALTDSGELYAFGAADKGQLGIELVGQQNERGTPERVDIDLS  556



>gb|ABA97468.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABA97469.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABG21962.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABG21963.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
Length=439

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 156/180 (87%), Gaps = 2/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ALN+QPVVVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNE+CES PKVVE+  N++ 
Sbjct  262  FQALNIQPVVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEECESVPKVVESLVNVRA  321

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+ GD YSFGCGESSSLGHN +      NRH+N+LSPELVTSLK+  
Sbjct  322  VHVATGDYTTFVVSDKGDVYSFGCGESSSLGHNTITEGN--NRHTNVLSPELVTSLKRTN  379

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERV QISLTNSIYWNAHTFALT+ GKL+AFGAGDKGQLG  L A ++ER  PERVE+DLS
Sbjct  380  ERVAQISLTNSIYWNAHTFALTDSGKLYAFGAGDKGQLGTELVAQESERGTPERVEIDLS  439


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/144 (28%), Positives = 65/144 (45%), Gaps = 14/144 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G    G LGHG+ + E  P+++ +   I+ +  A G   T +VS+ G  Y+FG 
Sbjct  70   GAVYTFGSNSSGQLGHGSLEEEWRPRIIRSLQGIRIIQAAAGAGRTMLVSDAGRVYAFG-  128

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
                S G       G       + +P+LV SLK +   +VQ ++ N       T  L+  
Sbjct  129  --KDSFGEVEYAAQGS----RVVTTPQLVESLKDIY--IVQAAIGNFF-----TAVLSRE  175

Query  201  GKLFAFGAGDKGQLGVALSANQTE  130
            G ++ F  G+  +LG     N  +
Sbjct  176  GHVYTFSWGNDMKLGHQTEPNDVQ  199



>emb|CDY04192.1| BnaA09g19700D [Brassica napus]
Length=492

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S++K 
Sbjct  314  FKVLNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHVKA  373

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGES+SLGH+ V+ D Q NRH N+LSP +VTSLKQ  
Sbjct  374  VHVATGDYTTFVVSEDGDVYSFGCGESASLGHHPVL-DEQGNRHGNVLSPAVVTSLKQAK  432

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKLFAFGAGDKGQLG  L  + TER  PE+V++DLS
Sbjct  433  ERVVQISLTNSIYWNAHTFALTESGKLFAFGAGDKGQLGAELGRDLTERCVPEKVDIDLS  492


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 71/147 (48%), Gaps = 20/147 (14%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG-  385
            G+  T+G+   G LGHG+ D E     V +   I+ +  A G   T ++S++G  Y+ G 
Sbjct  122  GQVYTFGYNNSGQLGHGHTDEEPRILPVRSLQGIRIIQAAAGAGRTMLISDNGSVYACGK  181

Query  384  --CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
               GE+   G  + +          + +P+LVTSLK +   VVQ ++ N       T  L
Sbjct  182  DLFGEAEYGGKGSRL----------VTTPQLVTSLKNIF--VVQAAIGNFF-----TAIL  224

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  GK++ F  G+ G+LG    AN  E
Sbjct  225  SREGKVYTFSWGNDGRLGHQTEANDLE  251



>emb|CDY39172.1| BnaC09g21720D [Brassica napus]
Length=492

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S++K 
Sbjct  314  FQVLNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHVKA  373

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGES+SLGH+ V+ D Q NRH N+LSP +VTSLKQ  
Sbjct  374  VHVATGDYTTFVVSEDGDVYSFGCGESASLGHHPVL-DEQGNRHGNVLSPAVVTSLKQAK  432

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKLFAFGAGDKGQLG  L  + TER  PE+V++DLS
Sbjct  433  ERVVQISLTNSIYWNAHTFALTESGKLFAFGAGDKGQLGAELGRDLTERCVPEKVDIDLS  492


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 70/144 (49%), Gaps = 14/144 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G+  T+G+   G LGHG+ D E     V +   I+ +  A G   T ++S++G  Y+  C
Sbjct  122  GQVYTFGYNNSGQLGHGHTDEEPRILPVRSLQGIRIIQAAAGAGRTMLISDNGSVYA--C  179

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G+            GQ +R   + +P+LV SLK +   VVQ ++ N       T  L+  
Sbjct  180  GKDL---FGEAEYGGQGSR--PVTTPQLVASLKHIF--VVQAAIGNFF-----TAILSRE  227

Query  201  GKLFAFGAGDKGQLGVALSANQTE  130
            GK++ F  G+ G+LG    AN  E
Sbjct  228  GKVYTFSWGNDGRLGHQTEANDLE  251



>ref|XP_003578713.1| PREDICTED: ultraviolet-B receptor UVR8 [Brachypodium distachyon]
Length=534

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 155/180 (86%), Gaps = 2/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LN+QPVVVAAGAWHAAVV KDGR CTWGWGRYGCLGHGNE+CES PKVVEA  ++K 
Sbjct  357  FQTLNIQPVVVAAGAWHAAVVSKDGRVCTWGWGRYGCLGHGNEECESVPKVVEALGSVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+ GD YSFGCGESSSLGHN ++     NRHSN+LSPELVTSLK+  
Sbjct  417  VHVATGDYTTFVVSDKGDVYSFGCGESSSLGHNTIIEGN--NRHSNVLSPELVTSLKRTN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQ+SLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG  L A Q ER  PERVE+DLS
Sbjct  475  ERVVQVSLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGTELVAQQNERGAPERVEIDLS  534



>gb|EEC69101.1| hypothetical protein OsI_38005 [Oryza sativa Indica Group]
Length=534

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 156/180 (87%), Gaps = 2/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ALN+QPVVVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNE+CES PKVVE+  N++ 
Sbjct  357  FQALNIQPVVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEECESVPKVVESLVNVRA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVS+ GD YSFGCGESSSLGHN +      NRH+N+LSPELVTSLK+  
Sbjct  417  IHVATGDYTTFVVSDKGDVYSFGCGESSSLGHNTITEGN--NRHTNVLSPELVTSLKRTN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERV QISLTNSIYWNAHTFALT+ GKL+AFGAGDKGQLG  L A Q+ER  PERVE+DLS
Sbjct  475  ERVAQISLTNSIYWNAHTFALTDSGKLYAFGAGDKGQLGTELVAQQSERGTPERVEIDLS  534


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/144 (28%), Positives = 65/144 (45%), Gaps = 14/144 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G    G LGHG+ + E  P+++ +   I+ +  A G   T +VS+ G  Y+FG 
Sbjct  165  GAVYTFGSNSSGQLGHGSLEEEWRPRIIRSLQGIRIIQAAAGAGRTMLVSDAGRVYAFG-  223

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
                S G       G       + +P+LV SLK +   +VQ ++ N       T  L+  
Sbjct  224  --KDSFGEVEYAAQGS----RVVTTPQLVESLKDIY--IVQAAIGNFF-----TAVLSRE  270

Query  201  GKLFAFGAGDKGQLGVALSANQTE  130
            G ++ F  G+  +LG     N  +
Sbjct  271  GHVYTFSWGNDMKLGHQTEPNDVQ  294



>ref|NP_566789.1| regulator of chromosome condensation repeat-containing protein 
[Arabidopsis thaliana]
 gb|AAK59536.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15211.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77118.1| regulator of chromosome condensation repeat-containing protein 
[Arabidopsis thaliana]
Length=432

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S++K 
Sbjct  254  FQILNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHVKA  313

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+    D Q NRH+N+LSP +VTSLKQV 
Sbjct  314  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHHPSF-DEQGNRHANVLSPTVVTSLKQVN  372

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNSIYWNAHTFALTE GKLFAFGAGD+GQLG  L  NQ ER  PE+V++DLS
Sbjct  373  ERMVQISLTNSIYWNAHTFALTESGKLFAFGAGDQGQLGTELGKNQKERCVPEKVDIDLS  432


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 19/149 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G+   G LGHG+ + E+  + V +   ++ +  A G   T ++S+DG  Y+  C
Sbjct  62   GEVYTFGYNNSGQLGHGHTEDEARIQPVRSLQGVRIIQAAAGAARTMLISDDGKVYA--C  119

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G+ S          GQ  +   + +P+LVTSLK +   VVQ ++ N  Y+ A    L+  
Sbjct  120  GKES---FGEAEYGGQGTK--PVTTPQLVTSLKNIF--VVQAAIGN--YFTA---VLSRE  167

Query  201  GKLFAFGAGDKGQLGVALSANQTERANPE  115
            GK++ F  G+ G+LG     +QTE A+ E
Sbjct  168  GKVYTFSWGNDGRLG-----HQTEAADVE  191



>ref|XP_009114097.1| PREDICTED: ultraviolet-B receptor UVR8-like [Brassica rapa]
Length=531

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S++K 
Sbjct  353  FKVLNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHVKA  412

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGES+SLGH+ V+ D Q NRH N+LSP +VTSLKQ  
Sbjct  413  VHVATGDYTTFVVSEDGDVYSFGCGESASLGHHPVL-DEQGNRHGNVLSPAVVTSLKQAK  471

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKLFAFGAGDKGQLG  L  + TER  PE+V++DLS
Sbjct  472  ERVVQISLTNSIYWNAHTFALTESGKLFAFGAGDKGQLGAELGRDLTERCVPEKVDIDLS  531


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 71/147 (48%), Gaps = 20/147 (14%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG-  385
            G+  T+G+   G LGHG+ D E     V +   I+ +  A G   T ++S++G  Y+ G 
Sbjct  161  GQVYTFGYNNSGQLGHGHTDEEPRILPVRSLQGIRIIQAAAGAGRTMLISDNGSVYACGK  220

Query  384  --CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
               GE+   G  + +          + +P+LVTSLK +   VVQ ++ N       T  L
Sbjct  221  DLFGEAEYGGKGSRL----------VTTPQLVTSLKNIF--VVQAAIGNFF-----TAIL  263

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  GK++ F  G+ G+LG    AN  E
Sbjct  264  SREGKVYTFSWGNDGRLGHQTEANDLE  290



>ref|NP_001066582.1| Os12g0284000 [Oryza sativa Japonica Group]
 gb|ABA97465.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABA97466.1| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABA97467.2| regulator of chromosome condensation, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29601.1| Os12g0284000 [Oryza sativa Japonica Group]
 dbj|BAG89336.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89767.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93803.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53047.1| hypothetical protein OsJ_35777 [Oryza sativa Japonica Group]
Length=534

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 156/180 (87%), Gaps = 2/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ALN+QPVVVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNE+CES PKVVE+  N++ 
Sbjct  357  FQALNIQPVVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEECESVPKVVESLVNVRA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+ GD YSFGCGESSSLGHN +      NRH+N+LSPELVTSLK+  
Sbjct  417  VHVATGDYTTFVVSDKGDVYSFGCGESSSLGHNTITEGN--NRHTNVLSPELVTSLKRTN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERV QISLTNSIYWNAHTFALT+ GKL+AFGAGDKGQLG  L A ++ER  PERVE+DLS
Sbjct  475  ERVAQISLTNSIYWNAHTFALTDSGKLYAFGAGDKGQLGTELVAQESERGTPERVEIDLS  534


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/144 (28%), Positives = 65/144 (45%), Gaps = 14/144 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G    G LGHG+ + E  P+++ +   I+ +  A G   T +VS+ G  Y+FG 
Sbjct  165  GAVYTFGSNSSGQLGHGSLEEEWRPRIIRSLQGIRIIQAAAGAGRTMLVSDAGRVYAFG-  223

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
                S G       G       + +P+LV SLK +   +VQ ++ N       T  L+  
Sbjct  224  --KDSFGEVEYAAQGS----RVVTTPQLVESLKDIY--IVQAAIGNFF-----TAVLSRE  270

Query  201  GKLFAFGAGDKGQLGVALSANQTE  130
            G ++ F  G+  +LG     N  +
Sbjct  271  GHVYTFSWGNDMKLGHQTEPNDVQ  294



>ref|XP_010250918.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250919.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250920.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250921.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250922.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250923.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
 ref|XP_010250924.1| PREDICTED: ultraviolet-B receptor UVR8 [Nelumbo nucifera]
Length=533

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 158/180 (88%), Gaps = 3/180 (2%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ALN+QPV VAAGAWHAAVVG+DGR CTWGWGR+GCLGHGNE+CES PKVVEA S +K 
Sbjct  357  FQALNIQPVEVAAGAWHAAVVGRDGRVCTWGWGRFGCLGHGNEECESLPKVVEALSKVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVSEDGD YSFGCGESSSLGHN +  DGQ  +  N+LSPELVTSLKQV 
Sbjct  417  IHVATGDYTTFVVSEDGDVYSFGCGESSSLGHN-IGADGQGRQ--NVLSPELVTSLKQVK  473

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVV ISLTNSIYWNAHTFALTE GKL+ FGAGDKGQLGV   A+Q+ER NPER+++DL+
Sbjct  474  ERVVHISLTNSIYWNAHTFALTESGKLYGFGAGDKGQLGVEFVADQSERGNPERIDIDLT  533



>ref|XP_006290882.1| hypothetical protein CARUB_v10016992mg [Capsella rubella]
 gb|EOA23780.1| hypothetical protein CARUB_v10016992mg [Capsella rubella]
Length=432

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S+IK 
Sbjct  254  FKILNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHIKA  313

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+ V  D Q NR +N+LSP +VTSLKQ  
Sbjct  314  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHHPVF-DEQGNRIANVLSPAVVTSLKQAN  372

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNS+YWNAHTFALTE GKL+AFGAGDKGQLG  L  NQ+ER  PE+V++DLS
Sbjct  373  ERMVQISLTNSLYWNAHTFALTESGKLYAFGAGDKGQLGAELGKNQSERCVPEKVDIDLS  432


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 70/147 (48%), Gaps = 20/147 (14%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG-  385
            G   T+G+   G LGHG+ + E+  + V +   I+ +  A G   T ++S+DG  Y+ G 
Sbjct  62   GEVYTFGYNNSGQLGHGHTEEEAPIQPVRSLQGIRIIQAAAGAGRTMLISDDGKVYACGK  121

Query  384  -C-GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             C GE+   G               + +P+LVTSLK +   VVQ ++ N  Y+ A    L
Sbjct  122  DCFGEAEQGGQGT----------KPVTTPQLVTSLKNIF--VVQAAIGN--YFTA---VL  164

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  GK++ F  G+   LG    A   E
Sbjct  165  SREGKVYTFSWGNDAILGHGTEAADVE  191



>ref|XP_010044521.1| PREDICTED: ultraviolet-B receptor UVR8 [Eucalyptus grandis]
 ref|XP_010044522.1| PREDICTED: ultraviolet-B receptor UVR8 [Eucalyptus grandis]
 gb|KCW86609.1| hypothetical protein EUGRSUZ_B03238 [Eucalyptus grandis]
Length=531

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FR L +QP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHG+E+CE  PKVVE+ +N+K 
Sbjct  353  FRHLKVQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGDEECELVPKVVESLNNVKA  412

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSE G+ YSFGCGES+SLGH A+V DGQ NRH+N+LSP LVTSLK+V 
Sbjct  413  VHVATGDYTTFVVSEAGEVYSFGCGESASLGHVAMV-DGQGNRHTNVLSPALVTSLKEVN  471

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG+   ANQTE+  PE V+VDLS
Sbjct  472  ERIVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGIGPIANQTEKQTPEGVDVDLS  531


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (47%), Gaps = 16/146 (11%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G   T+G    G LGHG  + E  P+++ +   ++ +  A G   T ++S+ G  Y+FG
Sbjct  160  EGAVYTFGSNINGQLGHGTTEEEWRPRLIRSLQGVRIIQAAAGAGRTMLISDAGQVYAFG  219

Query  384  CGESSSLGHNAVVXDGQVNRHSNIL-SPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
                 S G       G     SN++ +P LV SLK +   VVQ ++ N       T  L+
Sbjct  220  ---KDSFGEAEWGGQG-----SNLVTTPRLVESLKGIF--VVQAAIGNFF-----TAVLS  264

Query  207  EXGKLFAFGAGDKGQLGVALSANQTE  130
              G+++ F  G  G+LG     N  E
Sbjct  265  REGRVYTFCWGSDGKLGHHTEPNDVE  290



>ref|NP_974362.1| regulator of chromosome condensation repeat-containing protein 
[Arabidopsis thaliana]
 dbj|BAB01075.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF02074.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77117.1| regulator of chromosome condensation repeat-containing protein 
[Arabidopsis thaliana]
Length=532

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S++K 
Sbjct  354  FQILNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHVKA  413

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+    D Q NRH+N+LSP +VTSLKQV 
Sbjct  414  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHHPSF-DEQGNRHANVLSPTVVTSLKQVN  472

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNSIYWNAHTFALTE GKLFAFGAGD+GQLG  L  NQ ER  PE+V++DLS
Sbjct  473  ERMVQISLTNSIYWNAHTFALTESGKLFAFGAGDQGQLGTELGKNQKERCVPEKVDIDLS  532


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 19/149 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G+   G LGHG+ + E+  + V +   ++ +  A G   T ++S+DG  Y+  C
Sbjct  162  GEVYTFGYNNSGQLGHGHTEDEARIQPVRSLQGVRIIQAAAGAARTMLISDDGKVYA--C  219

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G+ S          GQ  +   + +P+LVTSLK +   VVQ ++ N  Y+ A    L+  
Sbjct  220  GKES---FGEAEYGGQGTK--PVTTPQLVTSLKNIF--VVQAAIGN--YFTA---VLSRE  267

Query  201  GKLFAFGAGDKGQLGVALSANQTERANPE  115
            GK++ F  G+ G+LG     +QTE A+ E
Sbjct  268  GKVYTFSWGNDGRLG-----HQTEAADVE  291



>ref|XP_006663947.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006663948.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X2 [Oryza brachyantha]
 ref|XP_006663949.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform 
X3 [Oryza brachyantha]
Length=534

 Score =   268 bits (684),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ALN+QPVVVAAGAWHAAVVGKDGR CTWGWGRYGCLGH NEDCES PKVVE+  N++ 
Sbjct  357  FQALNIQPVVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHNNEDCESVPKVVESLINVRA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVS+ GD YSFGCGESSSLGHN +      NRH+N LSP+LVTSLK+  
Sbjct  417  IHVATGDYTTFVVSDKGDVYSFGCGESSSLGHNTITEGN--NRHTNFLSPKLVTSLKRTN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERV QISLTNSIYWNAHTFALT+ GKL+AFGAGDKGQLG  L A Q+ER  PERVE+DLS
Sbjct  475  ERVAQISLTNSIYWNAHTFALTDSGKLYAFGAGDKGQLGTELVAQQSERGTPERVEIDLS  534


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 64/140 (46%), Gaps = 14/140 (10%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            T+G    G LGHG  + E  P+++ +   I+ +  A G   T +VS+ G  Y+FG     
Sbjct  169  TFGSNNSGQLGHGTLEEEWRPRIIRSLQGIRIIQAAAGAGRTMLVSDAGRVYAFG---KD  225

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
            S G       G       + +P++V SLK +   +VQ ++ N       T  L+  G+++
Sbjct  226  SFGEVEYGAPGS----RVVTTPQMVESLKDIY--IVQAAIGNFF-----TAVLSREGRVY  274

Query  189  AFGAGDKGQLGVALSANQTE  130
             F  G+  +LG     N  +
Sbjct  275  TFSWGNDMKLGHQTEPNDVQ  294



>ref|XP_006852257.1| hypothetical protein AMTR_s00049p00167370 [Amborella trichopoda]
 gb|ERN13724.1| hypothetical protein AMTR_s00049p00167370 [Amborella trichopoda]
Length=536

 Score =   268 bits (684),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ L LQP VVAAGAWHAAVVG DGR CTWGWGRYGCLGHGNEDCE+ PKVVEA S +K 
Sbjct  358  FQTLRLQPKVVAAGAWHAAVVGYDGRVCTWGWGRYGCLGHGNEDCEATPKVVEALSGVKA  417

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS++GD YSFGCGESSSLGH +   D Q NRH+N LSPELVTSLK   
Sbjct  418  VHVATGDYTTFVVSDNGDVYSFGCGESSSLGH-STTADPQGNRHANFLSPELVTSLKYPN  476

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALT+ G L+AFG+GDKGQLG  L A+Q+ERANPER+++DLS
Sbjct  477  ERVVQISLTNSIYWNAHTFALTDKGNLYAFGSGDKGQLGTELVAHQSERANPERIDIDLS  536



>ref|XP_009415993.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009415994.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009415995.1| PREDICTED: ultraviolet-B receptor UVR8-like [Musa acuminata subsp. 
malaccensis]
Length=534

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+ ES PKVVE+  NIK 
Sbjct  356  FQTLNLQPRVVAAGAWHAAVVGQDGRTCTWGWGRYGCLGHGNEESESVPKVVESLDNIKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+ GD YSFG GESSSLGH++V+ DGQ NRH+N+LSP+LVTSLK + 
Sbjct  416  VHVATGDYTTFVVSDTGDVYSFGYGESSSLGHSSVI-DGQGNRHANVLSPKLVTSLKNIN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNS+YWNAHTFALT+ GKL+AFGAGDKGQLG  L A QTERA PE+V ++LS
Sbjct  475  ERVVQISLTNSVYWNAHTFALTDSGKLYAFGAGDKGQLGTELPAQQTERAMPEQVNINLS  534



>ref|XP_010912915.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010912916.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Elaeis 
guineensis]
Length=534

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A SN+K 
Sbjct  356  FQTLNLQPVVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVDALSNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVV++ GD YSFGCGESSSLGH+  V DGQ +RH N+LSPELVTSLK++ 
Sbjct  416  VHVATGDYTTFVVADTGDVYSFGCGESSSLGHSTGV-DGQADRHINVLSPELVTSLKKIN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            E+VVQISLTNSIYWNAHTFALT+ GKL+AFGA DKGQLGV L   + ER  PE V++DLS
Sbjct  475  EKVVQISLTNSIYWNAHTFALTDSGKLYAFGAADKGQLGVELVGQENERGTPEHVDIDLS  534



>ref|XP_009152081.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
 ref|XP_009152082.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
 ref|XP_009152083.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
 ref|XP_009152084.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
 ref|XP_009152085.1| PREDICTED: ultraviolet-B receptor UVR8 [Brassica rapa]
Length=529

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ALN+QP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S++K 
Sbjct  351  FQALNIQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHVKA  410

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGES+SLGH+ +  D Q NR+ N+LSP +VTSLKQV 
Sbjct  411  VHVATGDYTTFVVSEDGDVYSFGCGESASLGHH-IAADEQGNRNGNVLSPAVVTSLKQVK  469

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            E++VQISLTNSIYWNAHTFAL+E GKLFAFGAGDKGQLG  L  +QTER  PE+V +DLS
Sbjct  470  EKMVQISLTNSIYWNAHTFALSESGKLFAFGAGDKGQLGAELGRDQTERCVPEKVNIDLS  529


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 72/144 (50%), Gaps = 14/144 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G+   G LGHG+ D E+    V +   I+ +  A G   T ++S+ G+ YS  C
Sbjct  158  GEVYTFGYNNSGQLGHGHTDEEARILPVRSLQGIRIIQAAAGAGRTMLISDSGNVYS--C  215

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G+ S          GQ ++   + +P+LVTSLK +   VVQ ++ N       T  L+  
Sbjct  216  GKDS---FGEAEYGGQGSKE--VTTPQLVTSLKNIF--VVQAAIGNFF-----TAVLSRE  263

Query  201  GKLFAFGAGDKGQLGVALSANQTE  130
            GK++ F  G+ G+LG    AN  E
Sbjct  264  GKVYTFSWGNDGRLGHQTEANDVE  287



>emb|CDY13609.1| BnaA06g33140D [Brassica napus]
Length=529

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ALN+QP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S++K 
Sbjct  351  FQALNIQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHVKA  410

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGES+SLGH+ +  D Q NR+ N+LSP +VTSLKQV 
Sbjct  411  VHVATGDYTTFVVSEDGDVYSFGCGESASLGHH-IAADEQGNRNGNVLSPAVVTSLKQVK  469

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            E++VQISLTNSIYWNAHTFAL+E GKLFAFGAGDKGQLG  L  +QTER  PE+V +DLS
Sbjct  470  EKMVQISLTNSIYWNAHTFALSESGKLFAFGAGDKGQLGAELGRDQTERCVPEKVNIDLS  529


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 72/144 (50%), Gaps = 14/144 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G+   G LGHG+ D E+    V +   I+ +  A G   T ++S+ G+ YS  C
Sbjct  158  GEVYTFGYNNSGQLGHGHTDEEARILPVRSLQGIRIIQAAAGAGRTMLISDSGNVYS--C  215

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G+ S          GQ ++   + +P+LVTSLK +   VVQ ++ N       T  L+  
Sbjct  216  GKDS---FGEAEYGGQGSKE--VTTPQLVTSLKNIF--VVQAAIGNFF-----TAVLSRE  263

Query  201  GKLFAFGAGDKGQLGVALSANQTE  130
            GK++ F  G+ G+LG    AN  E
Sbjct  264  GKVYTFSWGNDGRLGHQTEANDVE  287



>emb|CDX83586.1| BnaC07g23260D [Brassica napus]
Length=529

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LN+QP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S++K 
Sbjct  351  FQVLNIQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHVKA  410

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGES+SLGH+ +  D Q NR+ N+LSP +VTSLKQV 
Sbjct  411  VHVATGDYTTFVVSEDGDVYSFGCGESASLGHH-IAADEQGNRNGNVLSPAVVTSLKQVK  469

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNSIYWNAHTFAL+E GKLFAFGAGDKGQLG  L  +QTER  PE+V +DLS
Sbjct  470  ERMVQISLTNSIYWNAHTFALSESGKLFAFGAGDKGQLGADLGRDQTERCVPEKVNIDLS  529


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 14/144 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G+   G LGHG+ + E+    V +   I+ +  A G   T ++S+ G+ Y   C
Sbjct  158  GEVYTFGYNNSGQLGHGHTEEEARILPVRSLQGIRIIQAAAGAGRTMLISDSGNVYF--C  215

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G+ S          GQ ++   + +P+LVTSLK +   VVQ ++ N       T  L+  
Sbjct  216  GKDS---FGEAEYGGQGSKE--VTTPQLVTSLKNIF--VVQAAIGNFF-----TAVLSRE  263

Query  201  GKLFAFGAGDKGQLGVALSANQTE  130
            GK++ F  G+ G+LG    AN  E
Sbjct  264  GKVYTFSWGNDGRLGHQTEANDVE  287



>ref|XP_006290883.1| hypothetical protein CARUB_v10016992mg [Capsella rubella]
 gb|EOA23781.1| hypothetical protein CARUB_v10016992mg [Capsella rubella]
Length=533

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S+IK 
Sbjct  355  FKILNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHIKA  414

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+ V  D Q NR +N+LSP +VTSLKQ  
Sbjct  415  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHHPVF-DEQGNRIANVLSPAVVTSLKQAN  473

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNS+YWNAHTFALTE GKL+AFGAGDKGQLG  L  NQ+ER  PE+V++DLS
Sbjct  474  ERMVQISLTNSLYWNAHTFALTESGKLYAFGAGDKGQLGAELGKNQSERCVPEKVDIDLS  533


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 70/147 (48%), Gaps = 20/147 (14%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG-  385
            G   T+G+   G LGHG+ + E+  + V +   I+ +  A G   T ++S+DG  Y+ G 
Sbjct  163  GEVYTFGYNNSGQLGHGHTEEEAPIQPVRSLQGIRIIQAAAGAGRTMLISDDGKVYACGK  222

Query  384  -C-GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             C GE+   G               + +P+LVTSLK +   VVQ ++ N  Y+ A    L
Sbjct  223  DCFGEAEQGGQGT----------KPVTTPQLVTSLKNIF--VVQAAIGN--YFTA---VL  265

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  GK++ F  G+   LG    A   E
Sbjct  266  SREGKVYTFSWGNDAILGHGTEAADVE  292



>ref|XP_010514248.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010514249.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010514250.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
Length=534

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S++K 
Sbjct  356  FKILNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD +SFGCGES+SLGHN V  D Q NR +N+LSP +VTSLKQ  
Sbjct  416  VHVATGDYTTFVVSDDGDVFSFGCGESASLGHNPVF-DEQGNRIANVLSPAVVTSLKQAN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNS+YWNAHTFALTE GKL+AFGAGDKGQLG  L  NQ+ER  PE+V++DLS
Sbjct  475  ERMVQISLTNSLYWNAHTFALTESGKLYAFGAGDKGQLGTELGRNQSERCLPEKVDIDLS  534


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 70/147 (48%), Gaps = 20/147 (14%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG-  385
            G+  T+G+   G LGHG+ + E+  + V +   I+ +  A G   T ++S+DG  Y+ G 
Sbjct  164  GQVYTFGYNNSGQLGHGHTEEEAPIQPVRSLQGIRIIQAAAGAGRTMLISDDGKVYACGK  223

Query  384  -C-GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             C GE+   G               + +P+LVTSLK +   VVQ ++ N  Y+ A    L
Sbjct  224  DCFGEAEHGGQGT----------KPVTTPQLVTSLKDIF--VVQAAIGN--YFTA---VL  266

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  G ++ F  G  G LG    A   E
Sbjct  267  SREGTVYTFSWGKDGILGHGTEAADVE  293



>ref|XP_002875307.1| regulator of chromosome condensation family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH51566.1| regulator of chromosome condensation family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=533

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  +++K 
Sbjct  355  FKILNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLNHVKA  414

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+    D Q NRH+N+LSP +VTSLKQ  
Sbjct  415  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHHPSF-DEQGNRHANVLSPAVVTSLKQAN  473

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGD+GQLG  L  N+ ER  PE+V++DLS
Sbjct  474  ERVVQISLTNSIYWNAHTFALTESGKLYAFGAGDQGQLGAELDRNRKERCVPEKVDIDLS  533


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 77/149 (52%), Gaps = 19/149 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G+   G LGHG+ + ++  + V +   I+ +  A G   T ++S+DG  Y+  C
Sbjct  163  GEVYTFGYNNSGQLGHGHTEEQARIQPVRSLQGIRIIQAAAGAARTMLISDDGKVYA--C  220

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G+  S G       G       + +P+LVTSLK +   VVQ ++ N  Y+ A    L+  
Sbjct  221  GK-ESFGEAEYGGQGT----QPVTTPQLVTSLKNIF--VVQAAIGN--YFTA---VLSRE  268

Query  201  GKLFAFGAGDKGQLGVALSANQTERANPE  115
            GK++ F  G+ G+LG     +QTE A+ E
Sbjct  269  GKVYTFSWGNDGRLG-----HQTEAADVE  292



>dbj|BAK00885.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 155/180 (86%), Gaps = 2/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LN+QP+VVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNE+CES PKVVEA S++K 
Sbjct  357  FQTLNIQPIVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSSVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            V+VATGDYTTF+VS  GD YSFGCGESSSLGHN  +     NRHSN+LSPELVTSL+   
Sbjct  417  VYVATGDYTTFIVSCKGDVYSFGCGESSSLGHNTTIEGN--NRHSNVLSPELVTSLQSKN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            E+VVQ+SLTNS+YWNAHTFALTE GKL+AFGAGDKGQLG  L + ++ER  PERVE+DLS
Sbjct  475  EKVVQVSLTNSVYWNAHTFALTESGKLYAFGAGDKGQLGSELVSQESERGTPERVEIDLS  534



>emb|CDX99731.1| BnaC02g35890D [Brassica napus]
Length=535

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LN QP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+ ES PKVVE  S++K 
Sbjct  357  FQLLNFQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEEGESVPKVVEGLSHVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGES+SLGH+  V + Q +R +N+LSP +VTSLKQV 
Sbjct  417  VHVATGDYTTFVVSEDGDVYSFGCGESASLGHHTAVYE-QRDRQANVLSPAVVTSLKQVK  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GK+FAFGAGDKGQLG  L  +QTER  PERV +DLS
Sbjct  476  ERVVQISLTNSIYWNAHTFALTESGKVFAFGAGDKGQLGAELGRDQTERCAPERVNIDLS  535


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 69/147 (47%), Gaps = 19/147 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG-  385
            G+  T+G    G LGHG+ D E+    V +   I+ +  A G   T ++S++G  Y+ G 
Sbjct  164  GQVYTFGHNNSGQLGHGHTDEEARILPVRSMLGIRIIQAAAGAGRTMLISDNGSVYACGK  223

Query  384  --CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
               GE+   G               + +P+LVTSLK +   VVQ ++ N       T  L
Sbjct  224  DLFGEAEYGGQGG---------SRQVTTPQLVTSLKNIF--VVQAAIGNFF-----TAVL  267

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  GK++ F  G+ G+LG    AN  E
Sbjct  268  SREGKVYTFSWGNDGRLGHQTEANDVE  294



>ref|XP_010425280.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010425281.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010425282.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
Length=534

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE  S++K 
Sbjct  356  FKILNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEGLSHVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD +SFGCGES+SLGH+ V  D Q NR +N+LSP +VTSLKQ  
Sbjct  416  VHVATGDYTTFVVSDDGDVFSFGCGESASLGHSPVF-DEQGNRIANVLSPAVVTSLKQAN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNS+YWNAHTFALTE GKL+AFGAGDKGQLG  L  NQ+ER  PE+V++DLS
Sbjct  475  ERMVQISLTNSLYWNAHTFALTESGKLYAFGAGDKGQLGTELGRNQSERCLPEKVDIDLS  534


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 71/147 (48%), Gaps = 20/147 (14%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG-  385
            G+  T+G+   G LGHG+ + E+  + V +   I+ +  A G   T ++++DG  Y+ G 
Sbjct  164  GQVYTFGYNNSGQLGHGHTEEEAPIQPVRSLQGIRIIQAAAGAGRTMLITDDGKVYACGK  223

Query  384  -C-GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             C GE+   G               + +P+LVTSLK +   VVQ ++ N  Y+ A    L
Sbjct  224  DCFGEAEHGGQGT----------KPVTTPQLVTSLKNIF--VVQAAIGN--YFTA---VL  266

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  G ++ F  G +G LG    A   E
Sbjct  267  SREGTVYTFSWGKEGILGHGTEAADVE  293



>ref|XP_010502511.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010502512.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010502513.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010502514.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
 ref|XP_010502515.1| PREDICTED: ultraviolet-B receptor UVR8-like [Camelina sativa]
Length=534

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHG+E+CES PKVVE  S++K 
Sbjct  356  FKILNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGSEECESVPKVVEGLSHVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD +SFGCGES+SLGHN V  D Q NR +N+LSP +VTSLKQ  
Sbjct  416  VHVATGDYTTFVVSDDGDVFSFGCGESASLGHNPVF-DEQGNRIANVLSPAVVTSLKQAN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTNS+YWNAHTFALTE GKL+AFGAGDKGQLG  L  NQ+ER  PE+V++DLS
Sbjct  475  ERMVQISLTNSLYWNAHTFALTESGKLYAFGAGDKGQLGTELGRNQSERCLPEKVDIDLS  534


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 71/147 (48%), Gaps = 20/147 (14%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG-  385
            G+  T+G+   G LGHG+ + E+  + V +   I+ +  A G   T ++S+DG  Y+ G 
Sbjct  164  GQVYTFGYNNSGQLGHGHTEEEAPIQPVRSLQGIRIIQAAAGAGRTMLISDDGKVYACGK  223

Query  384  -C-GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             C GE+   G               + +P+LVTSLK +   VVQ ++ N  Y+ A    L
Sbjct  224  DCFGEAEHGGQGT----------KPVTTPQLVTSLKNIF--VVQAAIGN--YFTA---VL  266

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  G ++ F  G +G LG    A   E
Sbjct  267  SREGTVYTFSWGKEGILGHGTEAADVE  293



>ref|XP_009129568.1| PREDICTED: ultraviolet-B receptor UVR8-like [Brassica rapa]
Length=536

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 154/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LN QP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+ ES PKVVE  S++K 
Sbjct  358  FQLLNFQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEEGESVPKVVEGLSHVKA  417

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGES+SLGH+  V + Q +R +N+LSP +VTSLKQV 
Sbjct  418  VHVATGDYTTFVVSEDGDVYSFGCGESASLGHHTAVFE-QRDRQANVLSPAVVTSLKQVK  476

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKLFAFGAGDKGQLG  L  +QTER  PERV +DL+
Sbjct  477  ERVVQISLTNSIYWNAHTFALTESGKLFAFGAGDKGQLGAELGRDQTERCVPERVNIDLN  536


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 67/147 (46%), Gaps = 19/147 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG-  385
            G+  T+G    G LGHG+ D E+    + +    + +  A G   T ++S++G  Y+ G 
Sbjct  165  GQVYTFGHNNSGQLGHGHTDEEARILPIRSLQGTRIIQAAAGAGRTMLISDNGSVYACGK  224

Query  384  --CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
               GE+   G               + +P+LVTSLK +   VVQ ++ N       T  L
Sbjct  225  DLFGEAEYGGQGG---------SRQVTTPQLVTSLKNIF--VVQAAIGNFF-----TAVL  268

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  GK++ F  G  G+LG    AN  E
Sbjct  269  SREGKVYTFSWGSDGRLGHQTEANDVE  295



>ref|XP_007159624.1| hypothetical protein PHAVU_002G253100g [Phaseolus vulgaris]
 gb|ESW31618.1| hypothetical protein PHAVU_002G253100g [Phaseolus vulgaris]
Length=534

 Score =   257 bits (656),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGR GCLGHGNE+CES PKVVE   ++K 
Sbjct  356  FQVLNLQPKVVAAGAWHAAVVGQDGRICTWGWGRCGCLGHGNEECESVPKVVEELRDVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVV+++GD YSFGCGES+SLGHN    + Q + H+N+LSP+LV+S+K++ 
Sbjct  416  VHVATGDYTTFVVADNGDVYSFGCGESASLGHNP-ENNEQGDMHANVLSPKLVSSMKEIN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            E+VVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLGV L AN TER  PER+++DL
Sbjct  475  EKVVQISLTNSIYWNAHTFALTESGKLYAFGAGDKGQLGVELGANHTERGKPERLDIDL  533



>ref|XP_007159625.1| hypothetical protein PHAVU_002G253200g [Phaseolus vulgaris]
 gb|ESW31619.1| hypothetical protein PHAVU_002G253200g [Phaseolus vulgaris]
Length=534

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNL+P+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVE   ++K 
Sbjct  356  FQLLNLRPMVVAAGAWHAAVVGQDGRICTWGWGRYGCLGHGNEECESVPKVVEELRDVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS++GD YSFGCGES+SLGHN    + Q + H+N+LSP+LV+S+K++ 
Sbjct  416  VHVATGDYTTFVVSDNGDVYSFGCGESASLGHNPENHE-QEDMHANVLSPKLVSSMKEIN  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTNSIYW AHTFALTE GKL+AFGAGDKGQLGV L AN TER  PE +++DL
Sbjct  475  ERVVQISLTNSIYWKAHTFALTESGKLYAFGAGDKGQLGVELGANHTERGKPELLDIDL  533



>ref|XP_006395588.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 gb|ESQ32874.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
Length=533

 Score =   249 bits (635),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHG+E+CE  PKVV+  S++K 
Sbjct  355  FKLLNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGDEECEYVPKVVQGLSHVKA  414

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+  V D Q N H N+LSP LVTSLKQ  
Sbjct  415  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHHQDV-DEQGNGHENVLSPALVTSLKQAK  473

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ER+VQISLTN+I+  AHTFALTE GKLFAFGAGDKGQLG  L  N+TER  P +V++DLS
Sbjct  474  ERMVQISLTNAIHGKAHTFALTESGKLFAFGAGDKGQLGTELGRNRTERCVPAKVDIDLS  533


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 69/144 (48%), Gaps = 14/144 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G    G LGHG+ D E+    V +   I+ +  A G   T ++S++G+ Y+  C
Sbjct  163  GEVYTFGCNNSGQLGHGHTDEETRILPVRSLQGIRIIQAAAGTGRTMLISDNGNVYT--C  220

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G   S G      D +  R   + +P+LVTSLK +   VVQ ++ N       T  L+  
Sbjct  221  GR-DSFGE----ADYEGERTRPVTTPQLVTSLKNIF--VVQAAIGNFF-----TAILSRE  268

Query  201  GKLFAFGAGDKGQLGVALSANQTE  130
            GK++    G+ G+LG    A   E
Sbjct  269  GKVYTLSWGNDGRLGHQTEAGDVE  292



>gb|EPS68069.1| hypothetical protein M569_06703, partial [Genlisea aurea]
Length=467

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 153/184 (83%), Gaps = 5/184 (3%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F ALNLQP VVAAGAWHAAVVG DGR CTWGWGRYGCLGHGNEDCES PKVV+   ++K 
Sbjct  283  FGALNLQPKVVAAGAWHAAVVGNDGRVCTWGWGRYGCLGHGNEDCESVPKVVQGLKHVKA  342

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXD-----GQVNRHSNILSPELVTS  289
            V+VATGDYTTFVV++DGD YSFGCGESSSLGHN  + D     G  NR++N+LSP++VTS
Sbjct  343  VNVATGDYTTFVVTQDGDVYSFGCGESSSLGHNHNIIDHAQDQGGGNRNANVLSPKVVTS  402

Query  288  LKQVXERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERV  109
            LK+  + VVQISLTNSIYWNAHTFALT+  KL+AFG+GDKGQLGV L  +Q+ER +P+ V
Sbjct  403  LKKENDGVVQISLTNSIYWNAHTFALTKSDKLYAFGSGDKGQLGVELGVDQSERVDPQLV  462

Query  108  EVDL  97
            ++ L
Sbjct  463  KIQL  466



>emb|CDY40988.1| BnaA02g27780D [Brassica napus]
Length=549

 Score =   247 bits (630),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LN QP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+ ES PKVVE  S++K 
Sbjct  358  FQLLNFQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEEGESVPKVVEGLSHVKA  417

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVSEDGD YSFGCGES+SLGH+  V + Q +R +N+LSP +VTSLKQV 
Sbjct  418  VHVATGDYTTFVVSEDGDVYSFGCGESASLGHHTAVFE-QRDRQANVLSPAVVTSLKQVK  476

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTE  130
            ERVVQISLTNSIYWNAHTFALTE GKLFAFGAGDKGQLG  L  +QTE
Sbjct  477  ERVVQISLTNSIYWNAHTFALTESGKLFAFGAGDKGQLGAELGRDQTE  524


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 66/147 (45%), Gaps = 19/147 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG-  385
            G+  T+G    G LGHG+ D E+    + +      +  A G   T ++S++G  YS G 
Sbjct  165  GQVYTFGHNNSGQLGHGHTDEEARILPIRSLQGTIIIQAAAGAGRTMLISDNGSVYSCGK  224

Query  384  --CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
               GE+   G               + +P+LVTSLK +   VVQ ++ N       T  L
Sbjct  225  DLFGEAEYGGQGG---------SRQVTTPQLVTSLKNIF--VVQAAIGNFF-----TAVL  268

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  GK++ F  G  G+LG    AN  E
Sbjct  269  SREGKVYTFSWGSDGRLGHQTEANDVE  295



>ref|XP_003531318.1| PREDICTED: ultraviolet-B receptor UVR8-like isoformX1 [Glycine 
max]
 ref|XP_006585244.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Glycine 
max]
 ref|XP_006585245.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X3 [Glycine 
max]
 ref|XP_006585246.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X4 [Glycine 
max]
Length=539

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+ +AAG+WHAAVVG+DGR CTWGWG YGCLGHGNE+CE  PKVVE   N+K 
Sbjct  361  FQLLNLQPMAIAAGSWHAAVVGQDGRVCTWGWGSYGCLGHGNEECELVPKVVEELRNVKA  420

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGD+TTFVVS+ GD YSFG GES SLGH     + Q + H N+L+P+LVT +KQ+ 
Sbjct  421  VHVATGDFTTFVVSDSGDVYSFGYGESGSLGHVPENHE-QEDMHENVLTPKLVTWMKQIN  479

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTN IYWNAHTFALTE GKL+AFGAGDKGQLGV L A+QTE+  PERV++DL
Sbjct  480  ERVVQISLTNFIYWNAHTFALTESGKLYAFGAGDKGQLGVELGAHQTEKGKPERVDIDL  538



>ref|XP_010528070.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Tarenaya hassleriana]
Length=526

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 148/180 (82%), Gaps = 9/180 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA  ++K 
Sbjct  356  FQNLNLQPKVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEALRHVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVV+++GD YSFGCGES+SL        GQ     N+LSP LVTSLK   
Sbjct  416  VHVATGDYTTFVVTDNGDVYSFGCGESASL--------GQGGGQGNVLSPALVTSLKN-D  466

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG  L  NQTERA PE +++DLS
Sbjct  467  ERVVQISLTNSIYWNAHTFALTETGKLYAFGAGDKGQLGTELGPNQTERAVPESLDIDLS  526



>gb|KHN29007.1| E3 ubiquitin-protein ligase HERC2 [Glycine soja]
Length=542

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+V+AAG+WHAAVVG+DGR CTWGWG YGCLGHGNE+CE  PKVVE   N+K 
Sbjct  364  FQLLNLQPMVIAAGSWHAAVVGQDGRVCTWGWGSYGCLGHGNEECELVPKVVEELRNVKA  423

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGD+TTFVVS+ GD YSFG GES SLGH     + Q + H N+L+P+LVT +KQ+ 
Sbjct  424  VHVATGDFTTFVVSDSGDVYSFGYGESGSLGHVPENHE-QEDMHENVLTPKLVTWMKQIN  482

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERVVQISLTN IYWNAHTFALTE GKL+AFGAGDKGQLGV L A+QTE+  PERV++DL
Sbjct  483  ERVVQISLTNFIYWNAHTFALTESGKLYAFGAGDKGQLGVELGAHQTEKGKPERVDIDL  541



>ref|XP_002987735.1| hypothetical protein SELMODRAFT_426505 [Selaginella moellendorffii]
 gb|EFJ11310.1| hypothetical protein SELMODRAFT_426505 [Selaginella moellendorffii]
Length=539

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ L LQP+ VAAGAWHAAVV +DGR CTWGWGRYGCLGHGNEDCE  PKVVE+   +K 
Sbjct  360  FQHLRLQPIAVAAGAWHAAVVSEDGRVCTWGWGRYGCLGHGNEDCELLPKVVESLQGVKA  419

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVV++ G+ +S GCGESSSLGH +   +GQ NRH+N+L PELV+SLKQ  
Sbjct  420  VHVATGDYTTFVVTDAGEVFSCGCGESSSLGHLSGATEGQANRHANVLRPELVSSLKQRN  479

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            E+V+QISLTNS+ WNAHTFAL + G+LFAFGAGDKGQLG  L  N++ER  PE V++DLS
Sbjct  480  EKVLQISLTNSVTWNAHTFALCDSGRLFAFGAGDKGQLGTELLDNESERGTPELVDIDLS  539


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (46%), Gaps = 14/137 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   T+G    G LGHG+ D E  P+++ +   ++ +    G   T ++S+ G  Y+F
Sbjct  166  KTGAVYTFGSSSSGQLGHGSLDEEWRPRLLRSLQGVRIIQATAGVGRTMLISDTGRVYAF  225

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G     S G       G      NI +P++V SL  +   VVQ ++ N       T  L+
Sbjct  226  G---KDSFGDPEYGGPGS----KNINTPQIVESLNGIF--VVQAAIGNFF-----TAVLS  271

Query  207  EXGKLFAFGAGDKGQLG  157
              G+++ F  G   +LG
Sbjct  272  REGRVYTFSWGADAKLG  288



>ref|XP_002987523.1| hypothetical protein SELMODRAFT_126315 [Selaginella moellendorffii]
 gb|EFJ11359.1| hypothetical protein SELMODRAFT_126315 [Selaginella moellendorffii]
Length=508

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ L LQP+ VAAGAWHAAVV +DGR CTWGWGRYGCLGHGNEDCE  PKVVE+   +K 
Sbjct  329  FQHLRLQPIAVAAGAWHAAVVSEDGRVCTWGWGRYGCLGHGNEDCELLPKVVESLQGVKA  388

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVV++ G+ +S GCGESSSLGH +   +GQ NRH+N+L PELV+SLKQ  
Sbjct  389  VHVATGDYTTFVVTDAGEVFSCGCGESSSLGHLSGATEGQANRHANVLRPELVSSLKQRN  448

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            E+V+QISLTNS+ WNAHTFAL + G+LFAFGAGDKGQLG  L  N++ER  PE V+++LS
Sbjct  449  EKVLQISLTNSVTWNAHTFALCDSGRLFAFGAGDKGQLGTELLDNESERGTPELVDINLS  508


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (46%), Gaps = 14/137 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   T+G    G LGHG+ D E  P+++ +   ++ +    G   T ++S+ G  Y+F
Sbjct  135  KTGAVYTFGSSSSGQLGHGSLDEEWRPRLLRSLQGVRIIQATAGVGRTMLISDTGRVYAF  194

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G     S G       G      NI +P++V SL  +   VVQ ++ N       T  L+
Sbjct  195  G---KDSFGDPEYGGPGS----KNINTPQIVESLNGIF--VVQAAIGNFF-----TAVLS  240

Query  207  EXGKLFAFGAGDKGQLG  157
              G+++ F  G   +LG
Sbjct  241  REGRVYTFSWGADAKLG  257



>gb|KHN06528.1| E3 ubiquitin-protein ligase HERC2 [Glycine soja]
Length=537

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+V+AAG+WHAAVVG+DGR CTWGWGR+GCLGHGNE+C   PKVVE   N+K 
Sbjct  359  FQLLNLQPMVIAAGSWHAAVVGQDGRVCTWGWGRHGCLGHGNEECALVPKVVEELKNVKA  418

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVA GDYTTFVVS+ GDAYSFG GES +LGH+    + Q + H+++L+P+LVTS+KQ  
Sbjct  419  VHVAAGDYTTFVVSDSGDAYSFGYGESGTLGHDPENPE-QEHMHADVLTPKLVTSMKQNY  477

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERV+QISLTNS+YW AHTFALTE GKL+AFGAGDKGQLGV L   QTER  P+RV++DL
Sbjct  478  ERVIQISLTNSVYWIAHTFALTESGKLYAFGAGDKGQLGVELRPYQTERRKPQRVDIDL  536



>ref|XP_003524245.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Glycine 
max]
 ref|XP_006580239.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Glycine 
max]
Length=534

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+V+AAG+WHAAVVG+DGR CTWGWGR+GCLGHGNE+C   PKVVE   N+K 
Sbjct  356  FQLLNLQPMVIAAGSWHAAVVGQDGRVCTWGWGRHGCLGHGNEECALVPKVVEELKNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVA GDYTTFVVS+ GDAYSFG GES +LGH+    + Q + H+++L+P+LVTS+KQ  
Sbjct  416  VHVAAGDYTTFVVSDSGDAYSFGYGESGTLGHDPENPE-QEHMHADVLTPKLVTSMKQNY  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            ERV+QISLTNS+YW AHTFALTE GKL+AFGAGDKGQLGV L   QTER  P+RV++DL
Sbjct  475  ERVIQISLTNSVYWIAHTFALTESGKLYAFGAGDKGQLGVELRPYQTERRKPQRVDIDL  533



>ref|XP_010556194.1| PREDICTED: ultraviolet-B receptor UVR8-like [Tarenaya hassleriana]
 ref|XP_010556195.1| PREDICTED: ultraviolet-B receptor UVR8-like [Tarenaya hassleriana]
 ref|XP_010556196.1| PREDICTED: ultraviolet-B receptor UVR8-like [Tarenaya hassleriana]
 ref|XP_010556197.1| PREDICTED: ultraviolet-B receptor UVR8-like [Tarenaya hassleriana]
Length=526

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 148/180 (82%), Gaps = 8/180 (4%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FR LNL+PVV++AGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+ ESAPKVVEA  NIK 
Sbjct  355  FRHLNLEPVVISAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEESESAPKVVEALQNIKA  414

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            +HVATGDYTTFVVSEDGD YSFGCGES++L        GQ +   N L P+LVTSLKQ  
Sbjct  415  IHVATGDYTTFVVSEDGDVYSFGCGESANL--------GQGDDDGNTLIPKLVTSLKQAD  466

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            +RV+Q+SLTNS+YW  HTFA+TE GK++AFGAGD+GQLGV L  + TERA P++V +DLS
Sbjct  467  QRVIQVSLTNSVYWTGHTFAVTESGKVYAFGAGDRGQLGVELEDSLTERAEPDKVNIDLS  526


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (50%), Gaps = 18/133 (14%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG--CGE  376
            ++G    G LGHG  D    P+ + +   I+ +  ATG   T ++S+ G  Y+FG  C  
Sbjct  167  SFGANGSGQLGHGTTDDIFQPRPIRSLQGIRIIQAATGADRTMLISDSGQVYAFGKDCFS  226

Query  375  SSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGK  196
             + L         ++   S + +P+LV SLK +   VVQ+++ N       T  L+  G+
Sbjct  227  EAGL---------ELQETSFVTTPQLVKSLKNIY--VVQVTIGNFF-----TAVLSREGR  270

Query  195  LFAFGAGDKGQLG  157
            ++ F  G+ G+LG
Sbjct  271  VYTFSWGNDGRLG  283



>ref|XP_010528066.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Tarenaya hassleriana]
 ref|XP_010528067.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Tarenaya hassleriana]
 ref|XP_010528068.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Tarenaya hassleriana]
 ref|XP_010528069.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Tarenaya hassleriana]
Length=549

 Score =   240 bits (612),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 152/195 (78%), Gaps = 16/195 (8%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA  ++K 
Sbjct  356  FQNLNLQPKVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEALRHVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGH---NAVVXDG------------QVNRHS  319
            VHVATGDYTTFVV+++GD YSFGCGES+SLG    + +V  G            Q     
Sbjct  416  VHVATGDYTTFVVTDNGDVYSFGCGESASLGQVCGSILVFLGFSCHCSEISGRWQGGGQG  475

Query  318  NILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSAN  139
            N+LSP LVTSLK   ERVVQISLTNSIYWNAHTFALTE GKL+AFGAGDKGQLG  L  N
Sbjct  476  NVLSPALVTSLKN-DERVVQISLTNSIYWNAHTFALTETGKLYAFGAGDKGQLGTELGPN  534

Query  138  QTERANPERVEVDLS  94
            QTERA PE +++DLS
Sbjct  535  QTERAVPESLDIDLS  549



>ref|XP_009105322.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
 ref|XP_009105323.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
 ref|XP_009105324.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
 ref|XP_009105325.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
Length=537

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 133/181 (73%), Gaps = 8/181 (4%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L ++PV+++AG WHAA VG+DGR CTWGWGR+GCLGHG  + E APKVVE   N+K 
Sbjct  364  FSVLKMEPVMISAGTWHAAAVGRDGRVCTWGWGRFGCLGHGTGESELAPKVVEGLKNVKA  423

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DG  YSFG GE ++LG        Q +   N L+P LV+SLK++ 
Sbjct  424  VHVATGDYTTFVVSDDGQVYSFGSGEFANLGQ-------QGDEDDNTLTPNLVSSLKEIK  476

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ERVV +SLTNSI W  HTFA+TE G ++AFG GD+GQLGV L  N TERA P +V  +DL
Sbjct  477  ERVVHVSLTNSISWGGHTFAMTESGTVYAFGTGDRGQLGVELGDNLTERAEPAKVVGIDL  536

Query  96   S  94
            S
Sbjct  537  S  537



>ref|XP_009105326.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Brassica 
rapa]
Length=536

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 133/181 (73%), Gaps = 9/181 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L ++PV+++AG WHAA VG+DGR CTWGWGR+GCLGHG  + E APKVVE   N+K 
Sbjct  364  FSVLKMEPVMISAGTWHAAAVGRDGRVCTWGWGRFGCLGHGTGESELAPKVVEGLKNVKA  423

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DG  YSFG GE ++L        GQ +   N L+P LV+SLK++ 
Sbjct  424  VHVATGDYTTFVVSDDGQVYSFGSGEFANL--------GQGDEDDNTLTPNLVSSLKEIK  475

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ERVV +SLTNSI W  HTFA+TE G ++AFG GD+GQLGV L  N TERA P +V  +DL
Sbjct  476  ERVVHVSLTNSISWGGHTFAMTESGTVYAFGTGDRGQLGVELGDNLTERAEPAKVVGIDL  535

Query  96   S  94
            S
Sbjct  536  S  536



>emb|CDX96062.1| BnaA07g26690D [Brassica napus]
Length=518

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 131/181 (72%), Gaps = 8/181 (4%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L ++PV+++AG WHAA VG+DGR CTWGWGR+GCLGHG  + E  PKVVE   ++K 
Sbjct  345  FSVLKMEPVMISAGTWHAAAVGRDGRVCTWGWGRFGCLGHGTGESELVPKVVEGLKDVKA  404

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DG  YSFG GE ++LG        Q +   N L P LV+SLK++ 
Sbjct  405  VHVATGDYTTFVVSDDGQVYSFGSGEFANLGQ-------QGDEDDNTLIPNLVSSLKEIK  457

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ERVV +SLTNSI W  HTFA+TE G ++AFG GD+GQLGV L  N TERA P +V  +DL
Sbjct  458  ERVVHVSLTNSISWGGHTFAMTESGAVYAFGTGDRGQLGVELGDNLTERAEPAKVVGIDL  517

Query  96   S  94
            S
Sbjct  518  S  518



>ref|XP_006391226.1| hypothetical protein EUTSA_v10018382mg [Eutrema salsugineum]
 gb|ESQ28512.1| hypothetical protein EUTSA_v10018382mg [Eutrema salsugineum]
Length=535

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 133/181 (73%), Gaps = 9/181 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L ++PV+V+AG WHAAVVG+DGR CTWGWGRYGCLGHG E+ ESAPKVVE   ++K 
Sbjct  363  FSLLKMEPVMVSAGTWHAAVVGRDGRVCTWGWGRYGCLGHGTEEPESAPKVVEGLKDVKA  422

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDY TFVVS+DG  YSFGC ES++LG    V +       N L P+LVTSLK+  
Sbjct  423  VHVATGDYATFVVSDDGQVYSFGC-ESANLGQQGDVDE-------NTLIPKLVTSLKEKK  474

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ERVV +SLTNS  W  HTFA+ E G L+AFGAG++GQLGV L  N  ERA P +V  +DL
Sbjct  475  ERVVHVSLTNSTTWAGHTFAMAESGTLYAFGAGERGQLGVELGDNLAERAEPAKVVGIDL  534

Query  96   S  94
            S
Sbjct  535  S  535



>ref|XP_006391225.1| hypothetical protein EUTSA_v10018382mg [Eutrema salsugineum]
 gb|ESQ28511.1| hypothetical protein EUTSA_v10018382mg [Eutrema salsugineum]
Length=534

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 132/181 (73%), Gaps = 10/181 (6%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L ++PV+V+AG WHAAVVG+DGR CTWGWGRYGCLGHG E+ ESAPKVVE   ++K 
Sbjct  363  FSLLKMEPVMVSAGTWHAAVVGRDGRVCTWGWGRYGCLGHGTEEPESAPKVVEGLKDVKA  422

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDY TFVVS+DG  YSFGC ES++LG   V          N L P+LVTSLK+  
Sbjct  423  VHVATGDYATFVVSDDGQVYSFGC-ESANLGQGDV--------DENTLIPKLVTSLKEKK  473

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ERVV +SLTNS  W  HTFA+ E G L+AFGAG++GQLGV L  N  ERA P +V  +DL
Sbjct  474  ERVVHVSLTNSTTWAGHTFAMAESGTLYAFGAGERGQLGVELGDNLAERAEPAKVVGIDL  533

Query  96   S  94
            S
Sbjct  534  S  534



>emb|CDY01845.1| BnaC06g28850D [Brassica napus]
Length=517

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 128/175 (73%), Gaps = 7/175 (4%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L ++PV+++AG WHAA VG+DGR CTWGWGR+GCLGHG  + E  PKVVE   ++K 
Sbjct  344  FSVLKMEPVMISAGTWHAAAVGRDGRVCTWGWGRFGCLGHGTGESELVPKVVEGLKDVKA  403

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATGDYTTFVVS+DG  YSFG GE ++LG        Q +   N ++P LV+SLK++ 
Sbjct  404  VHVATGDYTTFVVSDDGQVYSFGSGEFANLGQ-------QGDEDDNTVTPNLVSSLKEIK  456

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERV  109
            ERVV +SLTNSI W  HTFA+TE G ++AFG GD+GQLGV L  N TERA P +V
Sbjct  457  ERVVHVSLTNSISWGGHTFAMTESGTVYAFGTGDRGQLGVELGDNLTERAEPAKV  511



>ref|XP_008798796.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1 [Phoenix 
dactylifera]
Length=538

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 133/182 (73%), Gaps = 3/182 (2%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LNLQPV +A G+WHAAVVG+DGR CTWGWG  GCLGHGNED ++ PKVVE  S+IK 
Sbjct  358  FNTLNLQPVCLAGGSWHAAVVGRDGRVCTWGWGNCGCLGHGNEDYQALPKVVEGLSHIKA  417

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            V+VA GD TTFVVS+ GD YSFG GESS+LGH  +   GQ      +  P+LVTSL +V 
Sbjct  418  VYVAAGDSTTFVVSDAGDIYSFGYGESSNLGH-IIGARGQDYSPIILTKPKLVTSLNKVT  476

Query  273  ERVVQISLTNSIYWNA--HTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVD  100
            ER+VQI  TNS  W A  HTF LTE GKL+AFG+G+KGQLG+  S     +A PERV++D
Sbjct  477  ERIVQIGPTNSSSWTADVHTFVLTESGKLYAFGSGNKGQLGIEFSGQPGMKAKPERVQID  536

Query  99   LS  94
            LS
Sbjct  537  LS  538



>ref|XP_002887142.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63401.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=542

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 132/181 (73%), Gaps = 10/181 (6%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LN++PV+V+AG WHAAVVGKDGR CTWGWGR+GCLGHG E+ E+APKVV+   ++K 
Sbjct  371  FGLLNIEPVMVSAGPWHAAVVGKDGRVCTWGWGRFGCLGHGTEEAENAPKVVDGLKDVKA  430

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATG YTTFVVS+DG  YSFG G     G N     GQ +   N L+P+LV+SLK   
Sbjct  431  VHVATGVYTTFVVSDDGQVYSFGSG-----GANL----GQDDVDENTLTPKLVSSLKDTK  481

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ER+V +SLTNS     HTFA+TE G L+AFGAG++GQLGV L  N TERA P +V  +DL
Sbjct  482  ERMVHVSLTNSGNGTGHTFAMTESGTLYAFGAGNRGQLGVELGENLTERAEPAKVAGIDL  541

Query  96   S  94
            S
Sbjct  542  S  542



>ref|XP_009105101.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X3 [Brassica 
rapa]
Length=535

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 130/183 (71%), Gaps = 12/183 (7%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L ++PV+++AGAWHAAVVG+DGR CTWGWGRYGCLGHG E+ E APKVVE   ++K 
Sbjct  362  FSLLKMEPVMISAGAWHAAVVGRDGRVCTWGWGRYGCLGHGTEELEMAPKVVEGLKDVKA  421

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVA G+YTTFVVS+DG  YSFG GE         V  GQ +   N L+P+LV+SLK+  
Sbjct  422  VHVAAGEYTTFVVSDDGQVYSFGYGE---------VNLGQGDVEENTLTPKLVSSLKETK  472

Query  273  ERVVQISLTNSIY--WNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERV-EV  103
            ERVV +SLT S+   W  HTFA+TE G L+AFG+G +GQLGV L  N  ER  P +V  +
Sbjct  473  ERVVHVSLTKSVSFPWTGHTFAMTESGTLYAFGSGGRGQLGVKLGDNIMEREEPAKVIGI  532

Query  102  DLS  94
            DLS
Sbjct  533  DLS  535



>emb|CDY56518.1| BnaA07g38600D [Brassica napus]
Length=520

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 131/183 (72%), Gaps = 11/183 (6%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L ++PV+++AGAWHAAVVG+DGR CTWGWGRYGCLGHG E+ E APKVVE   ++K 
Sbjct  346  FSLLKMEPVMISAGAWHAAVVGRDGRVCTWGWGRYGCLGHGTEELEMAPKVVEGLKDVKA  405

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVA G+YTTFVVS+DG  YSFG GE  +LG    V +       N L+P+LV+SLK+  
Sbjct  406  VHVAAGEYTTFVVSDDGQVYSFGYGE-VNLGQQGDVEE-------NTLTPKLVSSLKETK  457

Query  273  ERVVQISLTNSIY--WNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERV-EV  103
            ERVV +SLT S+   W  HTFA+TE G L+AFG+G +GQLGV L  N  ER  P +V  +
Sbjct  458  ERVVHVSLTKSVSFPWTGHTFAMTESGTLYAFGSGGRGQLGVKLGDNIMEREEPAKVIGI  517

Query  102  DLS  94
            DLS
Sbjct  518  DLS  520



>ref|XP_010927591.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 [Elaeis 
guineensis]
Length=532

 Score =   186 bits (471),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 133/182 (73%), Gaps = 9/182 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LNLQPV +AAG+WHAAVVG+DGR CTWGWG +GCLGHGNED ++ P VV+  ++IK 
Sbjct  358  FNILNLQPVCLAAGSWHAAVVGRDGRVCTWGWGSHGCLGHGNEDYQTLPTVVKGLNHIKA  417

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            V+V+ GD TTFVVS+ GD YSFG G+SS+LGH       QV    N  +P+LVTSLK V 
Sbjct  418  VYVSVGDCTTFVVSDTGDVYSFGYGDSSNLGHE------QVFYPLNQTTPKLVTSLK-VT  470

Query  273  ERVVQISLTNSIYWN--AHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVD  100
            ER+VQIS TN   W    HTF LTE GKL+AFG+G +GQLG+ +S     +A PERV++D
Sbjct  471  ERIVQISPTNISNWTEFMHTFVLTESGKLYAFGSGHQGQLGIDMSGQPHTKAIPERVQID  530

Query  99   LS  94
            LS
Sbjct  531  LS  532



>ref|XP_009105098.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
 ref|XP_009105099.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Brassica 
rapa]
 ref|XP_009105100.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Brassica 
rapa]
Length=536

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 131/183 (72%), Gaps = 11/183 (6%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L ++PV+++AGAWHAAVVG+DGR CTWGWGRYGCLGHG E+ E APKVVE   ++K 
Sbjct  362  FSLLKMEPVMISAGAWHAAVVGRDGRVCTWGWGRYGCLGHGTEELEMAPKVVEGLKDVKA  421

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVA G+YTTFVVS+DG  YSFG GE  +LG    V +       N L+P+LV+SLK+  
Sbjct  422  VHVAAGEYTTFVVSDDGQVYSFGYGE-VNLGQQGDVEE-------NTLTPKLVSSLKETK  473

Query  273  ERVVQISLTNSIY--WNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERV-EV  103
            ERVV +SLT S+   W  HTFA+TE G L+AFG+G +GQLGV L  N  ER  P +V  +
Sbjct  474  ERVVHVSLTKSVSFPWTGHTFAMTESGTLYAFGSGGRGQLGVKLGDNIMEREEPAKVIGI  533

Query  102  DLS  94
            DLS
Sbjct  534  DLS  536



>emb|CDY28863.1| BnaC06g26510D [Brassica napus]
Length=520

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 130/183 (71%), Gaps = 11/183 (6%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L ++PV+++AGAWHAAVVG+DGR CTWGWGRYGCLGHG E+ E APKVVE   ++K 
Sbjct  346  FSLLKMEPVMISAGAWHAAVVGRDGRVCTWGWGRYGCLGHGTEELEMAPKVVEGLKDVKA  405

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVA G+YTTFVV +DG  YSFG GE ++LG        Q +   N L+P LV+SLK+  
Sbjct  406  VHVAAGEYTTFVVCDDGQVYSFGYGE-ANLGQ-------QGDLEENTLTPRLVSSLKETK  457

Query  273  ERVVQISLTNSIY--WNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERV-EV  103
            ERVV +SLT S+   W  HTFA+TE G L+AFG+G +GQLGV L  N  ER  P +V  +
Sbjct  458  ERVVHVSLTKSVSFPWTGHTFAMTESGTLYAFGSGGRGQLGVKLGDNIMEREEPAKVIGI  517

Query  102  DLS  94
            DLS
Sbjct  518  DLS  520



>ref|XP_010511732.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Camelina 
sativa]
Length=531

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 129/181 (71%), Gaps = 9/181 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LN++PV+V+AGAWHAAVVG+DGR CTWGWGR+GCLGHG E+ + APKVV+   ++K 
Sbjct  359  FGLLNIEPVMVSAGAWHAAVVGRDGRVCTWGWGRHGCLGHGTEELQMAPKVVDGLKDVKV  418

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATG Y TFV S+DG  YSFG G +++LG + V  D         L+P+LV SLK+  
Sbjct  419  VHVATGTYATFVTSDDGQVYSFGSGVAANLGQDDVDED--------TLTPKLVLSLKETK  470

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ER+V +SLTN+  WN HT  +TE G L+AFG GD+GQLGV L  N  ER  P +V  +DL
Sbjct  471  ERMVHVSLTNAGNWNGHTLVMTESGTLYAFGTGDRGQLGVELGDNSKEREEPAKVAGIDL  530

Query  96   S  94
            S
Sbjct  531  S  531



>ref|XP_010511729.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
 ref|XP_010511730.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
 ref|XP_010511731.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
Length=532

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 129/181 (71%), Gaps = 8/181 (4%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LN++PV+V+AGAWHAAVVG+DGR CTWGWGR+GCLGHG E+ + APKVV+   ++K 
Sbjct  359  FGLLNIEPVMVSAGAWHAAVVGRDGRVCTWGWGRHGCLGHGTEELQMAPKVVDGLKDVKV  418

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATG Y TFV S+DG  YSFG G +++LG        Q +   + L+P+LV SLK+  
Sbjct  419  VHVATGTYATFVTSDDGQVYSFGSGVAANLGQ-------QDDVDEDTLTPKLVLSLKETK  471

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ER+V +SLTN+  WN HT  +TE G L+AFG GD+GQLGV L  N  ER  P +V  +DL
Sbjct  472  ERMVHVSLTNAGNWNGHTLVMTESGTLYAFGTGDRGQLGVELGDNSKEREEPAKVAGIDL  531

Query  96   S  94
            S
Sbjct  532  S  532



>ref|XP_010415359.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X1 
[Camelina sativa]
 ref|XP_010415360.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X1 
[Camelina sativa]
 ref|XP_010415361.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X2 
[Camelina sativa]
Length=532

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 129/181 (71%), Gaps = 8/181 (4%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LN++PV+V+AGAWHAAVVG+DGR CTWGWGR+GCLGHG E+ + APKVV+   ++K 
Sbjct  359  FGFLNIEPVMVSAGAWHAAVVGRDGRVCTWGWGRHGCLGHGTEELQMAPKVVDGLKDVKA  418

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATG Y TFV S+DG  YSFG G +++LG        Q +   + L+P+LV+SLK   
Sbjct  419  VHVATGTYATFVASDDGQVYSFGSGVAANLGQ-------QDDVDEDTLTPKLVSSLKGTK  471

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ERVV +SLTN+  WN HT  +TE G L+AFG GD+GQLGV L  N  ER  P +V  +DL
Sbjct  472  ERVVHVSLTNAGNWNGHTMVMTESGTLYAFGTGDRGQLGVELGDNLKEREEPAKVAGIDL  531

Query  96   S  94
            S
Sbjct  532  S  532



>ref|XP_010470700.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Camelina 
sativa]
Length=531

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 128/181 (71%), Gaps = 9/181 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LN++PV+V+AGAWHAAVVG+DGR CTWGWGR+GCLGHG E+ + AP+VV+   ++K 
Sbjct  359  FGFLNIEPVMVSAGAWHAAVVGRDGRVCTWGWGRHGCLGHGTEELQMAPRVVDGLKDVKV  418

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATG Y TFV S+DG  YSFG G +++LG + V  D         L+P+LV SLK+  
Sbjct  419  VHVATGTYATFVASDDGQVYSFGSGVAANLGQDDVDED--------TLAPKLVLSLKETK  470

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ER+V +SLTN   WN HT  +TE G L+AFG GD+GQLGV L  N  ER  P +V  +DL
Sbjct  471  ERMVHVSLTNGGNWNGHTLVMTESGTLYAFGTGDRGQLGVELGDNLKEREEPAKVAGIDL  530

Query  96   S  94
            S
Sbjct  531  S  531



>ref|XP_010470697.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
 ref|XP_010470698.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
 ref|XP_010470699.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Camelina 
sativa]
Length=532

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 128/181 (71%), Gaps = 8/181 (4%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LN++PV+V+AGAWHAAVVG+DGR CTWGWGR+GCLGHG E+ + AP+VV+   ++K 
Sbjct  359  FGFLNIEPVMVSAGAWHAAVVGRDGRVCTWGWGRHGCLGHGTEELQMAPRVVDGLKDVKV  418

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVATG Y TFV S+DG  YSFG G +++LG        Q +   + L+P+LV SLK+  
Sbjct  419  VHVATGTYATFVASDDGQVYSFGSGVAANLGQ-------QDDVDEDTLAPKLVLSLKETK  471

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDL  97
            ER+V +SLTN   WN HT  +TE G L+AFG GD+GQLGV L  N  ER  P +V  +DL
Sbjct  472  ERMVHVSLTNGGNWNGHTLVMTESGTLYAFGTGDRGQLGVELGDNLKEREEPAKVAGIDL  531

Query  96   S  94
            S
Sbjct  532  S  532



>ref|XP_006647457.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Oryza brachyantha]
Length=537

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 122/185 (66%), Gaps = 9/185 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ L+  PV VAAG WHAA +G DGR CTWGWG  GCLGHG+E+ ++ P VV+  SN+K 
Sbjct  355  FQTLSFNPVSVAAGTWHAAALGDDGRVCTWGWGHTGCLGHGDEEYKALPTVVQGLSNVKA  414

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHV+TG+YTTFVV+++GD YSFG  ES +LG             S   +P LV SLK + 
Sbjct  415  VHVSTGEYTTFVVADNGDVYSFGSAESLNLGFQEDEEAADDADFS---TPTLVESLKLLN  471

Query  273  ERVVQISLTNSIYW------NAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
            E+ V+IS TNS YW        HTFAL E GKL+AFG G KGQLGV LS  Q    NPER
Sbjct  472  EKAVEISPTNSSYWLNSEMGFPHTFALMESGKLYAFGGGIKGQLGVKLSEGQDRVQNPER  531

Query  111  VEVDL  97
            V VD+
Sbjct  532  VPVDI  536



>ref|NP_001047324.1| Os02g0597000 [Oryza sativa Japonica Group]
 dbj|BAD21626.1| rjs-like protein [Oryza sativa Japonica Group]
 dbj|BAF09238.1| Os02g0597000 [Oryza sativa Japonica Group]
 dbj|BAG95450.1| unnamed protein product [Oryza sativa Japonica Group]
Length=537

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 119/185 (64%), Gaps = 9/185 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L+  PV VAAG WHAA +G DGR CTWGWG  GCLGHG+E+    P VV+  SN+K 
Sbjct  355  FLTLSFNPVSVAAGTWHAAALGDDGRVCTWGWGHTGCLGHGDEEYRVLPTVVQGLSNVKA  414

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHV+TG+YTTFVVS++GD YSFG  ES ++G             S   +P LV SLK + 
Sbjct  415  VHVSTGEYTTFVVSDNGDTYSFGSAESLNIGFQEDEEAADDADFS---TPSLVESLKVLN  471

Query  273  ERVVQISLTNSIYW------NAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
            ++ VQIS TNS YW        HTFAL E GKL+AFG G KGQLGV LS  Q    NPER
Sbjct  472  DKAVQISTTNSSYWLNSEMGYPHTFALMESGKLYAFGGGIKGQLGVKLSEGQERAQNPER  531

Query  111  VEVDL  97
            V +DL
Sbjct  532  VPIDL  536



>gb|EEE57302.1| hypothetical protein OsJ_07379 [Oryza sativa Japonica Group]
Length=609

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 119/185 (64%), Gaps = 9/185 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L+  PV VAAG WHAA +G DGR CTWGWG  GCLGHG+E+    P VV+  SN+K 
Sbjct  427  FLTLSFNPVSVAAGTWHAAALGDDGRVCTWGWGHTGCLGHGDEEYRVLPTVVQGLSNVKA  486

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHV+TG+YTTFVVS++GD YSFG  ES ++G             S   +P LV SLK + 
Sbjct  487  VHVSTGEYTTFVVSDNGDTYSFGSAESLNIGFQEDEEAADDADFS---TPSLVESLKVLN  543

Query  273  ERVVQISLTNSIYW------NAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
            ++ VQIS TNS YW        HTFAL E GKL+AFG G KGQLGV LS  Q    NPER
Sbjct  544  DKAVQISTTNSSYWLNSEMGYPHTFALMESGKLYAFGGGIKGQLGVKLSEGQERAQNPER  603

Query  111  VEVDL  97
            V +DL
Sbjct  604  VPIDL  608



>gb|EEC73526.1| hypothetical protein OsI_07916 [Oryza sativa Indica Group]
Length=634

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 119/185 (64%), Gaps = 9/185 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  L+  PV VAAG WHAA +G DGR CTWGWG  GCLGHG+E+    P VV+  SN+K 
Sbjct  452  FLTLSFNPVSVAAGTWHAAALGDDGRVCTWGWGHTGCLGHGDEEYRVLPTVVQGLSNVKA  511

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHV+TG+YTTFVVS++GD YSFG  ES ++G             S   +P LV SLK + 
Sbjct  512  VHVSTGEYTTFVVSDNGDTYSFGSAESLNIGFQEDEEAADDADFS---TPSLVESLKVLN  568

Query  273  ERVVQISLTNSIYW------NAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
            ++ VQIS TNS YW        HTFAL E GKL+AFG G KGQLGV LS  Q    NPER
Sbjct  569  DKAVQISTTNSSYWLNSEMGYPHTFALMESGKLYAFGGGIKGQLGVKLSEGQERAQNPER  628

Query  111  VEVDL  97
            V +DL
Sbjct  629  VPIDL  633



>ref|XP_009387708.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC3 [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 123/180 (68%), Gaps = 5/180 (3%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F  LNLQP+ ++AG+WHA  +GKDGR CTWGWG  GCLGHG+ED ++ PKVV+  S++K 
Sbjct  306  FAILNLQPIALSAGSWHAIALGKDGRVCTWGWGYNGCLGHGDEDYQNLPKVVKGLSHVKA  365

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHVA G  TTFV++E+GD YSFG G  S+LG+       Q     + L+P+LVTSL    
Sbjct  366  VHVAAGLCTTFVITENGDIYSFGRGSDSNLGYPP-----QYGHRLDQLTPKLVTSLTCAG  420

Query  273  ERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            E+++++S T       HTFA+TE GKL+AFG    GQLG+ L   Q   ++P+RV++DLS
Sbjct  421  EKIIRLSATKEHEAAGHTFAMTESGKLYAFGMAIYGQLGIKLLQGQDGTSSPQRVDIDLS  480



>ref|NP_001145799.1| uncharacterized protein LOC100279306 [Zea mays]
 ref|XP_008677080.1| PREDICTED: uncharacterized protein LOC100279306 isoform X1 [Zea 
mays]
 ref|XP_008677081.1| PREDICTED: uncharacterized protein LOC100279306 isoform X1 [Zea 
mays]
 gb|ACF85135.1| unknown [Zea mays]
 gb|ACF86478.1| unknown [Zea mays]
 gb|ACG32569.1| HECT domain and RCC1-like domain-containing protein 2 [Zea mays]
 gb|ACL52612.1| unknown [Zea mays]
 gb|ACN29033.1| unknown [Zea mays]
 gb|ACN34463.1| unknown [Zea mays]
 gb|AFW62848.1| putative regulator of chromosome condensation (RCC1) family protein 
isoform 1 [Zea mays]
 gb|AFW62849.1| putative regulator of chromosome condensation (RCC1) family protein 
isoform 2 [Zea mays]
 gb|AFW62850.1| putative regulator of chromosome condensation (RCC1) family protein 
isoform 3 [Zea mays]
Length=535

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 119/185 (64%), Gaps = 11/185 (6%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F++++ +PV +AAG WHA  +G DGR CTWGWG  GCLGHG+E+C + P VVE   ++K 
Sbjct  355  FQSMSFKPVSIAAGTWHAVALGADGRVCTWGWGHTGCLGHGDEECRAVPTVVEGLRDVKA  414

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VHV+TG+YTTFVV+E+GD YSFG GES      A   D +     +  +P +V+SLK + 
Sbjct  415  VHVSTGEYTTFVVAENGDVYSFGSGESL-----AFQLDDEAEEEPDSSTPSIVSSLKDLN  469

Query  273  ERVVQISLTNSIYW------NAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
            ++VVQIS TN+ YW      + HTFA+ + G + AFG G +GQLGV L     +   P  
Sbjct  470  KKVVQISHTNASYWMNSEMGHPHTFAVMDSGDVCAFGGGVRGQLGVKLHEGVEKVRVPMN  529

Query  111  VEVDL  97
            V + L
Sbjct  530  VPIGL  534


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/157 (25%), Positives = 70/157 (45%), Gaps = 20/157 (13%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGD---A  397
            ++GR  T+ WG+   LGH ++  +  P+++    ++   +++ G+    +++   +    
Sbjct  268  REGRVYTFSWGKAERLGHSSDPSDVEPRLLPGLEDVPVAYISAGNCYLLMLAYQPNGMSV  327

Query  396  YSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTF  217
            YS GCG    LGH     +G          P+LV   + +  + V I+      W  H  
Sbjct  328  YSVGCGLGGKLGHGCKTNNGM---------PKLVEQFQSMSFKPVSIAAGT---W--HAV  373

Query  216  ALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            AL   G++  +G G  G LG     ++  RA P  VE
Sbjct  374  ALGADGRVCTWGWGHTGCLG---HGDEECRAVPTVVE  407



>ref|XP_008446119.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X2 [Cucumis melo]
Length=467

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES+PKVVEA  N+K 
Sbjct  356  FQLLNLQPVVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESSPKVVEALINVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVN  328
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN VV + QV+
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHNVVVPEEQVS  457



>gb|KDO82118.1| hypothetical protein CISIN_1g009463mg [Citrus sinensis]
Length=380

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 93/101 (92%), Gaps = 1/101 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A +++K 
Sbjct  254  FQLLNLQPVVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVQALNDVKA  313

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQV  331
            +HVATGDYTTFVVSEDGD YSFGCGES+SLGHNA+  DGQV
Sbjct  314  IHVATGDYTTFVVSEDGDVYSFGCGESASLGHNAIA-DGQV  353



>gb|KJB31066.1| hypothetical protein B456_005G174500 [Gossypium raimondii]
Length=455

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 1/101 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNEDCES PKVVEA SN+K 
Sbjct  356  FQLLNLQPMVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEDCESVPKVVEALSNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQV  331
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGHN    +GQV
Sbjct  416  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHN-TAGEGQV  455



>ref|XP_007222373.1| hypothetical protein PRUPE_ppa004014mg [Prunus persica]
 gb|EMJ23572.1| hypothetical protein PRUPE_ppa004014mg [Prunus persica]
Length=469

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 1/101 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVVEA SN+K 
Sbjct  357  FQLLNLQPMVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGNEECESVPKVVEALSNVKA  416

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQV  331
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+    DGQV
Sbjct  417  VHVATGDYTTFVVSKDGDVYSFGCGESASLGHSTAT-DGQV  456



>ref|XP_002454125.1| hypothetical protein SORBIDRAFT_04g024990 [Sorghum bicolor]
 gb|EES07101.1| hypothetical protein SORBIDRAFT_04g024990 [Sorghum bicolor]
Length=535

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 120/185 (65%), Gaps = 11/185 (6%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F++L+ +PV +AAG WHAA +G DGR CTWGWG  GCLGHG+E+ ++ P +VE   ++K 
Sbjct  355  FQSLSFKPVSIAAGTWHAAALGADGRVCTWGWGHTGCLGHGDEEYKAVPTLVEGLRDVKA  414

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VH++TG+YTTFVV+E+GD YSFG GES          D +     +  +P +V+SLK + 
Sbjct  415  VHLSTGEYTTFVVAENGDVYSFGSGESLVFQE-----DDEAEEGPDFSTPSIVSSLKALN  469

Query  273  ERVVQISLTNSIYW------NAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
            ++VVQIS TN+ YW      + HTFA+ + G L AFG G +GQLGV L     + + P  
Sbjct  470  KKVVQISPTNASYWLNSEMGHPHTFAVMDSGDLCAFGGGIRGQLGVKLLEGVEKVSVPMH  529

Query  111  VEVDL  97
            V + L
Sbjct  530  VPIVL  534


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/157 (24%), Positives = 69/157 (44%), Gaps = 20/157 (13%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGD---A  397
            ++GR  T+ WG+   LGH ++  +  P+++    ++   +++ G+    +++   +    
Sbjct  268  REGRVYTFSWGKEERLGHSSDPSDVEPRLLSGLEDVPVAYISAGNCYLLMLAYQPNGMSV  327

Query  396  YSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTF  217
            YS GCG    LGH      G          P+L+   + +  + V I+      W  H  
Sbjct  328  YSVGCGLGGKLGHGCKTNKGM---------PKLIEQFQSLSFKPVSIAAGT---W--HAA  373

Query  216  ALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            AL   G++  +G G  G LG     ++  +A P  VE
Sbjct  374  ALGADGRVCTWGWGHTGCLG---HGDEEYKAVPTLVE  407



>ref|XP_004952987.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like isoform X1 
[Setaria italica]
Length=539

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 120/186 (65%), Gaps = 8/186 (4%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F++L+ +PV ++AG WHAA +  DGR CTWGWG  GCLGHG+E+ ++AP VVE   N+K 
Sbjct  356  FQSLSFKPVSISAGTWHAAALSADGRVCTWGWGHTGCLGHGDEEYKAAPTVVEGLRNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVX  274
            VH++TG+YTTFVV+++GD YSFG GES +L         +     +I  P +V SLK + 
Sbjct  416  VHLSTGEYTTFVVADNGDVYSFGSGESLNLIFQEDDEGEEEGPDFSI--PSIVESLKALN  473

Query  273  ERVVQISLTNSIYW------NAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
            ++V Q+  TN+ YW      + HTF + E G+L AFG G +GQLGV L     + + P  
Sbjct  474  KKVAQVCPTNASYWLNSEMGHPHTFVVMESGELCAFGGGIRGQLGVKLLEGVEKVSVPMH  533

Query  111  VEVDLS  94
            V +DLS
Sbjct  534  VPIDLS  539


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 70/157 (45%), Gaps = 20/157 (13%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGD---A  397
            ++GR  T+ WG+   LGH ++  +  P+++    ++   +++ G+    +++   +    
Sbjct  269  REGRVYTFSWGKSERLGHNSDPSDVEPRLLSELEDVPVAYISAGNCYLLMLAYQPNGLSV  328

Query  396  YSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTF  217
            YS GCG    LGH      G          P+L+   + +  + V IS      W  H  
Sbjct  329  YSVGCGLGGKLGHGCKTNKG---------VPKLIEQFQSLSFKPVSISAGT---W--HAA  374

Query  216  ALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            AL+  G++  +G G  G LG     ++  +A P  VE
Sbjct  375  ALSADGRVCTWGWGHTGCLG---HGDEEYKAAPTVVE  408



>ref|XP_006653534.1| PREDICTED: ultraviolet-B receptor UVR8-like [Oryza brachyantha]
Length=541

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 120/184 (65%), Gaps = 9/184 (5%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+A N+ P+ ++AGAWHAAV+  DGR  TWGWG  GCLGHG E+  + P  VE  SN+K 
Sbjct  358  FQAFNICPMSISAGAWHAAVLSCDGRVFTWGWGNNGCLGHGGEEFFTLPTAVEGLSNVKA  417

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLG--HNAVVXDGQVNRHSNILSPELVTSLKQ  280
            VHV+ G+YTTFVV+++GD YSFG GES +LG   +A V   +     + L+P+ V SL  
Sbjct  418  VHVSAGEYTTFVVADNGDVYSFGLGESFNLGFQESAAV---EYEESLSFLTPKFVASLVN  474

Query  279  VXERVVQISLTNSIYW----NAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
            + E+ VQIS +N+  W     +HT ALTE GKL+ FG G KGQLG  L+ ++   A P  
Sbjct  475  LNEKFVQISPSNTWDWLNEGMSHTIALTESGKLYTFGGGIKGQLGFKLAEDEDTMATPVC  534

Query  111  VEVD  100
            V +D
Sbjct  535  VSID  538



>gb|KJB60983.1| hypothetical protein B456_009G334300 [Gossypium raimondii]
Length=455

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            FR LNLQP+VVA GAWHAAVV +DGR CTWGWGRYGCLGHGNE+CES PKVVEA   +K 
Sbjct  356  FRLLNLQPMVVATGAWHAAVVARDGRVCTWGWGRYGCLGHGNEECESVPKVVEALIKVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQV  331
            VHVATGDYTTFV+SEDGD YSFGCGES+SLGHN    +GQV
Sbjct  416  VHVATGDYTTFVLSEDGDVYSFGCGESASLGHN-TAAEGQV  455



>ref|XP_010912917.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Elaeis 
guineensis]
Length=455

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 1/101 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQPVVVAAGAWHAAVVG+DGR CTWGWGRYGCLGHGNE+CES PKVV+A SN+K 
Sbjct  356  FQTLNLQPVVVAAGAWHAAVVGRDGRVCTWGWGRYGCLGHGNEECESVPKVVDALSNVKA  415

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQV  331
            VHVATGDYTTFVV++ GD YSFGCGESSSLGH+  V DGQ+
Sbjct  416  VHVATGDYTTFVVADTGDVYSFGCGESSSLGHSTGV-DGQL  455



>gb|AFK41653.1| unknown [Lotus japonicus]
Length=136

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP+VVAAGAWHAAVVGKDGR CTWGWGRYGCLGHGNEDCES PKVVEA +N+K 
Sbjct  31   FQMLNLQPMVVAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEDCESVPKVVEALTNVKA  90

Query  453  VHVATGDYTTFVVSEDGDAYSFGCG  379
            V+VATGDYTTFVVS+DGD YSFGCG
Sbjct  91   VYVATGDYTTFVVSDDGDVYSFGCG  115



>ref|XP_004975996.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like [Setaria 
italica]
Length=544

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 124/187 (66%), Gaps = 13/187 (7%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGH--GNEDCESAPKVVEAXSNI  460
            F+  N++P+ ++AGA+H AV+  DGR  TWGW R+GCLGH   ++D E  PK VE   ++
Sbjct  364  FQVPNVKPLSISAGAFHCAVLALDGRVFTWGWSRHGCLGHDENDDDDEILPKAVEGLKDV  423

Query  459  KXVHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQ  280
            +  H++ G +TTFVV+++ D YSFG G S +LG   V  DG     +N+ +P+L TS+  
Sbjct  424  RASHLSAGAHTTFVVTDNDDVYSFGWGRSLNLG---VQADGA--EKANVWTPKLATSIAA  478

Query  279  VXERVVQISLTNSIYW-----NAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPE  115
            + E+VVQIS TN+  W      +HT  LTE  +L++FGAG KGQLGV L   Q +R+ P+
Sbjct  479  LNEKVVQISATNTWDWIDQDCYSHTLVLTESVRLYSFGAGTKGQLGVKLVEGQ-KRSTPD  537

Query  114  RVEVDLS  94
            RV++DL+
Sbjct  538  RVDIDLA  544



>ref|XP_006395589.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 ref|XP_006395592.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 ref|XP_006395593.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 gb|ESQ32875.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 gb|ESQ32878.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
 gb|ESQ32879.1| hypothetical protein EUTSA_v10003973mg [Eutrema salsugineum]
Length=454

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 1/101 (1%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ LNLQP VVAAGAWHAAVVG+DGR CTWGWGRYGCLGHG+E+CE  PKVV+  S++K 
Sbjct  355  FKLLNLQPRVVAAGAWHAAVVGQDGRVCTWGWGRYGCLGHGDEECEYVPKVVQGLSHVKA  414

Query  453  VHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQV  331
            VHVATGDYTTFVVS+DGD YSFGCGES+SLGH+  V D QV
Sbjct  415  VHVATGDYTTFVVSDDGDVYSFGCGESASLGHHQDV-DEQV  454


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 69/144 (48%), Gaps = 14/144 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   T+G    G LGHG+ D E+    V +   I+ +  A G   T ++S++G+ Y+  C
Sbjct  163  GEVYTFGCNNSGQLGHGHTDEETRILPVRSLQGIRIIQAAAGTGRTMLISDNGNVYT--C  220

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G   S G      D +  R   + +P+LVTSLK +   VVQ ++ N       T  L+  
Sbjct  221  GR-DSFGE----ADYEGERTRPVTTPQLVTSLKNIF--VVQAAIGNFF-----TAILSRE  268

Query  201  GKLFAFGAGDKGQLGVALSANQTE  130
            GK++    G+ G+LG    A   E
Sbjct  269  GKVYTLSWGNDGRLGHQTEAGDVE  292



>ref|XP_003579993.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 [Brachypodium 
distachyon]
Length=548

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 116/184 (63%), Gaps = 11/184 (6%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGN-EDCESAPKVVEAXSNIK  457
            F+A N++P+ ++AGAWHAAV+ +DGR  TWGW   GCLGHG+ EDC + P+ VE  +N+K
Sbjct  361  FQAFNIRPMSISAGAWHAAVMCRDGRVFTWGWNSSGCLGHGDSEDCVTLPRAVEGLNNVK  420

Query  456  XVHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQV  277
             VHV+ G++ TFVV+++GD YSFG   S +LG      D +   + ++L P+  T L  +
Sbjct  421  AVHVSAGEWCTFVVADNGDVYSFGFRGSHNLGFQD--NDAE---NEDVLPPKPATLLADL  475

Query  276  XERVVQISLTNSIYWN-----AHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPER  112
             ER VQIS T++  WN      HT AL E G ++AFG G  GQLGV L   +     P +
Sbjct  476  NERFVQISPTSAYNWNNAEQPHHTVALAESGIVYAFGGGSMGQLGVKLVEGKEAMPTPVQ  535

Query  111  VEVD  100
            V +D
Sbjct  536  VAID  539



>gb|AEW08936.1| hypothetical protein CL2350Contig1_01, partial [Pinus lambertiana]
 gb|AFB34079.1| hypothetical protein CL2350Contig1_01, partial [Pinus cembra]
 gb|AFB34080.1| hypothetical protein CL2350Contig1_01, partial [Pinus cembra]
 gb|AFB34081.1| hypothetical protein CL2350Contig1_01, partial [Pinus cembra]
 gb|AFB34082.1| hypothetical protein CL2350Contig1_01, partial [Pinus cembra]
 gb|AFB34083.1| hypothetical protein CL2350Contig1_01, partial [Pinus cembra]
 gb|AFB34084.1| hypothetical protein CL2350Contig1_01, partial [Pinus cembra]
 gb|AFB34085.1| hypothetical protein CL2350Contig1_01, partial [Pinus cembra]
 gb|AFB34086.1| hypothetical protein CL2350Contig1_01, partial [Pinus cembra]
Length=96

 Score =   122 bits (307),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ L L+PVV+AAGAWHAAVVGKDGR CTWGWGRYGCLGHGNE+CE+ PKVVE+   +K 
Sbjct  12   FKLLKLEPVVIAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEECETVPKVVESLLAVKA  71

Query  453  VHVATGDYTTFVVSEDGDAYSFGCG  379
            VHV TGDYTTFVV+E+GD YSFGCG
Sbjct  72   VHVTTGDYTTFVVAENGDVYSFGCG  96



>gb|AEW08937.1| hypothetical protein CL2350Contig1_01, partial [Pinus radiata]
 gb|AFB34087.1| hypothetical protein CL2350Contig1_01, partial [Pinus mugo]
 gb|AFG67538.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67539.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67540.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67541.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67542.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67543.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67544.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67545.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67546.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67547.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67548.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67549.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67550.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67551.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67552.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67553.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
 gb|AFG67554.1| hypothetical protein CL2350Contig1_01, partial [Pinus taeda]
Length=96

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKX  454
            F+ L L+PVV+AAGAWHAAVVGKDGR CTWGWGRYGCLGHGNE+CE+ PKVVE+   +K 
Sbjct  12   FKHLKLEPVVIAAGAWHAAVVGKDGRVCTWGWGRYGCLGHGNEECETVPKVVESLLRVKA  71

Query  453  VHVATGDYTTFVVSEDGDAYSFGCG  379
            VHV TGDYTTFVV+E+GD YSFGCG
Sbjct  72   VHVTTGDYTTFVVAENGDVYSFGCG  96



>gb|KHN02047.1| Putative E3 ubiquitin-protein ligase HERC2 [Glycine soja]
Length=91

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -2

Query  540  WGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSSLG  361
            +GRYGCLGHG+++C+S PK VEA SN+K +HV  GDYTTFVV +DGD YSFGCG+S+SLG
Sbjct  24   YGRYGCLGHGSDECDSVPKAVEALSNVKAIHVVAGDYTTFVVFDDGDVYSFGCGQSASLG  83

Query  360  HNAVVXD  340
            HNAV  D
Sbjct  84   HNAVGND  90



>gb|KFK41183.1| hypothetical protein AALP_AA2G096500 [Arabis alpina]
Length=259

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 73/111 (66%), Gaps = 10/111 (9%)
 Frame = -2

Query  420  VVSEDG-DAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTN  244
            VV +DG   YSFGCGES++LG   V          N L+P+LV+SLK+  ERVV +SL N
Sbjct  157  VVGKDGWSVYSFGCGESANLGQGDV--------DENTLTPKLVSSLKKTKERVVHVSLKN  208

Query  243  SIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE-VDLS  94
            S+YW  HTF +TE G L+ FG GD+GQLGV L  + TER  P +V  +DLS
Sbjct  209  SVYWTGHTFEMTESGTLYVFGVGDRGQLGVELGDSSTERVKPTKVVGIDLS  259



>ref|XP_002448071.1| hypothetical protein SORBIDRAFT_06g020490 [Sorghum bicolor]
 gb|EES12399.1| hypothetical protein SORBIDRAFT_06g020490 [Sorghum bicolor]
Length=529

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 112/192 (58%), Gaps = 20/192 (10%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGW-GRYGCLGHGN-EDCESAPKVVEAXSNI  460
            F+ L ++PV V+AGA+H AV+  DGR  TWGW    GCLGH + ++    P  V    ++
Sbjct  344  FKTLKVKPVSVSAGAFHCAVLASDGRVFTWGWDSDTGCLGHDDKQEYVVLPTAVAGLGSV  403

Query  459  KXVHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLK-  283
            K  +++TG  +TFVV+++GD YSFGC  S +LG  A V +       ++  P+L  +L  
Sbjct  404  KATYISTGYCSTFVVTDNGDVYSFGCDHSRNLGVKADVGE-------DVRIPKLAANLNV  456

Query  282  QVXERVVQISLTNSIYWNA----------HTFALTEXGKLFAFGAGDKGQLGVALSANQT  133
             + E+VVQIS TN+  W +          HT  LTE G+L++ G G +GQLGV L+  Q 
Sbjct  457  SLNEKVVQISATNTWDWPSRSQNRITSECHTCVLTESGRLYSLGRGSEGQLGVKLAEGQK  516

Query  132  ERANPERVEVDL  97
             R  P+ V +DL
Sbjct  517  IRPAPDGVAIDL  528



>gb|EMT06491.1| hypothetical protein F775_19352 [Aegilops tauschii]
Length=485

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 109/187 (58%), Gaps = 15/187 (8%)
 Frame = -2

Query  633  FRALNLQPvvvaagawhaavVGKDGRXCTWGWGRYGCLGHG-NEDCESAPKVVEAXSNIK  457
            F  ++ +PV ++AGAWHAAV+  DGR   WGWG  GCLGHG  E+C + P  VE  +   
Sbjct  307  FAGIDARPVSISAGAWHAAVLSSDGRVLPWGWGVQGCLGHGYAEECATLPMAVEISN---  363

Query  456  XVHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQV  277
             VHV+ G Y TFV++++GD YSFG     +LG    + D   + +  +L+P+LV SL  +
Sbjct  364  AVHVSAGQYCTFVMTDNGDVYSFGWKGYYNLG----LQDEDEDENQGVLAPKLVASLTGL  419

Query  276  XERVVQISLTNSIYWN------AHTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPE  115
             +R VQIS TN+  W+      +HT ALTE GK++AF  G          A   E   P 
Sbjct  420  NKRFVQISPTNAYDWHNRRTGVSHTVALTESGKVYAF-GGGGSGQLGLKLAEGKEAMPPL  478

Query  114  RVEVDLS  94
            +V++DL+
Sbjct  479  QVDIDLA  485



>ref|NP_608388.2| HECT and RLD domain containing protein 2 ortholog [Drosophila 
melanogaster]
 sp|Q9VR91.3|HERC2_DROME RecName: Full=Probable E3 ubiquitin-protein ligase HERC2; AltName: 
Full=HECT domain and RCC1-like domain-containing protein 
2 [Drosophila melanogaster]
 gb|AAF50913.3| HECT and RLD domain containing protein 2 ortholog [Drosophila 
melanogaster]
Length=4912

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P++VEA    K   VA G   +  +S  G+ Y++G
Sbjct  3091  DGKVFSWGEGEDGKLGHGNRTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWG  3150

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           ++  L P+LVT+L     RVVQ++  +    +A T ALTE
Sbjct  3151  LGEYGRLGH---------GDNTTQLKPKLVTAL--AGRRVVQVACGSR---DAQTLALTE  3196

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  3197  DGAVFSWGDGDFGKLG  3212


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 69/136 (51%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  V V  G   +  +++ G  Y++G
Sbjct  4260  DDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWG  4319

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH +V          ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  4320  KGDFHRLGHGSV---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  4363

Query  204   XGKLFAFGAGDKGQLG  157
              G+++ +G  D+GQLG
Sbjct  4364  SGEVYTWGDNDEGQLG  4379


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 66/137 (48%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +    P  +E  S I  V +  G   +  ++  G+ +++
Sbjct  3196  EDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTW  3255

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH         ++H  +  P+ +  L+    RV+ +++        H  A+T
Sbjct  3256  GKGDYYRLGHGG-------DQH--VRKPQPIGGLR--GRRVIHVAVG-----ALHCLAVT  3299

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3300  DAGQVYAWGDNDHGQQG  3316


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 63/136 (46%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G    WG G  G LGHGN      PK+VE  + +    +A G   +  ++  G   ++G
Sbjct  4154  EGEVYAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWG  4213

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4214  KGRYGRLGH---------GDSEDQLRPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4259

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4260  DDNVWSWGDGDYGKLG  4275


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 43/152 (28%), Positives = 64/152 (42%), Gaps = 20/152 (13%)
 Frame = -2

Query  552   CT---WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             CT   WG      LG         P   +  S ++ +H+A G  + F+VS+DG  Y+ G 
Sbjct  2986  CTVMVWGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACGE  3045

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G +  LG              N+  P  +  L+Q   + V +          H  ALT  
Sbjct  3046  GTNGRLGLGVT---------HNVPLPHQLPVLRQYVVKKVAVHSGGK-----HALALTLD  3091

Query  201   GKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             GK+F++G G+ G+LG     N+T    P  VE
Sbjct  3092  GKVFSWGEGEDGKLG---HGNRTTLDKPRLVE  3120


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 44/129 (34%), Positives = 63/129 (49%), Gaps = 20/129 (16%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G Y  LGHGN D  S P +V A S+   V VA  +GD  +  ++ +G  +++
Sbjct  687  GNLLTWGRGTYARLGHGNSDDRSLPTLVVALSDHMVVDVALGSGDAHSLALTSEGLVFAW  746

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG      +G  N     L P LV SL +V +RV   S          + AL+
Sbjct  747  GDGDYGKLG------NGNCN---GSLQPILVESLPRV-QRVFAGS--------QFSVALS  788

Query  207  EXGKLFAFG  181
              G+L+ +G
Sbjct  789  SEGQLYTWG  797


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/135 (30%), Positives = 68/135 (50%), Gaps = 16/135 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G    WG G YG LG+GN +    P +VE+   ++ V    G   +  +S +G  Y++ 
Sbjct  740  EGLVFAWGDGDYGKLGNGNCNGSLQPILVESLPRVQRVF--AGSQFSVALSSEGQLYTW-  796

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G+++ LGH  V    Q         P LV+SL+   +R+V ++++      AH  AL+ 
Sbjct  797  -GKATCLGHQLVERSVQ-----GCSVPRLVSSLQH--KRIVDVAVS-----VAHCLALSS  843

Query  204  XGKLFAFGAGDKGQL  160
             G++F +G  D  Q+
Sbjct  844  SGEVFGWGRNDSQQI  858


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG+ D    PK V A    K + +ATG       S+ G+ Y++
Sbjct  4311  KSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVYTW  4370

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV +L+   + +V+++       +AHT AL+
Sbjct  4371  GDNDEGQLG------DGTV---TAIQRPRLVAALQ--GKHIVKVTCG-----SAHTLALS  4414


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 40/131 (31%), Positives = 61/131 (47%), Gaps = 14/131 (11%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            +WG G    LGHG+    + P  + A        V  G   +  ++  G+  ++G G  +
Sbjct  639  SWGTGEDHRLGHGDTHARAVPTKIAALEQHCVQSVYCGCSYSAAITCGGNLLTWGRGTYA  698

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH      G  +  S    P LV +L      VV ++L +    +AH+ ALT  G +F
Sbjct  699  RLGH------GNSDDRS---LPTLVVALSD--HMVVDVALGSG---DAHSLALTSEGLVF  744

Query  189  AFGAGDKGQLG  157
            A+G GD G+LG
Sbjct  745  AWGDGDYGKLG  755



>ref|XP_002039536.1| GM23027 [Drosophila sechellia]
 gb|EDW56278.1| GM23027 [Drosophila sechellia]
Length=3806

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P++VEA    K   VA G   +  +S  G+ Y++G
Sbjct  2746  DGKVFSWGEGEDGKLGHGNRTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWG  2805

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           ++  L P+LVT+L     RVVQ++  +    +A T ALTE
Sbjct  2806  LGEYGRLGH---------GDNTTQLKPKLVTAL--AGRRVVQVACGSR---DAQTLALTE  2851

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  2852  DGAVFSWGDGDFGKLG  2867


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 66/137 (48%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +    P  +E  S I  V +  G   +  ++  G+ +++
Sbjct  2851  EDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTW  2910

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH         ++H  +  P+ +  L+    RV+ +++        H  A+T
Sbjct  2911  GKGDYYRLGHGG-------DQH--VRKPQPIGGLR--GRRVIHVAVG-----ALHCLAVT  2954

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  2955  DAGQVYAWGDNDHGQQG  2971


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 44/129 (34%), Positives = 63/129 (49%), Gaps = 20/129 (16%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G Y  LGHGN D  S P +V A S+   V VA  +GD  +  ++ +G  +++
Sbjct  341  GNLLTWGRGTYARLGHGNSDDRSLPTLVVALSDHMVVDVALGSGDAHSLALTSEGLVFAW  400

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG      +G  N     L P LV SL +V +RV   S          + AL+
Sbjct  401  GDGDYGKLG------NGNCN---GSLQPILVESLPRV-QRVFAGS--------QFSVALS  442

Query  207  EXGKLFAFG  181
              G+L+ +G
Sbjct  443  SEGQLYTWG  451


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 40/135 (30%), Positives = 68/135 (50%), Gaps = 16/135 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G    WG G YG LG+GN +    P +VE+   ++ V    G   +  +S +G  Y++ 
Sbjct  394  EGLVFAWGDGDYGKLGNGNCNGSLQPILVESLPRVQRVF--AGSQFSVALSSEGQLYTW-  450

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G+++ LGH  V    Q         P LV+SL+   +R+V ++++      AH  AL+ 
Sbjct  451  -GKATCLGHQLVERSVQ-----GCSVPRLVSSLQH--KRIVDVAVS-----VAHCLALSS  497

Query  204  XGKLFAFGAGDKGQL  160
             G++F +G  D  Q+
Sbjct  498  SGEVFGWGRNDSQQI  512


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 43/152 (28%), Positives = 63/152 (41%), Gaps = 20/152 (13%)
 Frame = -2

Query  552   CT---WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             CT   WG      LG         P   +  S ++ +H+A G  + F+VS+DG  Y+ G 
Sbjct  2641  CTVMVWGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACGE  2700

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G +  LG              N+  P  +  L Q   + V +          H  ALT  
Sbjct  2701  GTNGRLGLGVT---------HNVPLPHQLPVLHQYVVKKVAVHSGGK-----HALALTLD  2746

Query  201   GKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             GK+F++G G+ G+LG     N+T    P  VE
Sbjct  2747  GKVFSWGEGEDGKLG---HGNRTTLDKPRLVE  2775


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 40/131 (31%), Positives = 61/131 (47%), Gaps = 14/131 (11%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            +WG G    LGHG+    + P  + A        V  G   +  ++  G+  ++G G  +
Sbjct  293  SWGTGEDHRLGHGDTHARAVPTKIAALEQHCVQSVYCGCSYSAAITCGGNLLTWGRGTYA  352

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH      G  +  S    P LV +L      VV ++L +    +AH+ ALT  G +F
Sbjct  353  RLGH------GNSDDRS---LPTLVVALSD--HMVVDVALGSG---DAHSLALTSEGLVF  398

Query  189  AFGAGDKGQLG  157
            A+G GD G+LG
Sbjct  399  AWGDGDYGKLG  409



>ref|XP_001977881.1| GG19286 [Drosophila erecta]
 gb|EDV46808.1| GG19286 [Drosophila erecta]
Length=4908

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 52/136 (38%), Positives = 71/136 (52%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P++VEA    K   VA G   +  +S  G+ Y++G
Sbjct  3088  DGKVFSWGEGEDGKLGHGNRTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWG  3147

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH   V           L P+LV +L     RVVQ++  +    +A T ALTE
Sbjct  3148  LGEYGRLGHGDNVTQ---------LKPKLVVAL--AGRRVVQVACGSR---DAQTLALTE  3193

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  3194  DGAVFSWGDGDFGKLG  3209


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 69/136 (51%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  V V  G   +  +++ G  Y++G
Sbjct  4256  DDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWG  4315

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH +V          ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  4316  KGDFHRLGHGSV---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  4359

Query  204   XGKLFAFGAGDKGQLG  157
              G+++ +G  D+GQLG
Sbjct  4360  SGEVYTWGDNDEGQLG  4375


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 66/137 (48%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +    P  +E  S I  V +  G   +  ++  G+ +++
Sbjct  3193  EDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTW  3252

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH         ++H  +  P+ +  L+    RV+ +++        H  A+T
Sbjct  3253  GKGDYYRLGHGG-------DQH--VRKPQPIGGLR--GRRVIHVAVG-----ALHCLAVT  3296

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3297  DAGQVYAWGDNDHGQQG  3313


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 63/136 (46%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G    WG G  G LGHGN      PK+VE  + +    +A G   +  ++  G   ++G
Sbjct  4150  EGEVYAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWG  4209

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4210  KGRYGRLGH---------GDSEDQLRPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4255

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4256  DDNVWSWGDGDYGKLG  4271


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 41/135 (30%), Positives = 68/135 (50%), Gaps = 16/135 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G    WG G YG LG+GN +    P +VE+   ++ V    G   +  +S +G  YS+ 
Sbjct  737  EGLVFAWGDGDYGKLGNGNCNGSLQPILVESLPRVQRVF--AGSQFSLALSSEGQLYSW-  793

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G+++ LGH  V    Q         P LV+SL+   +R+V ++++      AH  AL+ 
Sbjct  794  -GKATCLGHQLVERSVQ-----GCSVPRLVSSLQH--KRIVDVAVS-----VAHCLALSS  840

Query  204  XGKLFAFGAGDKGQL  160
             G++F +G  D  Q+
Sbjct  841  SGEVFGWGRNDSQQI  855


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 44/129 (34%), Positives = 64/129 (50%), Gaps = 20/129 (16%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G Y  LGHGN D  S P +V A S+   V VA  +GD  +  ++ +G  +++
Sbjct  684  GNLLTWGRGTYARLGHGNSDDRSLPTLVVALSDHMVVDVALGSGDAHSLALTSEGLVFAW  743

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG      +G  N     L P LV SL +V +RV   S          + AL+
Sbjct  744  GDGDYGKLG------NGNCN---GSLQPILVESLPRV-QRVFAGS--------QFSLALS  785

Query  207  EXGKLFAFG  181
              G+L+++G
Sbjct  786  SEGQLYSWG  794


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 43/152 (28%), Positives = 63/152 (41%), Gaps = 20/152 (13%)
 Frame = -2

Query  552   CT---WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             CT   WG      LG         P   +  S ++ +H+A G  + F+VS+DG  Y+ G 
Sbjct  2983  CTVMVWGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACGE  3042

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G +  LG              N+  P  +  L Q   + V +          H  ALT  
Sbjct  3043  GTNGRLGLGVT---------HNVPLPHQLPVLHQYVVKKVAVHSGGK-----HALALTLD  3088

Query  201   GKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             GK+F++G G+ G+LG     N+T    P  VE
Sbjct  3089  GKVFSWGEGEDGKLG---HGNRTTLDKPRLVE  3117


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG+ D    PK V A    K + +ATG       S+ G+ Y++
Sbjct  4307  KSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVYTW  4366

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV +L+   + +V+++       +AHT AL+
Sbjct  4367  GDNDEGQLG------DGTV---TAIQRPRLVAALQ--GKHIVKVTCG-----SAHTLALS  4410


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 40/131 (31%), Positives = 61/131 (47%), Gaps = 14/131 (11%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            +WG G    LGHG+    + P  + A        V  G   +  ++  G+  ++G G  +
Sbjct  636  SWGTGEDHRLGHGDTHARAVPTKIAALEQHCVQSVYCGCSYSAAITCGGNLLTWGRGTYA  695

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH      G  +  S    P LV +L      VV ++L +    +AH+ ALT  G +F
Sbjct  696  RLGH------GNSDDRS---LPTLVVALSD--HMVVDVALGSG---DAHSLALTSEGLVF  741

Query  189  AFGAGDKGQLG  157
            A+G GD G+LG
Sbjct  742  AWGDGDYGKLG  752



>ref|XP_001355626.2| GA11166 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL32685.2| GA11166 [Drosophila pseudoobscura pseudoobscura]
Length=5072

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P++VE   + K   VA G   +  +S  G+ Y++G
Sbjct  3200  DGKVFSWGEGEDGKLGHGNRTTLDKPRLVETLRSKKIRDVACGSSHSAAISSQGELYTWG  3259

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           +S  L P+LV +L     RV+Q++  +    +A T ALTE
Sbjct  3260  LGEYGRLGH---------GDNSTQLKPKLVAAL--AGRRVIQVACGSR---DAQTLALTE  3305

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  3306  DGAVFSWGDGDFGKLG  3321


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 35/137 (26%), Positives = 66/137 (48%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +    P  +E  S I  + +  G   +  ++  G+ +++
Sbjct  3305  EDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVIQIECGAQFSLALTRAGEVWTW  3364

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH         ++H  +  P+ +  L+    RV+ +++        H  A+T
Sbjct  3365  GKGDYYRLGHGG-------DQH--VRKPQPIAGLR--GRRVIHVAVG-----ALHCLAVT  3408

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3409  DAGQVYAWGDNDHGQQG  3425


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 69/136 (51%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  + V  G   +  +++ G  Y++G
Sbjct  4447  DDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVIKVECGSQFSVALTKSGAVYTWG  4506

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH +V          ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  4507  KGDFHRLGHGSV---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  4550

Query  204   XGKLFAFGAGDKGQLG  157
              G+++ +G  D+GQLG
Sbjct  4551  SGEVYTWGDNDEGQLG  4566


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 42/129 (33%), Positives = 65/129 (50%), Gaps = 20/129 (16%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G Y  LGHGN D +  P VV A +  + + VA  +GD  +  ++ +G  Y++
Sbjct  690  GNLYTWGRGTYARLGHGNSDDQPLPTVVMALTEHEIIDVALGSGDAHSLCLTSEGHVYAW  749

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G  +   LG      +G +N     +SP LV SL +V +RV   +          + ALT
Sbjct  750  GDADYGKLG------NGNLN---GSMSPVLVESLPKV-QRVFAGA--------QFSMALT  791

Query  207  EXGKLFAFG  181
              G+L+++G
Sbjct  792  TDGQLYSWG  800


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 62/136 (46%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G    WG G  G LGHGN      PK+VE  + +    +A G   +  ++  G   ++G
Sbjct  4341  EGEVYAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMNVADIACGSAHSAAITASGHVLTWG  4400

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + I+  +    +A T  + +
Sbjct  4401  KGRYGRLGH---------GDSEDQLRPQLVEAL--LGYRAIDIACGSG---DAQTLCIND  4446

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4447  DDNVWSWGDGDYGKLG  4462


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG+ D    PK V A    K + +ATG       S+ G+ Y++
Sbjct  4498  KSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVYTW  4557

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV +L+   + +V+++       +AHT AL+
Sbjct  4558  GDNDEGQLG------DGTV---TAIQRPRLVAALQ--GKHIVKVTCG-----SAHTLALS  4601


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 39/135 (29%), Positives = 66/135 (49%), Gaps = 16/135 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G    WG   YG LG+GN +   +P +VE+   ++ V    G   +  ++ DG  YS+ 
Sbjct  743  EGHVYAWGDADYGKLGNGNLNGSMSPVLVESLPKVQRVF--AGAQFSMALTTDGQLYSW-  799

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G++S LGH  V    Q         P L++ L+   +R+V +++       AH  AL+ 
Sbjct  800  -GKASCLGHQLVERSAQWCS-----VPRLISGLQH--KRIVDVAVG-----VAHCLALSS  846

Query  204  XGKLFAFGAGDKGQL  160
             G++F +G  D  Q+
Sbjct  847  CGEVFGWGRNDSQQI  861


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 41/152 (27%), Positives = 62/152 (41%), Gaps = 20/152 (13%)
 Frame = -2

Query  552   CT---WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             CT   WG      LG         P   +  S ++ +H+A G  + F+V ++G  Y+ G 
Sbjct  3095  CTVMVWGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVGQNGKVYACGE  3154

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G +  LG              N+  P  +  L Q   + V +          H  ALT  
Sbjct  3155  GTNGRLGLGVT---------HNVPLPHQLPVLHQYVVKKVAVHSGGK-----HALALTLD  3200

Query  201   GKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             GK+F++G G+ G+LG     N+T    P  VE
Sbjct  3201  GKVFSWGEGEDGKLG---HGNRTTLDKPRLVE  3229



>ref|XP_006084722.1| PREDICTED: E3 ISG15--protein ligase HERC5-like [Myotis lucifugus]
Length=870

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 77/143 (54%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D E  P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  115  GNVYSWGRNDFGQLGLGHTDNEDCPSLIEALDNQKVEFLACGGSHTALLTKDGLLFTFGA  174

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L  + +RV QI+         HT A +++
Sbjct  175  GKHGQLGHNST---------QNELKPCLVAEL--LGKRVTQIACGRR-----HTLAYVSD  218

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G++GQLG   + NQ
Sbjct  219  LGKVFSFGSGEEGQLGNGGTQNQ  241



>ref|XP_006084723.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Myotis lucifugus]
Length=947

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 77/143 (54%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D E  P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  133  GNVYSWGRNDFGQLGLGHTDNEDCPSLIEALDNQKVEFLACGGSHTALLTKDGLLFTFGA  192

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L  + +RV QI+         HT A +++
Sbjct  193  GKHGQLGHNST---------QNELKPCLVAEL--LGKRVTQIACGRR-----HTLAYVSD  236

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G++GQLG   + NQ
Sbjct  237  LGKVFSFGSGEEGQLGNGGTQNQ  259



>ref|XP_002011008.1| GI16306 [Drosophila mojavensis]
 gb|EDW05850.1| GI16306 [Drosophila mojavensis]
Length=5077

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 52/152 (34%), Positives = 77/152 (51%), Gaps = 14/152 (9%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P++VEA    K   +A G   +  +S  G+ Y++G
Sbjct  3166  DGKVFSWGEGEDGKLGHGNRSTLDKPRLVEALRAKKIRDIACGSSHSAAISSQGELYTWG  3225

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           ++  L P+LV +L     RV+Q++  +    +A T ALTE
Sbjct  3226  LGEYGRLGH---------GDNATQLKPKLVAALS--GRRVIQVACGSR---DAQTLALTE  3271

Query  204   XGKLFAFGAGDKGQLGVALSANQTERANPERV  109
              G +F++G GD G+LG   S   +     ER+
Sbjct  3272  DGAVFSWGDGDFGKLGRGGSEGSSTPHEIERL  3303


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 67/137 (49%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +  S P  +E  S I  + +  G   +  ++  G+ +++
Sbjct  3271  EDGAVFSWGDGDFGKLGRGGSEGSSTPHEIERLSGIGVIQIECGAQFSLALTRAGEVWTW  3330

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH         ++H  +  P+ +  L+    RV+ +++        H  A+T
Sbjct  3331  GKGDYYRLGHGG-------DQH--VRKPQPIAGLR--GHRVIHVAVG-----ALHCLAVT  3374

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3375  DAGQVYAWGDNDHGQQG  3391


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 69/136 (51%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  + V  G   +  +++ G  Y++G
Sbjct  4425  DDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVIKVECGSQFSVALTKSGAVYTWG  4484

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH +V          ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  4485  KGDFHRLGHGSV---------EHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  4528

Query  204   XGKLFAFGAGDKGQLG  157
              G++F +G  D+GQLG
Sbjct  4529  AGEVFTWGDNDEGQLG  4544


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 39/136 (29%), Positives = 63/136 (46%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG    WG G  G LGHGN      PK+VE  + +    +A G   +  ++  G   ++G
Sbjct  4319  DGEVYAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWG  4378

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4379  KGRYGRLGH---------GDSEDQLRPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4424

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4425  DDNVWSWGDGDYGKLG  4440


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 43/152 (28%), Positives = 62/152 (41%), Gaps = 20/152 (13%)
 Frame = -2

Query  552   CT---WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             CT   WG      LG         P      S ++ +H+A G  + FVVS+DG  Y+ G 
Sbjct  3061  CTVMVWGLNDKEQLGGLKGSKVKVPTFSPTISRLRPIHIAGGSKSLFVVSQDGKVYACGE  3120

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G +  LG              N+  P  +  L Q   + V +          H  ALT  
Sbjct  3121  GTNGRLGLGVT---------HNVPLPHQLPVLHQYVVKKVAVHSGGK-----HALALTLD  3166

Query  201   GKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             GK+F++G G+ G+LG     N++    P  VE
Sbjct  3167  GKVFSWGEGEDGKLG---HGNRSTLDKPRLVE  3195


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 42/132 (32%), Positives = 64/132 (48%), Gaps = 17/132 (13%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSN-IKXVHVATGDYTTFVVSEDGDAYSFGCGES  373
            +WG G    LGHG+      P  +E+    +K V+   G   +  ++  G+ Y++G G  
Sbjct  669  SWGVGDSRRLGHGDCHARELPTKIESLVRLVKSVYC--GCSYSAAITLGGNLYTWGRGTY  726

Query  372  SSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKL  193
              LGH     D Q         P +V +LK    +VV ++L +    +AHT  LT  G +
Sbjct  727  GRLGHG--TSDDQC-------LPAMVMALKD--HQVVDVALGSG---DAHTLCLTSEGLV  772

Query  192  FAFGAGDKGQLG  157
            FA+G GD G+LG
Sbjct  773  FAWGDGDYGKLG  784


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 43/132 (33%), Positives = 65/132 (49%), Gaps = 26/132 (20%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G YG LGHG  D +  P +V A  + + V VA  +GD  T  ++ +G  +++
Sbjct  716  GNLYTWGRGTYGRLGHGTSDDQCLPAMVMALKDHQVVDVALGSGDAHTLCLTSEGLVFAW  775

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERV---VQISLTNSIYWNAHTF  217
            G G+   LG      +G  N     L P+L+  L +V +RV    Q SL           
Sbjct  776  GDGDYGKLG------NGSCNSS---LLPQLIDCLPRV-QRVFAGAQFSL-----------  814

Query  216  ALTEXGKLFAFG  181
            AL+  G+L+++G
Sbjct  815  ALSCEGQLYSWG  826


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 67/135 (50%), Gaps = 16/135 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G    WG G YG LG+G+ +    P++++    ++ V    G   +  +S +G  YS+ 
Sbjct  769  EGLVFAWGDGDYGKLGNGSCNSSLLPQLIDCLPRVQRVF--AGAQFSLALSCEGQLYSW-  825

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G++S LGH  V  + Q         P L+T L+   +R+V +++       AH  AL+ 
Sbjct  826  -GKASCLGHQLVERNVQ-----GCSVPRLITGLQH--KRIVDVAVG-----VAHCLALSS  872

Query  204  XGKLFAFGAGDKGQL  160
             G++F +G  D  Q+
Sbjct  873  SGEIFGWGRNDNQQI  887


 Score = 49.7 bits (117),  Expect = 0.001, Method: Composition-based stats.
 Identities = 37/120 (31%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG+ +    PK V A    K + +ATG       S+ G+ +++
Sbjct  4476  KSGAVYTWGKGDFHRLGHGSVEHVRRPKKVAALQGKKIISIATGSLHCVACSDAGEVFTW  4535

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV +L+   + +V+++       +AHT AL+
Sbjct  4536  GDNDEGQLG------DGTV---TAIQRPRLVAALQ--GKHIVKVTCG-----SAHTLALS  4579



>ref|XP_008579308.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Galeopterus variegatus]
Length=944

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+ D + +P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  131  GNIYSWGKNDLGQLGLGHTDSKDSPSLIEALDNQKVEFLACGGSHTALLTQDGLVFTFGA  190

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV QI+      W  HT A +++
Sbjct  191  GKYGQLGHNS---------RQNELRPCLVTEL--AGSRVTQIACGR---W--HTLAYVSD  234

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+FAFG+G +GQLG   + NQ
Sbjct  235  LGKVFAFGSGKEGQLGNGGTHNQ  257



>ref|XP_008141914.1| PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--protein ligase HERC5 
[Eptesicus fuscus]
Length=942

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 51/136 (38%), Positives = 74/136 (54%), Gaps = 17/136 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D E  P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  131  GNIYSWGRNDFGQLGLGHTDNEDFPSLIEAPDNQKVEFLACGGSHTALLTKDGLLFTFGA  190

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L  V +RV QI+         HT A +++
Sbjct  191  GKHGQLGHNST---------QNELKPCLVTEL--VGKRVTQIACGRR-----HTLAYVSD  234

Query  204  XGKLFAFGAGDKGQLG  157
             GK+F+FG+G +GQLG
Sbjct  235  LGKVFSFGSGKEGQLG  250


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 44/145 (30%), Positives = 64/145 (44%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGN-EDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   YG LG G   D   +P++VE  S I    ++ G   +  +S  G+ YS
Sbjct  76   KGGELFAWGQNLYGQLGLGRILDSTPSPQLVEHLSGIPLAQISAGKAHSMALSMSGNIYS  135

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  +   LG         +    N   P L+ +     ++V  ++   S     HT  L
Sbjct  136  WGRNDFGQLG---------LGHTDNEDFPSLIEAPDN--QKVEFLACGGS-----HTALL  179

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G LF FGAG  GQLG   + N+
Sbjct  180  TKDGLLFTFGAGKHGQLGHNSTQNE  204



>ref|XP_002025047.1| GL26839 [Drosophila persimilis]
 gb|EDW30535.1| GL26839 [Drosophila persimilis]
Length=3840

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 72/136 (53%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P++VE   + K   VA G   +  +S  G+ Y++G
Sbjct  1937  DGKVFSWGEGEDGKLGHGNRTTLDKPRLVETLRSKKIRDVACGSSHSAAISSQGELYTWG  1996

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           ++  L P+LV +L     RV+Q++  +    +A T ALTE
Sbjct  1997  LGEYGRLGH---------GDNATQLKPKLVAAL--AGRRVIQVACGSR---DAQTLALTE  2042

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  2043  DGSVFSWGDGDFGKLG  2058


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 35/137 (26%), Positives = 66/137 (48%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +    P  +E  S I  + +  G   +  ++  G+ +++
Sbjct  2042  EDGSVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVIQIECGAQFSLALTRAGEVWTW  2101

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH         ++H  +  P+ +  L+    RV+ +++        H  A+T
Sbjct  2102  GKGDYYRLGHGG-------DQH--VRKPQPIGGLR--GRRVIHVAVG-----ALHCLAVT  2145

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  2146  DAGQVYAWGDNDHGQQG  2162


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 63/136 (46%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G    WG G  G LGHGN      PK+VE  + +    +A G   +  ++  G   ++G
Sbjct  3082  EGEVYAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMNVADIACGSAHSAAITASGHVLTWG  3141

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  3142  KGRYGRLGH---------GDSEDQLRPQLVEAL--LGYRAIDIACGSG---DAQTLCITD  3187

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  3188  DDNVWSWGDGDYGKLG  3203


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 68/136 (50%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  + V  G   +  +++ G  Y++ 
Sbjct  3188  DDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVIKVECGSQFSVALTKSGAVYTWS  3247

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH +V          ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  3248  KGDFHRLGHGSV---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  3291

Query  204   XGKLFAFGAGDKGQLG  157
              G+++ +G  D+GQLG
Sbjct  3292  SGEVYTWGDNDEGQLG  3307


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 38/120 (32%), Positives = 57/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TW  G +  LGHG+ D    PK V A    K + +ATG       S+ G+ Y++
Sbjct  3239  KSGAVYTWSKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVYTW  3298

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV +L+   + +V+++       +AHT AL+
Sbjct  3299  GDNDEGQLG------DGTV---TAIQRPRLVAALQ--GKHIVKVTCG-----SAHTLALS  3342


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 41/152 (27%), Positives = 62/152 (41%), Gaps = 20/152 (13%)
 Frame = -2

Query  552   CT---WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             CT   WG      LG         P   +  S ++ +H+A G  + F+V ++G  Y+ G 
Sbjct  1832  CTVMVWGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVGQNGKVYACGE  1891

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G +  LG              N+  P  +  L Q   + V +          H  ALT  
Sbjct  1892  GTNGRLGLGVT---------HNVPLPHQLPVLHQYVVKKVAVHSGGK-----HALALTLD  1937

Query  201   GKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             GK+F++G G+ G+LG     N+T    P  VE
Sbjct  1938  GKVFSWGEGEDGKLG---HGNRTTLDKPRLVE  1966



>ref|XP_004756145.1| PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--protein ligase HERC5 
[Mustela putorius furo]
Length=1025

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 17/136 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+ D E  P +VEA  + K   +A G   T +++EDG  ++FG 
Sbjct  215  GNIYSWGRNDLGQLGLGHTDGEEFPSLVEALDSQKVEFLACGGSHTALLTEDGQVFTFGA  274

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L  +  RV Q++         HT A +++
Sbjct  275  GKHGQLGHNST---------QNELRPRLVTELTGI--RVTQVACGRR-----HTLAYVSD  318

Query  204  XGKLFAFGAGDKGQLG  157
             GK+F+FG+G +GQLG
Sbjct  319  LGKVFSFGSGKEGQLG  334


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 45/145 (31%), Positives = 66/145 (46%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCE-SAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   +G LG G        P++VE  S +  V ++ G   +  +S  G+ YS
Sbjct  160  KGGELFAWGQNLHGQLGIGRLFASIPTPQLVEHLSGVPLVQISAGKAHSMALSMSGNIYS  219

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  +   LG      DG+         P LV +L    ++V  ++   S     HT  L
Sbjct  220  WGRNDLGQLGLGHT--DGEE-------FPSLVEALDS--QKVEFLACGGS-----HTALL  263

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            TE G++F FGAG  GQLG   + N+
Sbjct  264  TEDGQVFTFGAGKHGQLGHNSTQNE  288



>ref|XP_001966082.1| GF19414 [Drosophila ananassae]
 gb|EDV38491.1| GF19414 [Drosophila ananassae]
Length=5087

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 51/136 (38%), Positives = 71/136 (52%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P+ VEA    K   VA G   +  +S  G+ Y++G
Sbjct  3179  DGKVFSWGEGEDGKLGHGNRTTLDKPRQVEALRAKKIRDVACGSSHSAAISSQGELYTWG  3238

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           ++  L P+LV +L     RVVQ++  +    +A T ALTE
Sbjct  3239  LGEYGRLGH---------GDNATQLKPKLVAAL--AGRRVVQVACGSR---DAQTLALTE  3284

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  3285  DGAVFSWGDGDFGKLG  3300


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 69/136 (51%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  + V  G   +  +++ G  Y++G
Sbjct  4435  DDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVIKVECGSQFSVALTKSGAVYTWG  4494

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH +V          ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  4495  KGDFHRLGHGSV---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  4538

Query  204   XGKLFAFGAGDKGQLG  157
              G+++ +G  D+GQLG
Sbjct  4539  SGEVYTWGDNDEGQLG  4554


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 35/137 (26%), Positives = 66/137 (48%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +    P  +E  S I  + +  G   +  ++  G+ +++
Sbjct  3284  EDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVIQIECGAQFSLALTRAGEVWTW  3343

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH         ++H  +  P+ +  L+    RV+ +++        H  A+T
Sbjct  3344  GKGDYYRLGHGG-------DQH--VRKPQPIGGLR--GRRVIHVAVG-----ALHCLAVT  3387

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3388  DSGQVYAWGDNDHGQQG  3404


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 62/136 (46%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G    WG G  G LGHGN      PK+VE    +    +A G   +  ++  G   ++G
Sbjct  4329  EGEVYAWGEGEDGKLGHGNRVSYDRPKLVEHLHGMSVADIACGSAHSAAITASGQVLTWG  4388

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4389  KGRYGRLGH---------GDSEDQLRPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4434

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4435  DDNVWSWGDGDYGKLG  4450


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG+ D    PK V A    K + +ATG       S+ G+ Y++
Sbjct  4486  KSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVYTW  4545

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV++L+   + +V+++       +AHT AL+
Sbjct  4546  GDNDEGQLG------DGTV---TAIQRPRLVSALQ--GKHIVKVTCG-----SAHTLALS  4589


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 41/131 (31%), Positives = 62/131 (47%), Gaps = 14/131 (11%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            +WG G    LGHG+    + P  + A        V  G   + V++  G+  ++G G  +
Sbjct  654  SWGAGEDHRLGHGDTHARAVPTKIAALEQHCVQSVFCGCTYSAVITCGGNLLTWGRGTYA  713

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH         N     L P LV +L +    VV ++L +    +AH+ ALT  G +F
Sbjct  714  RLGHG--------NSDDRCL-PTLVAALAE--HTVVDVALGSG---DAHSLALTSEGLVF  759

Query  189  AFGAGDKGQLG  157
            A+G GD G+LG
Sbjct  760  AWGDGDYGKLG  770


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 41/152 (27%), Positives = 64/152 (42%), Gaps = 20/152 (13%)
 Frame = -2

Query  552   CT---WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             CT   WG      LG         P   +  S ++ +H+A G  + F+VS++G  ++ G 
Sbjct  3074  CTVMVWGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQEGRVFACGE  3133

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G +  LG              N+  P  +  L Q   + V +          H  ALT  
Sbjct  3134  GTNGRLGLGVTY---------NVPLPHQLPVLHQYVVKKVAVHSGGK-----HALALTLD  3179

Query  201   GKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             GK+F++G G+ G+LG     N+T    P +VE
Sbjct  3180  GKVFSWGEGEDGKLG---HGNRTTLDKPRQVE  3208


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 39/135 (29%), Positives = 67/135 (50%), Gaps = 16/135 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G    WG G YG LG+GN +    P +VE+   ++ +    G   +  +S +G  Y++ 
Sbjct  755  EGLVFAWGDGDYGKLGNGNCNGSLQPILVESLPRVQRIF--AGSQYSVALSSEGQVYTW-  811

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G+++ LGH  V    Q         P LV+SL+   +R+V +++       AH  AL+ 
Sbjct  812  -GKATCLGHQLVERSVQ-----GCSVPRLVSSLQH--KRIVDMAVG-----VAHCLALSS  858

Query  204  XGKLFAFGAGDKGQL  160
             G++F +G  D  Q+
Sbjct  859  SGEVFGWGRNDCQQV  873


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 20/129 (16%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G Y  LGHGN D    P +V A +    V VA  +GD  +  ++ +G  +++
Sbjct  702  GNLLTWGRGTYARLGHGNSDDRCLPTLVAALAEHTVVDVALGSGDAHSLALTSEGLVFAW  761

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG      +G  N     L P LV SL +V +R+   S         ++ AL+
Sbjct  762  GDGDYGKLG------NGNCN---GSLQPILVESLPRV-QRIFAGS--------QYSVALS  803

Query  207  EXGKLFAFG  181
              G+++ +G
Sbjct  804  SEGQVYTWG  812



>ref|XP_005835300.1| hypothetical protein GUITHDRAFT_162457 [Guillardia theta CCMP2712]
 gb|EKX48320.1| hypothetical protein GUITHDRAFT_162457 [Guillardia theta CCMP2712]
Length=580

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 86/157 (55%), Gaps = 17/157 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG   +WGWG  G LG GN   ++ P VV+A SN +   VA G Y T VV++ G    +
Sbjct  87   EDGEVVSWGWGNEGQLGSGNAFDQTVPAVVKALSNHRVCGVACGYYHTAVVTDVGLVMCW  146

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G S  L        GQ +  S++L P  V++L    E++ QI+        AHT AL+
Sbjct  147  GKGNSGQL--------GQGDWTSSLL-PRTVSTL--YNEKIRQIACG-----MAHTLALS  190

Query  207  EXGKLFAFGAGDKGQLGVALSANQT-ERANPERVEVD  100
              G+++++GAG  GQLGV     +T + A P++V VD
Sbjct  191  VNGEIYSWGAGADGQLGVGKHQEETADVATPQKVRVD  227


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 70/138 (51%), Gaps = 5/138 (4%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVE-AXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            D R  +WG G  G LG G+ +   +P VV  +  N++  +VA G + T V+S++G+ ++ 
Sbjct  248  DCRLFSWGLGADGRLGLGDSESRFSPTVVRRSIENLRICYVAAGGHHTAVLSDNGEIFTC  307

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH        + +   +    L+  + Q+ ++     +  +   + HT  ++
Sbjct  308  GRGSYGQLGHGDADPQLTLKKARALRHGCLLLHIVQLRDK----KIIKAACGDTHTLVIS  363

Query  207  EXGKLFAFGAGDKGQLGV  154
              G++FA+GA + GQLG 
Sbjct  364  TAGEVFAWGAAEDGQLGT  381



>ref|XP_011354609.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Pteropus vampyrus]
Length=1029

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 50/143 (35%), Positives = 77/143 (54%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D +  P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  215  GNIYSWGRNDFGQLGLGHTDDKDFPSLIEALENQKVEFLACGGSHTALLTKDGLVFTFGA  274

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L +   RV Q++         HT A +++
Sbjct  275  GKYGQLGHNST---------QNELRPCLVTKLAE--NRVTQVACGRQ-----HTLAYVSD  318

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G++GQLG   + NQ
Sbjct  319  LGKVFSFGSGEEGQLGNGGTHNQ  341



>ref|XP_007074874.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Panthera tigris altaica]
Length=1000

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 50/143 (35%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D +  P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  185  GNIYSWGRNDFGQLGLGHTDGKDFPSLIEALDNQKVEFLACGGSHTALLTKDGLVFTFGA  244

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV Q++         HT A +++
Sbjct  245  GKHGQLGHNST---------QNELRPRLVTEL--AGNRVTQLACGRQ-----HTLAYVSD  288

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  289  LGKVFSFGSGKEGQLGNGGTHNQ  311



>ref|XP_002101897.1| GE17877 [Drosophila yakuba]
 gb|EDX03005.1| GE17877 [Drosophila yakuba]
Length=2660

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            DG+  +WG G  G LGHGN      P++VEA    K   VA G   +  +S  G+ Y++G
Sbjct  837  DGKVFSWGEGEDGKLGHGNRTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWG  896

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             GE   LGH           ++  L P+LVT+L     RVVQ++  +    +A T ALTE
Sbjct  897  LGEYGRLGH---------GDNATQLKPKLVTAL--AGRRVVQVACGSR---DAQTLALTE  942

Query  204  XGKLFAFGAGDKGQLG  157
             G +F++G GD G+LG
Sbjct  943  DGAVFSWGDGDFGKLG  958


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 68/131 (52%), Gaps = 16/131 (12%)
 Frame = -2

Query  549   TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
             +WG G YG LG G  D    P  +E+ + +  V V  G   +  +++ G  Y++G G+  
Sbjct  2013  SWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWGKGDFH  2072

Query  369   SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
              LGH +V          ++  P+ V +L+   ++++ I+ T S+    H  A ++ G+++
Sbjct  2073  RLGHGSV---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSDSGEVY  2116

Query  189   AFGAGDKGQLG  157
              +G  D+GQLG
Sbjct  2117  TWGDNDEGQLG  2127


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 65/137 (47%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +    P  +E  S I  V +  G   +  ++  G+ +++
Sbjct  942   EDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTW  1001

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH     D  V +      P+ +  L+    RV+ +++        H  A+T
Sbjct  1002  GKGDYYRLGHGG---DQHVRK------PQPIGGLR--GRRVIHVAVG-----ALHCLAVT  1045

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  1046  DAGQVYAWGDNDHGQQG  1062


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 63/136 (46%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G    WG G  G LGHGN      PK+VE  + +    +A G   +  ++  G   ++G
Sbjct  1902  EGEVYAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWG  1961

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  1962  KGRYGRLGH---------GDSEDQLRPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  2007

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  2008  DDNVWSWGDGDYGKLG  2023


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 57/128 (45%), Gaps = 17/128 (13%)
 Frame = -2

Query  489  PKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNIL  310
            P   +  S ++ +H+A G  + F+VS+DG  Y+ G G +  LG              N+ 
Sbjct  756  PTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACGEGTNGRLGLGVT---------HNVP  806

Query  309  SPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTE  130
             P  +  L Q   + V +          H  ALT  GK+F++G G+ G+LG     N+T 
Sbjct  807  LPHQLPVLHQYVVKKVAVH-----SGGKHALALTLDGKVFSWGEGEDGKLG---HGNRTT  858

Query  129  RANPERVE  106
               P  VE
Sbjct  859  LDKPRLVE  866


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG+ D    PK V A    K + +ATG       S+ G+ Y++
Sbjct  2059  KSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVYTW  2118

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV +L+   + +V+++       +AHT AL+
Sbjct  2119  GDNDEGQLG------DGTV---TAIQRPRLVAALQ--GKHIVKVTCG-----SAHTLALS  2162



>ref|XP_002058164.1| GJ15642 [Drosophila virilis]
 gb|EDW66272.1| GJ15642 [Drosophila virilis]
Length=5062

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P++VEA    K   +A G   +  +S  G+ Y++G
Sbjct  3150  DGKVFSWGEGEDGKLGHGNRSTLDKPRLVEALRAKKIRDIACGSSHSAAISSQGELYTWG  3209

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           ++  L P+LVT+L     RV+Q++  +    +A T ALTE
Sbjct  3210  LGEYGRLGH---------GDNATQLKPKLVTALH--GRRVIQVACGSR---DAQTLALTE  3255

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  3256  DGAVFSWGDGDFGKLG  3271


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 68/131 (52%), Gaps = 16/131 (12%)
 Frame = -2

Query  549   TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
             +WG G YG LG G  D    P  +E+ + +  + V  G   +  +++ G  Y++G G+  
Sbjct  4415  SWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVIKVECGSQFSVALTKSGAVYTWGKGDFH  4474

Query  369   SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
              LGH +V          ++  P+ V +L+   ++++ I+ T S+    H  A ++ G+++
Sbjct  4475  RLGHGSV---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSDAGEVY  4518

Query  189   AFGAGDKGQLG  157
              +G  D+GQLG
Sbjct  4519  TWGDNDEGQLG  4529


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 66/137 (48%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +  + P  +E  S I  + +  G   +  ++  G+ +++
Sbjct  3255  EDGAVFSWGDGDFGKLGRGGSEGSATPHEIERLSGIGVIQIECGAQFSLALTRAGEVWTW  3314

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH     D  V +      P+ +  L+    RV+ +++        H  A+T
Sbjct  3315  GKGDYYRLGHGG---DQHVRK------PQPIAGLR--GRRVIHVAVG-----ALHCLAVT  3358

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3359  DAGQVYAWGDNDHGQQG  3375


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 65/136 (48%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG    WG G  G LGHGN      PK++E  + +    +A G   +  ++  G   ++G
Sbjct  4304  DGEVYAWGEGEDGKLGHGNRMSYDRPKLLEHLNGMSVADIACGSAHSAAITASGHVLTWG  4363

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH     D +     + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4364  KGRYGRLGHG----DSE-----DQLRPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4409

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4410  DDNVWSWGDGDYGKLG  4425


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 64/129 (50%), Gaps = 20/129 (16%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G YG LGHGN D +  P +V A  + + + VA  +GD  T  ++  G  Y++
Sbjct  687  GNLYTWGRGTYGRLGHGNSDDQCMPAMVMALKDHQVLDVALGSGDAHTLCLTRGGLVYAW  746

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG      +G  N   + L P L+  L +V +RV   S          + ALT
Sbjct  747  GDGDYGKLG------NGSCN---SSLQPLLIECLPRV-QRVFAGS--------QFSLALT  788

Query  207  EXGKLFAFG  181
              G+L+++G
Sbjct  789  CEGQLYSWG  797


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 74/155 (48%), Gaps = 16/155 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            + G    WG G YG LG+G+ +    P ++E    ++ V    G   +  ++ +G  YS+
Sbjct  739  RGGLVYAWGDGDYGKLGNGSCNSSLQPLLIECLPRVQRVF--AGSQFSLALTCEGQLYSW  796

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
              G++S LGH  V  + Q         P L+TSL+   +R+V +++       AH  AL+
Sbjct  797  --GKASCLGHQLVERNVQ-----GCSVPRLITSLQH--KRIVHVAVG-----VAHCLALS  842

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEV  103
              G++F +G  D  Q+  A   ++     P +V +
Sbjct  843  SNGEIFGWGRNDNQQICPASVCSEPLLRQPIQVTL  877


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 61/148 (41%), Gaps = 17/148 (11%)
 Frame = -2

Query  549   TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
              WG      LG         P   +  S ++ +H+A G  + FVVS+DG  Y+ G G + 
Sbjct  3049  VWGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFVVSQDGKVYACGEGTNG  3108

Query  369   SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
              LG              N+  P  +  L Q   + V +          H  ALT  GK+F
Sbjct  3109  RLGLGVT---------HNVPLPHQLPVLHQYVVKKVAVH-----SGGKHALALTLDGKVF  3154

Query  189   AFGAGDKGQLGVALSANQTERANPERVE  106
             ++G G+ G+LG     N++    P  VE
Sbjct  3155  SWGEGEDGKLG---HGNRSTLDKPRLVE  3179


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG+ D    PK V A    K + +ATG       S+ G+ Y++
Sbjct  4461  KSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDAGEVYTW  4520

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV +L+   + +V+++       +AHT AL+
Sbjct  4521  GDNDEGQLG------DGTV---TAIQRPRLVAALQ--GKHIVKVTCG-----SAHTLALS  4564



>ref|XP_006910823.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Pteropus alecto]
Length=944

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 50/143 (35%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D +  P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  130  GNIYSWGRNDFGQLGLGHTDDKDFPSLIEALENQKVEFLACGGSHTALLTKDGLVFTFGA  189

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV Q++         HT A +++
Sbjct  190  GKYGQLGHNST---------QNELRPCLVTKL--AGNRVTQVACGRQ-----HTLAYVSD  233

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G++GQLG   + NQ
Sbjct  234  LGKVFSFGSGEEGQLGNGGTHNQ  256



>gb|ELK13686.1| Putative E3 ubiquitin-protein ligase HERC5 [Pteropus alecto]
Length=923

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 50/143 (35%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D +  P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  108  GNIYSWGRNDFGQLGLGHTDDKDFPSLIEALENQKVEFLACGGSHTALLTKDGLVFTFGA  167

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV Q++         HT A +++
Sbjct  168  GKYGQLGHNST---------QNELRPCLVTKL--AGNRVTQVACGRQ-----HTLAYVSD  211

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G++GQLG   + NQ
Sbjct  212  LGKVFSFGSGEEGQLGNGGTHNQ  234



>ref|XP_001995753.1| GH17927 [Drosophila grimshawi]
 gb|EDV95405.1| GH17927 [Drosophila grimshawi]
Length=4933

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P++VEA    K   +A G   +  +S  G+ Y++G
Sbjct  3017  DGKVFSWGEGEDGKLGHGNRTTLDKPRLVEALRAKKIRDIACGSSHSAAISSQGELYTWG  3076

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           ++  L P+LVT+L     RV+Q++  +    +A T ALTE
Sbjct  3077  LGEYGRLGH---------GDNATQLKPKLVTAL--CGSRVIQVACGSR---DAQTLALTE  3122

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  3123  DGAVFSWGDGDFGKLG  3138


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 66/137 (48%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +  + P  +E  S I  V +  G   +  ++  G+ +++
Sbjct  3122  EDGAVFSWGDGDFGKLGRGGSEGSATPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTW  3181

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH     D  V +      P+ +  L+    RV+ +++        H  A+T
Sbjct  3182  GKGDYYRLGHGG---DQHVRK------PQPIAGLR--GRRVIHVAVG-----ALHCLAVT  3225

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3226  DAGQVYAWGDNDHGQQG  3242


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 68/131 (52%), Gaps = 16/131 (12%)
 Frame = -2

Query  549   TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
             +WG G YG LG G  D    P  +E+ + +  + V  G   +  +++ G  Y++G G+  
Sbjct  4286  SWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVIKVECGSQFSVALTKSGAVYTWGKGDFH  4345

Query  369   SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
              LGH +V          ++  P+ V +L+   ++++ I+ T S+    H  A ++ G+++
Sbjct  4346  RLGHGSV---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSDAGEVY  4389

Query  189   AFGAGDKGQLG  157
              +G  D+GQLG
Sbjct  4390  TWGDNDEGQLG  4400


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 65/136 (48%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG    WG G  G LGHGN      PK++E  + +    +A G   +  ++  G   ++G
Sbjct  4175  DGEVYAWGEGEDGKLGHGNRLSYDRPKLLEHLNGMSVADIACGSAHSAAITASGHVLTWG  4234

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH     D +     + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4235  KGRYGRLGHG----DSE-----DQLRPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4280

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4281  DDNVWSWGDGDYGKLG  4296


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 57/128 (45%), Gaps = 17/128 (13%)
 Frame = -2

Query  489   PKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXDGQVNRHSNIL  310
             P   +  S ++ +H+A G  + FVVS+DG  ++ G G +  LG              N+ 
Sbjct  2936  PTFSQTISRLRPIHIAGGSKSLFVVSQDGKVFACGEGTNGRLGLGVT---------HNVP  2986

Query  309   SPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQLGVALSANQTE  130
              P  +  L Q   + V +          H  ALT  GK+F++G G+ G+LG     N+T 
Sbjct  2987  LPHQLPVLHQYVVKKVAVH-----SGGKHALALTLDGKVFSWGEGEDGKLG---HGNRTT  3038

Query  129   RANPERVE  106
                P  VE
Sbjct  3039  LDKPRLVE  3046


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 64/129 (50%), Gaps = 20/129 (16%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G YG LGHG  D +  P +V A  + + V VA  +GD  T  ++ +G  Y++
Sbjct  711  GNLYTWGRGNYGRLGHGISDDQCLPTMVMALKDHQVVDVALGSGDAHTLCLTNEGLVYAW  770

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG+ +          ++ L P L+  L +V +RV   S          + ALT
Sbjct  771  GDGDYGKLGNASC---------NSSLQPLLIECLPRV-QRVFAGS--------QFSLALT  812

Query  207  EXGKLFAFG  181
              G+L+++G
Sbjct  813  GEGQLYSWG  821


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG+ D    PK V A    K + +ATG       S+ G+ Y++
Sbjct  4332  KSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDAGEVYTW  4391

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV +L+   + +V+++       +AHT AL+
Sbjct  4392  GDNDEGQLG------DGTV---TAIQRPRLVAALQ--GKHIVKVTCG-----SAHTLALS  4435


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 66/134 (49%), Gaps = 17/134 (13%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVH-VATGDYTTFVVSEDGDAYSFGCGES  373
            +WG G    LGHG  DC S     +  S ++ V  V  G   +  ++  G+ Y++G G  
Sbjct  664  SWGTGDNRRLGHG--DCHSRELPTKIESLVRRVKSVYCGCSYSAAITLRGNLYTWGRGNY  721

Query  372  SSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKL  193
              LGH   + D Q         P +V +LK    +VV ++L +    +AHT  LT  G +
Sbjct  722  GRLGHG--ISDDQC-------LPTMVMALKD--HQVVDVALGSG---DAHTLCLTNEGLV  767

Query  192  FAFGAGDKGQLGVA  151
            +A+G GD G+LG A
Sbjct  768  YAWGDGDYGKLGNA  781



>ref|XP_004590688.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Ochotona princeps]
Length=868

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 54/141 (38%), Positives = 74/141 (52%), Gaps = 19/141 (13%)
 Frame = -2

Query  549  TWGWGR--YGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGE  376
            T+ WG+   G LG G+   E +P ++EA  N K   VA G   T ++++DG  ++FG G+
Sbjct  213  TYSWGKNDMGQLGLGHTQNEDSPCLIEALDNQKIEFVACGGSHTALLTQDGKLFTFGAGK  272

Query  375  SSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX-G  199
               LGHN+           N L P LVT L  V +RV QI       W  HT A     G
Sbjct  273  CGQLGHNS---------KRNELKPRLVTEL--VGKRVTQIVCGR---W--HTLAYAAGLG  316

Query  198  KLFAFGAGDKGQLGVALSANQ  136
            K+F+FG+G +GQLG   + NQ
Sbjct  317  KVFSFGSGKEGQLGSRGTQNQ  337


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 66/139 (47%), Gaps = 19/139 (14%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAP--KVVEAXSNIKXVHVATGDYTTFVVSEDGDAY  394
            K G    WG   +G LG G E C S P  ++VE  S +  + ++ G+  +  +S  G  Y
Sbjct  156  KGGELFAWGQNLHGQLGIG-EMCPSVPVPQIVEHLSGVPLLQISAGEAHSMALSMAGITY  214

Query  393  SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
            S+G  +   LG         +    N  SP L+ +L    +++  ++   S     HT  
Sbjct  215  SWGKNDMGQLG---------LGHTQNEDSPCLIEALDN--QKIEFVACGGS-----HTAL  258

Query  213  LTEXGKLFAFGAGDKGQLG  157
            LT+ GKLF FGAG  GQLG
Sbjct  259  LTQDGKLFTFGAGKCGQLG  277



>ref|XP_005639229.1| PREDICTED: E3 ISG15--protein ligase HERC5 isoform X2 [Canis lupus 
familiaris]
Length=927

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+ + E  P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  113  GNIYSWGRNDLGQLGLGHTNGEDFPSLIEALDNQKVEFLACGGSHTALLTKDGLVFTFGA  172

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV Q++      W  HT A +++
Sbjct  173  GKYGQLGHNST---------QNELRPRLVTEL--AGNRVTQVACGR---W--HTLAYVSD  216

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  217  LGKVFSFGSGKEGQLGNGGTHNQ  239


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFV-VSEDGDAYS  391
            KDG   T+G G+YG LGH +   E  P++V   +  +   VA G + T   VS+ G  +S
Sbjct  163  KDGLVFTFGAGKYGQLGHNSTQNELRPRLVTELAGNRVTQVACGRWHTLAYVSDLGKVFS  222

Query  390  FGCGESSSLG----HNAVV  346
            FG G+   LG    HN ++
Sbjct  223  FGSGKEGQLGNGGTHNQLI  241



>ref|XP_005639228.1| PREDICTED: E3 ISG15--protein ligase HERC5 isoform X1 [Canis lupus 
familiaris]
Length=930

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+ + E  P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  113  GNIYSWGRNDLGQLGLGHTNGEDFPSLIEALDNQKVEFLACGGSHTALLTKDGLVFTFGA  172

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV Q++      W  HT A +++
Sbjct  173  GKYGQLGHNST---------QNELRPRLVTEL--AGNRVTQVACGR---W--HTLAYVSD  216

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  217  LGKVFSFGSGKEGQLGNGGTHNQ  239


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFV-VSEDGDAYS  391
            KDG   T+G G+YG LGH +   E  P++V   +  +   VA G + T   VS+ G  +S
Sbjct  163  KDGLVFTFGAGKYGQLGHNSTQNELRPRLVTELAGNRVTQVACGRWHTLAYVSDLGKVFS  222

Query  390  FGCGESSSLG----HNAVV  346
            FG G+   LG    HN ++
Sbjct  223  FGSGKEGQLGNGGTHNQLI  241



>ref|XP_008705354.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Ursus maritimus]
Length=945

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 73/143 (51%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+ D E  P ++EA  + K   +A G   T +++ DG  ++FG 
Sbjct  131  GNVYSWGRNDLGQLGLGHTDGEDFPSLIEALDDQKVEFLACGGSHTALLTTDGLVFTFGA  190

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV QI+         HT A +++
Sbjct  191  GKYGQLGHNST---------QNELRPRLVTEL--AGNRVTQIACGRR-----HTLAYVSD  234

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  235  LGKVFSFGSGKEGQLGNGGTHNQ  257



>ref|XP_006727131.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Leptonychotes weddellii]
Length=1029

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 73/143 (51%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+ D E  P ++EA  N K   +A G   T +++ DG  ++FG 
Sbjct  215  GNIYSWGRNDLGQLGLGHTDGEDFPSLIEALDNQKVEFLACGGSHTALLTTDGLVFTFGA  274

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGH++           N L P LVT L     RV QI+         HT A +++
Sbjct  275  GKYGQLGHSST---------QNELRPRLVTEL--AGNRVTQIACGRR-----HTLAYVSD  318

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  319  LGKVFSFGSGKEGQLGNGGTHNQ  341



>ref|XP_004665453.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Jaculus jaculus]
Length=968

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 76/140 (54%), Gaps = 19/140 (14%)
 Frame = -2

Query  546  WGWGRYGC--LGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGES  373
            + WGR GC  LG G+ + + +P ++EA  N +   ++ G   T ++++DG  ++FG G+ 
Sbjct  157  YSWGRNGCGQLGLGHTEKQDSPSLIEALDNQRIEFLSCGGSHTALLTQDGLLFTFGAGKY  216

Query  372  SSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTEXGK  196
              LGHN+           N L P LVT L  +  RV QI+      W  HT A +++ GK
Sbjct  217  GQLGHNS---------KQNELKPCLVTKL--IGNRVTQIACGR---W--HTLAYVSDLGK  260

Query  195  LFAFGAGDKGQLGVALSANQ  136
            +F+FG G +GQLG     NQ
Sbjct  261  VFSFGFGKQGQLGNCGKHNQ  280



>ref|XP_004348355.1| regulator of chromosome condensation (RCC1) repeat domain containing 
protein [Acanthamoeba castellanii str. Neff]
 gb|ELR21981.1| regulator of chromosome condensation (RCC1) repeat domain containing 
protein [Acanthamoeba castellanii str. Neff]
Length=447

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 79/142 (56%), Gaps = 21/142 (15%)
 Frame = -2

Query  567  KDGRXCTWGWGRY-----GCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDG  403
            KDG   ++G+G       G LGHG++  +  P+ V + S ++ V VA G + + V+S+ G
Sbjct  126  KDGGLLSFGYGSANVVVDGRLGHGDQRTQMIPRPVLSLSGVRIVKVAAGAHHSLVLSDQG  185

Query  402  DAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAH  223
            + +SFG G   SLGH      G   R    L P+L++SL++  E+VV I+       +AH
Sbjct  186  NVFSFGVGIDGSLGH------GDQARQ---LVPKLISSLQR--EKVVDIA-----AGSAH  229

Query  222  TFALTEXGKLFAFGAGDKGQLG  157
            +  + E G +++FG G +G LG
Sbjct  230  SLVVAESGDVYSFGLGSEGALG  251


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 76/154 (49%), Gaps = 12/154 (8%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   ++G G  G LGHG++  +  PK++ +    K V +A G   + VV+E GD YSFG 
Sbjct  185  GNVFSFGVGIDGSLGHGDQARQLVPKLISSLQREKVVDIAAGSAHSLVVAESGDVYSFGL  244

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G   +LGH     D  ++     L P+ +    Q     V    ++S+  +   + L + 
Sbjct  245  GSEGALGHG----DTDMS-----LVPKKIEHFVQRPAVKVAAGGSHSLVLSK-LYVLEQE  294

Query  201  GKLFAFGAGDKGQLGVALSANQTERANPERVEVD  100
            G++ +FG    GQLG+   +     A+P +V+V+
Sbjct  295  GRVLSFGQNSYGQLGLGHFSRMI--ASPAQVQVE  326


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 72/147 (49%), Gaps = 18/147 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGN-EDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            ++GR  ++G   YG LG G+     ++P  V+  +    V +  G + + V++ DG  YS
Sbjct  293  QEGRVLSFGQNSYGQLGLGHFSRMIASPAQVQVEA--AAVEIEAGAHHSLVLTNDGRVYS  350

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            FG  +   LGH   + D           P L+ SL++  ER+V ++  N+      +  L
Sbjct  351  FGLAQHGQLGHGNDLRDNP--------EPTLIQSLER--ERIVDVAAGNNF-----SLVL  395

Query  210  TEXGKLFAFGAGDKGQLGVALSANQTE  130
            +  G +F+FG G  G+LG    +N T+
Sbjct  396  SAEGTVFSFGCGKNGRLGKGDESNATQ  422


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 63/130 (48%), Gaps = 15/130 (12%)
 Frame = -2

Query  519  GHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSSLGHNAVVXD  340
            GHG+   +  PK VEA +  +   V+ G Y + V ++DG   SFG G ++      VV D
Sbjct  90   GHGDHVDKLRPKCVEALARERVRDVSAGLYHSLVATKDGGLLSFGYGSAN------VVVD  143

Query  339  GQVNR--HSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKG  166
            G++        + P  V SL  V  R+V+++         H+  L++ G +F+FG G  G
Sbjct  144  GRLGHGDQRTQMIPRPVLSLSGV--RIVKVA-----AGAHHSLVLSDQGNVFSFGVGIDG  196

Query  165  QLGVALSANQ  136
             LG    A Q
Sbjct  197  SLGHGDQARQ  206


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 64/157 (41%), Gaps = 27/157 (17%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVS------ED  406
            + G   ++G G  G LGHG+ D    PK +E       V VA G   + V+S      ++
Sbjct  235  ESGDVYSFGLGSEGALGHGDTDMSLVPKKIEHFVQRPAVKVAAGGSHSLVLSKLYVLEQE  294

Query  405  GDAYSFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNA  226
            G   SFG      LG       G  +R   I SP  V    QV    V+I          
Sbjct  295  GRVLSFGQNSYGQLGL------GHFSR--MIASPAQV----QVEAAAVEIE-----AGAH  337

Query  225  HTFALTEXGKLFAFGAGDKGQLGVALSANQTERANPE  115
            H+  LT  G++++FG    GQLG         R NPE
Sbjct  338  HSLVLTNDGRVYSFGLAQHGQLG----HGNDLRDNPE  370



>ref|XP_011021217.1| PREDICTED: ultraviolet-B receptor UVR8 [Populus euphratica]
Length=392

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 76/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  +++DG+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPITVQGLSGLTLVDIAAGGWHSTALTDDGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L  V E +VQ+S   +     H+ ALT
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMVPQRVNLL--VGEEIVQVSCGGT-----HSVALT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G+++ FG GD G+LG      +     P  V +D+  P
Sbjct  320  RDGRMYTFGRGDHGRLGY---GRKVTTGQPMEVPIDIPPP  356


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 68/153 (44%), Gaps = 17/153 (11%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DG+  TWGW + G LGH  E   E+ P  V+A +N+  V  A G +    V + G AY++
Sbjct  56   DGKLFTWGWNQRGTLGHPPETKTENIPSQVKALANVNIVQAAIGGWHCLAVDDQGRAYAW  115

Query  387  GCGESSSLGHNAVVXD--GQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
            G  E    G      D  G+  R   ++     ++L      V Q++   +     H+  
Sbjct  116  GGNEYGQCGEEPERKDDTGRPLRRDIVIPQRCASNLV-----VRQVAAGGT-----HSVV  165

Query  213  LTEXGKLFAFG----AGDKGQLGVALSANQTER  127
            LT  G ++++G     GD  Q+ V +     ER
Sbjct  166  LTREGHVWSWGQPWPPGDIKQISVPVRVQGLER  198



>ref|WP_042122221.1| hypothetical protein, partial [Paenibacillus senegalensis]
Length=359

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 83/158 (53%), Gaps = 25/158 (16%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G+G +G LGHGN D +  PK +E  S+I+   +A GD+ +  +++ GD YSF
Sbjct  63   KSGDVYSFGFGLFGRLGHGNTDSQLEPKKIEGLSDIQA--IAAGDFHSLALTKSGDVYSF  120

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G +S LGH      G     S   +P+ + SL  V                 H+ ALT
Sbjct  121  GNG-TSGLGH------GNTEDQS---TPKKIESLSDVQAIAA---------GGNHSLALT  161

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            + G +++FG G  G+LG   + +Q E   P+++E DLS
Sbjct  162  KSGDVYSFGFGLFGRLGHGDTDSQLE---PKKIE-DLS  195


 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 77/154 (50%), Gaps = 23/154 (15%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G+G +G LGHG+ D +  PK +E  S+I+   +A G   +  +++ GD YSF
Sbjct  162  KSGDVYSFGFGLFGRLGHGDTDSQLEPKKIEDLSDIQA--IAAGGNHSLALTKSGDVYSF  219

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH             N L+P+ +  L  +       +         H+ ALT
Sbjct  220  GWGLHGQLGHGDT---------ENQLTPKKIEDLSDIQAVAAGAN---------HSLALT  261

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            + G++++FG G+ GQLG     +  ++  P+++E
Sbjct  262  KSGEVYSFGRGNTGQLG---HGDTDDQLTPKKIE  292


 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 78/154 (51%), Gaps = 24/154 (16%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++GWG +G LGHG+ + +  PK +E  S+I+   VA G   +  +++ G+ YSF
Sbjct  212  KSGDVYSFGWGLHGQLGHGDTENQLTPKKIEDLSDIQA--VAAGANHSLALTKSGEVYSF  269

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G +  LGH             + L+P+ +  LK +               + H+ ALT
Sbjct  270  GRGNTGQLGHGDT---------DDQLTPKKIEGLKDIQAIAA---------GDFHSLALT  311

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            + G +++FG G  G LG   +ANQ E   P+++E
Sbjct  312  KSGDVYSFGNGTSG-LGHGDTANQLE---PKKIE  341


 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 72/148 (49%), Gaps = 24/148 (16%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            ++G G YG LGHG+   + APK +E  S+I+   +A G   +  +++ GD YSFG G   
Sbjct  19   SFGMGMYGKLGHGDTANQLAPKKIEGLSDIQA--IAAGTNHSLALTKSGDVYSFGFGLFG  76

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH     D Q       L P+ +  L  +               + H+ ALT+ G ++
Sbjct  77   RLGHGNT--DSQ-------LEPKKIEGLSDIQAIAA---------GDFHSLALTKSGDVY  118

Query  189  AFGAGDKGQLGVALSANQTERANPERVE  106
            +FG G  G LG     N  +++ P+++E
Sbjct  119  SFGNGTSG-LG---HGNTEDQSTPKKIE  142



>ref|XP_005781906.1| E3 ubiquitin ligase [Emiliania huxleyi CCMP1516]
 gb|EOD29477.1| E3 ubiquitin ligase [Emiliania huxleyi CCMP1516]
Length=471

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 19/153 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            DGR  +WG+GR G LGHG+E  +  PK VEA +  + + V  G Y +  ++ DG  +S+G
Sbjct  224  DGRVWSWGYGRDGRLGHGDEQRQLLPKRVEAFAGQRVIVVTAGAYHSLALTADGSVWSWG  283

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G S  LGH      G   R    L P+ V +     +RVV +S         H+ A+T 
Sbjct  284  EGASGKLGH------GDQQRQ---LLPKKVEAF--AGQRVVAVSAGTY-----HSLAITA  327

Query  204  XGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
               ++++G G+ GQLG     +Q  +  P+++E
Sbjct  328  DSAVWSWGEGNSGQLG---HGDQQRQLLPKKIE  357


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 66/136 (49%), Gaps = 16/136 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            D    +WG G  G LGHG++  +  PK +EA +  + V V+ G Y +  ++ DG  +S+G
Sbjct  328  DSAVWSWGEGNSGQLGHGDQQRQLLPKKIEAFAGQRVVTVSAGVYHSLAIAADGAVWSWG  387

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G    LGH      G   R    L P+ + +   + + VV +S         H+ A+T 
Sbjct  388  EGSYGRLGH------GNEQRQ---LPPKKIEAF--IGQHVVAVSAGAY-----HSLAITA  431

Query  204  XGKLFAFGAGDKGQLG  157
             G +F +G G+ G LG
Sbjct  432  DGAVFTWGEGEDGCLG  447


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            DG   +WG G YG LGHGNE  +  PK +EA      V V+ G Y +  ++ DG  +++G
Sbjct  380  DGAVWSWGEGSYGRLGHGNEQRQLPPKKIEAFIGQHVVAVSAGAYHSLAITADGAVFTWG  439

Query  384  CGESSSLGH  358
             GE   LGH
Sbjct  440  EGEDGCLGH  448



>ref|XP_008209737.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 isoform X3 [Nasonia 
vitripennis]
Length=4721

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 77/137 (56%), Gaps = 14/137 (10%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG+  +WG G  G LGHGN      P+++EA  + +   +A G   +  ++ +G+ Y++
Sbjct  2995  QDGKVFSWGEGEDGKLGHGNRVSLDKPRLIEALKSKRIRDIACGSGHSAAIASNGELYTW  3054

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G GE   LGH      G    H   L P+LV +L  V +RV+Q++  +    +A T ALT
Sbjct  3055  GLGEYGRLGH------GDTTTH---LKPKLVDAL--VGQRVIQVACGSR---DAQTMALT  3100

Query  207   EXGKLFAFGAGDKGQLG  157
             E G ++++G GD G+LG
Sbjct  3101  EDGSVYSWGDGDFGKLG  3117


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 69/136 (51%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G   +WG G  G LGHGN      PK++EA    + V +A G + +  +S  G  Y++G
Sbjct  3968  EGHVYSWGEGDDGKLGHGNRITYDRPKLIEALLGTEIVDIACGGHHSAAISSAGWLYTWG  4027

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH     D Q       L P +VT+L+    +V+ ++  +    +A T  +T+
Sbjct  4028  KGRYGRLGHGD--SDDQ-------LKPTVVTALQ--GYKVIDVACGSG---DAQTLCVTD  4073

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4074  DDNVWSWGDGDYGKLG  4089


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  V V  G   +  ++  G  Y++G
Sbjct  4074  DDNVWSWGDGDYGKLGRGGSDGCKVPMKIESLAGLGVVKVECGSQFSVALTRSGAVYTWG  4133

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH     D  V R      P  V++L+   +++V I+ T S+    H  A ++
Sbjct  4134  KGDYHRLGHGT---DDHVRR------PRKVSALQ--GKKIVSIA-TGSL----HCVACSD  4177

Query  204   XGKLFAFGAGDKGQLG  157
              G+++ +G  D+GQLG
Sbjct  4178  KGEVYTWGDNDEGQLG  4193


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 63/137 (46%), Gaps = 18/137 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G YG LGHG  D  S P VV A +     HVA  +GD  T  V+  G  +S+
Sbjct  572  GELLTWGRGSYGRLGHGICDDISIPTVVTALNGHTVTHVACGSGDSQTLCVTNSGIVFSW  631

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG      DG              + L ++ ++++  ++         + ALT
Sbjct  632  GDGDYGKLGRGG--SDG--------------SKLPKIVDKLLDQNVVKVFCGGQFSAALT  675

Query  207  EXGKLFAFGAGDKGQLG  157
              G+++ +G GD  +LG
Sbjct  676  AHGEVYTWGKGDHYRLG  692


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 65/147 (44%), Gaps = 17/147 (12%)
 Frame = -2

Query  546   WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
             WG      LG         P   E  S +K +H+A G  T FVVS++G  Y+ G G +  
Sbjct  2896  WGLNDKDQLGGLKGSKIKLPVHSEVLSKLKPIHIAGGSKTLFVVSQEGKLYACGEGTNGR  2955

Query  366   LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
             LG         +  ++N+  P+ +  L Q   + V +          H  ALT+ GK+F+
Sbjct  2956  LG---------LGDNNNVGEPKPIPFLSQYIIKKVAVH-----SGGKHALALTQDGKVFS  3001

Query  186   FGAGDKGQLGVALSANQTERANPERVE  106
             +G G+ G+LG     N+     P  +E
Sbjct  3002  WGEGEDGKLG---HGNRVSLDKPRLIE  3025


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 62/140 (44%), Gaps = 16/140 (11%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            +WG G YG LG G  D    PK+V+   +   V V  G   +  ++  G+ Y++G G+  
Sbjct  630  SWGDGDYGKLGRGGSDGSKLPKIVDKLLDQNVVKVFCGGQFSAALTAHGEVYTWGKGDHY  689

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH             ++  P+LV  L+    R + +        N H  A+TE   ++
Sbjct  690  RLGH---------GNEEHVRFPKLVEGLRNKKVRDLSVG-------NLHILAITEDQLVY  733

Query  189  AFGAGDKGQLGVALSANQTE  130
             +G  D  Q+  +L A  +E
Sbjct  734  GWGRNDACQIDPSLGAVVSE  753


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 68/137 (50%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  D   +P  V+  + +  V V  G   +  +++ G+ +++
Sbjct  3101  EDGSVYSWGDGDFGKLGRGGSDGCYSPLPVDRLNGLGVVQVECGAQFSLALTKYGEVWTW  3160

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH     D  V R      P LV  L+   ++VV +++        H  A+T
Sbjct  3161  GKGDYFRLGHG---NDHHVRR------PTLVEGLR--GKKVVHVAVG-----ALHCLAVT  3204

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3205  DAGQVYAWGDNDHGQQG  3221


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 64/153 (42%), Gaps = 21/153 (14%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G Y  LGHGN+     P +VE     K VHVA G      V++ G  Y++
Sbjct  3153  KYGEVWTWGKGDYFRLGHGNDHHVRRPTLVEGLRGKKVVHVAVGALHCLAVTDAGQVYAW  3212

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +    G+ + +    VNR      P LV +L+      V    ++SI W      LT
Sbjct  3213  GDNDHGQQGNGSTM----VNR-----KPSLVHNLEDAKVNRVACGSSHSIAW-----VLT  3258

Query  207   EXGKL-------FAFGAGDKGQLGVALSANQTE  130
             +   L       F       GQ  +  + ++TE
Sbjct  3259  DQPTLGNQEPVTFPTAKDPLGQATLGFTQDKTE  3291



>ref|XP_008209736.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 isoform X2 [Nasonia 
vitripennis]
Length=4731

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 77/137 (56%), Gaps = 14/137 (10%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG+  +WG G  G LGHGN      P+++EA  + +   +A G   +  ++ +G+ Y++
Sbjct  3005  QDGKVFSWGEGEDGKLGHGNRVSLDKPRLIEALKSKRIRDIACGSGHSAAIASNGELYTW  3064

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G GE   LGH      G    H   L P+LV +L  V +RV+Q++  +    +A T ALT
Sbjct  3065  GLGEYGRLGH------GDTTTH---LKPKLVDAL--VGQRVIQVACGSR---DAQTMALT  3110

Query  207   EXGKLFAFGAGDKGQLG  157
             E G ++++G GD G+LG
Sbjct  3111  EDGSVYSWGDGDFGKLG  3127


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 69/136 (51%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G   +WG G  G LGHGN      PK++EA    + V +A G + +  +S  G  Y++G
Sbjct  3978  EGHVYSWGEGDDGKLGHGNRITYDRPKLIEALLGTEIVDIACGGHHSAAISSAGWLYTWG  4037

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH     D Q       L P +VT+L+    +V+ ++  +    +A T  +T+
Sbjct  4038  KGRYGRLGHGD--SDDQ-------LKPTVVTALQ--GYKVIDVACGSG---DAQTLCVTD  4083

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4084  DDNVWSWGDGDYGKLG  4099


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  V V  G   +  ++  G  Y++G
Sbjct  4084  DDNVWSWGDGDYGKLGRGGSDGCKVPMKIESLAGLGVVKVECGSQFSVALTRSGAVYTWG  4143

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH     D  V R      P  V++L+   +++V I+ T S+    H  A ++
Sbjct  4144  KGDYHRLGHGT---DDHVRR------PRKVSALQ--GKKIVSIA-TGSL----HCVACSD  4187

Query  204   XGKLFAFGAGDKGQLG  157
              G+++ +G  D+GQLG
Sbjct  4188  KGEVYTWGDNDEGQLG  4203


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 65/147 (44%), Gaps = 17/147 (12%)
 Frame = -2

Query  546   WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
             WG      LG         P   E  S +K +H+A G  T FVVS++G  Y+ G G +  
Sbjct  2906  WGLNDKDQLGGLKGSKIKLPVHSEVLSKLKPIHIAGGSKTLFVVSQEGKLYACGEGTNGR  2965

Query  366   LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
             LG         +  ++N+  P+ +  L Q   + V +          H  ALT+ GK+F+
Sbjct  2966  LG---------LGDNNNVGEPKPIPFLSQYIIKKVAVH-----SGGKHALALTQDGKVFS  3011

Query  186   FGAGDKGQLGVALSANQTERANPERVE  106
             +G G+ G+LG     N+     P  +E
Sbjct  3012  WGEGEDGKLG---HGNRVSLDKPRLIE  3035


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 63/137 (46%), Gaps = 18/137 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G YG LGHG  D  S P VV A +     HVA  +GD  T  V+  G  +S+
Sbjct  572  GELLTWGRGSYGRLGHGICDDISIPTVVTALNGHTVTHVACGSGDSQTLCVTNSGIVFSW  631

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG      DG              + L ++ ++++  ++         + ALT
Sbjct  632  GDGDYGKLGRGG--SDG--------------SKLPKIVDKLLDQNVVKVFCGGQFSAALT  675

Query  207  EXGKLFAFGAGDKGQLG  157
              G+++ +G GD  +LG
Sbjct  676  AHGEVYTWGKGDHYRLG  692


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 62/140 (44%), Gaps = 16/140 (11%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            +WG G YG LG G  D    PK+V+   +   V V  G   +  ++  G+ Y++G G+  
Sbjct  630  SWGDGDYGKLGRGGSDGSKLPKIVDKLLDQNVVKVFCGGQFSAALTAHGEVYTWGKGDHY  689

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH             ++  P+LV  L+    R + +        N H  A+TE   ++
Sbjct  690  RLGH---------GNEEHVRFPKLVEGLRNKKVRDLSVG-------NLHILAITEDQLVY  733

Query  189  AFGAGDKGQLGVALSANQTE  130
             +G  D  Q+  +L A  +E
Sbjct  734  GWGRNDACQIDPSLGAVVSE  753


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 68/137 (50%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  D   +P  V+  + +  V V  G   +  +++ G+ +++
Sbjct  3111  EDGSVYSWGDGDFGKLGRGGSDGCYSPLPVDRLNGLGVVQVECGAQFSLALTKYGEVWTW  3170

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH     D  V R      P LV  L+   ++VV +++        H  A+T
Sbjct  3171  GKGDYFRLGHG---NDHHVRR------PTLVEGLR--GKKVVHVAVG-----ALHCLAVT  3214

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3215  DAGQVYAWGDNDHGQQG  3231


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 64/153 (42%), Gaps = 21/153 (14%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G Y  LGHGN+     P +VE     K VHVA G      V++ G  Y++
Sbjct  3163  KYGEVWTWGKGDYFRLGHGNDHHVRRPTLVEGLRGKKVVHVAVGALHCLAVTDAGQVYAW  3222

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +    G+ + +    VNR      P LV +L+      V    ++SI W      LT
Sbjct  3223  GDNDHGQQGNGSTM----VNR-----KPSLVHNLEDAKVNRVACGSSHSIAW-----VLT  3268

Query  207   EXGKL-------FAFGAGDKGQLGVALSANQTE  130
             +   L       F       GQ  +  + ++TE
Sbjct  3269  DQPTLGNQEPVTFPTAKDPLGQATLGFTQDKTE  3301



>ref|XP_008209733.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 isoform X1 [Nasonia 
vitripennis]
 ref|XP_008209734.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 isoform X1 [Nasonia 
vitripennis]
 ref|XP_008209735.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 isoform X1 [Nasonia 
vitripennis]
Length=4754

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 77/137 (56%), Gaps = 14/137 (10%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG+  +WG G  G LGHGN      P+++EA  + +   +A G   +  ++ +G+ Y++
Sbjct  3028  QDGKVFSWGEGEDGKLGHGNRVSLDKPRLIEALKSKRIRDIACGSGHSAAIASNGELYTW  3087

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G GE   LGH      G    H   L P+LV +L  V +RV+Q++  +    +A T ALT
Sbjct  3088  GLGEYGRLGH------GDTTTH---LKPKLVDAL--VGQRVIQVACGSR---DAQTMALT  3133

Query  207   EXGKLFAFGAGDKGQLG  157
             E G ++++G GD G+LG
Sbjct  3134  EDGSVYSWGDGDFGKLG  3150


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 69/136 (51%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G   +WG G  G LGHGN      PK++EA    + V +A G + +  +S  G  Y++G
Sbjct  4001  EGHVYSWGEGDDGKLGHGNRITYDRPKLIEALLGTEIVDIACGGHHSAAISSAGWLYTWG  4060

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH     D Q       L P +VT+L+    +V+ ++  +    +A T  +T+
Sbjct  4061  KGRYGRLGHGD--SDDQ-------LKPTVVTALQ--GYKVIDVACGSG---DAQTLCVTD  4106

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4107  DDNVWSWGDGDYGKLG  4122


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  V V  G   +  ++  G  Y++G
Sbjct  4107  DDNVWSWGDGDYGKLGRGGSDGCKVPMKIESLAGLGVVKVECGSQFSVALTRSGAVYTWG  4166

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH     D  V R      P  V++L+   +++V I+ T S+    H  A ++
Sbjct  4167  KGDYHRLGHGT---DDHVRR------PRKVSALQ--GKKIVSIA-TGSL----HCVACSD  4210

Query  204   XGKLFAFGAGDKGQLG  157
              G+++ +G  D+GQLG
Sbjct  4211  KGEVYTWGDNDEGQLG  4226


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 63/137 (46%), Gaps = 18/137 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G YG LGHG  D  S P VV A +     HVA  +GD  T  V+  G  +S+
Sbjct  572  GELLTWGRGSYGRLGHGICDDISIPTVVTALNGHTVTHVACGSGDSQTLCVTNSGIVFSW  631

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG      DG              + L ++ ++++  ++         + ALT
Sbjct  632  GDGDYGKLGRGG--SDG--------------SKLPKIVDKLLDQNVVKVFCGGQFSAALT  675

Query  207  EXGKLFAFGAGDKGQLG  157
              G+++ +G GD  +LG
Sbjct  676  AHGEVYTWGKGDHYRLG  692


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 65/147 (44%), Gaps = 17/147 (12%)
 Frame = -2

Query  546   WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
             WG      LG         P   E  S +K +H+A G  T FVVS++G  Y+ G G +  
Sbjct  2929  WGLNDKDQLGGLKGSKIKLPVHSEVLSKLKPIHIAGGSKTLFVVSQEGKLYACGEGTNGR  2988

Query  366   LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
             LG         +  ++N+  P+ +  L Q   + V +          H  ALT+ GK+F+
Sbjct  2989  LG---------LGDNNNVGEPKPIPFLSQYIIKKVAVH-----SGGKHALALTQDGKVFS  3034

Query  186   FGAGDKGQLGVALSANQTERANPERVE  106
             +G G+ G+LG     N+     P  +E
Sbjct  3035  WGEGEDGKLG---HGNRVSLDKPRLIE  3058


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 62/140 (44%), Gaps = 16/140 (11%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            +WG G YG LG G  D    PK+V+   +   V V  G   +  ++  G+ Y++G G+  
Sbjct  630  SWGDGDYGKLGRGGSDGSKLPKIVDKLLDQNVVKVFCGGQFSAALTAHGEVYTWGKGDHY  689

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH             ++  P+LV  L+    R + +        N H  A+TE   ++
Sbjct  690  RLGH---------GNEEHVRFPKLVEGLRNKKVRDLSVG-------NLHILAITEDQLVY  733

Query  189  AFGAGDKGQLGVALSANQTE  130
             +G  D  Q+  +L A  +E
Sbjct  734  GWGRNDACQIDPSLGAVVSE  753


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 68/137 (50%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  D   +P  V+  + +  V V  G   +  +++ G+ +++
Sbjct  3134  EDGSVYSWGDGDFGKLGRGGSDGCYSPLPVDRLNGLGVVQVECGAQFSLALTKYGEVWTW  3193

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH     D  V R      P LV  L+   ++VV +++        H  A+T
Sbjct  3194  GKGDYFRLGHG---NDHHVRR------PTLVEGLR--GKKVVHVAVG-----ALHCLAVT  3237

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3238  DAGQVYAWGDNDHGQQG  3254


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 64/153 (42%), Gaps = 21/153 (14%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G Y  LGHGN+     P +VE     K VHVA G      V++ G  Y++
Sbjct  3186  KYGEVWTWGKGDYFRLGHGNDHHVRRPTLVEGLRGKKVVHVAVGALHCLAVTDAGQVYAW  3245

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +    G+ + +    VNR      P LV +L+      V    ++SI W      LT
Sbjct  3246  GDNDHGQQGNGSTM----VNR-----KPSLVHNLEDAKVNRVACGSSHSIAW-----VLT  3291

Query  207   EXGKL-------FAFGAGDKGQLGVALSANQTE  130
             +   L       F       GQ  +  + ++TE
Sbjct  3292  DQPTLGNQEPVTFPTAKDPLGQATLGFTQDKTE  3324



>ref|XP_011230877.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Ailuropoda melanoleuca]
Length=945

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+ D E  P ++E   N +   +A G   T +++ DG  ++FG 
Sbjct  131  GNVYSWGRNDLGQLGLGHTDGEDFPSLIETLDNQQVEFLACGGSHTALLTTDGLVFTFGA  190

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV QI+         HT A +++
Sbjct  191  GKYGQLGHNST---------QNELRPRLVTEL--AGNRVTQIACGRR-----HTLAYVSD  234

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  235  LGKVFSFGSGKEGQLGNGGTHNQ  257



>ref|XP_006373448.1| regulator of chromosome condensation family protein [Populus 
trichocarpa]
 gb|ERP51245.1| regulator of chromosome condensation family protein [Populus 
trichocarpa]
Length=392

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 76/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  +++DG+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPITVQGLSGLTLVDIAAGGWHSTALTDDGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L  V E +VQ+S   +     H+ ALT
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMVPQRVNLL--VGEDIVQVSCGGT-----HSVALT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G+++ FG GD G+LG      +     P  V +D+  P
Sbjct  320  RDGRMYTFGRGDHGRLGY---GRKVTTGQPMEVPIDIPPP  356


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 67/153 (44%), Gaps = 17/153 (11%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DG+  TWGW + G LGH  E   E+ P  V+A +N+  V  A G +    V + G AY++
Sbjct  56   DGKLFTWGWNQRGTLGHPPETKTENIPSQVKALANVNIVQAAIGGWHCLAVDDQGRAYAW  115

Query  387  GCGESSSLGHNAVVXD--GQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
            G  E    G      D  G+  R   ++     + L      V Q++   +     H+  
Sbjct  116  GGNEYGQCGEEPERKDDTGRPLRRDIVIPQRCASKLV-----VRQVAAGGT-----HSVV  165

Query  213  LTEXGKLFAFG----AGDKGQLGVALSANQTER  127
            LT  G ++++G     GD  Q+ V +     ER
Sbjct  166  LTREGHVWSWGQPWPPGDIKQISVPVRVQGLER  198



>ref|XP_002064396.1| GK20144 [Drosophila willistoni]
 gb|EDW75382.1| GK20144 [Drosophila willistoni]
Length=4996

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P++VEA    K   VA G   +  +S  G+ Y++G
Sbjct  3132  DGKVFSWGEGEDGKLGHGNRTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWG  3191

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           ++  L P+ VT+L     RV+Q++  +    +A T ALTE
Sbjct  3192  LGEYGRLGH---------GDNATQLKPKQVTAL--AGRRVIQVACGSR---DAQTLALTE  3237

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  3238  DGAVFSWGDGDFGKLG  3253


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 64/130 (49%), Gaps = 22/130 (17%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G YG LGHGN D +  P +V A +  + + VA  +GD  +  ++ +G  Y++
Sbjct  685  GNLYTWGRGTYGRLGHGNSDDQCVPAIVMALAEYEIIDVALGSGDAHSLCLTSEGLVYAW  744

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAH-TFAL  211
            G G+   LG      +G  N   + L P LV +L +V            I+  A  + AL
Sbjct  745  GDGDYGKLG------NGNCN---SSLQPILVETLPRV----------QRIFAGAQSSMAL  785

Query  210  TEXGKLFAFG  181
            T  G L+++G
Sbjct  786  TTEGHLYSWG  795


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 68/131 (52%), Gaps = 16/131 (12%)
 Frame = -2

Query  549   TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
             +WG G YG LG G  D    P  +E+ + +  + V  G   +  +++ G  Y++G G+  
Sbjct  4362  SWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVIKVECGSQFSVALTKSGAVYTWGKGDFH  4421

Query  369   SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
              LGH +V          ++  P+ V +L+   ++++ I+ T S+    H  A ++ G+++
Sbjct  4422  RLGHGSV---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSDAGEVY  4465

Query  189   AFGAGDKGQLG  157
              +G  D+GQLG
Sbjct  4466  TWGDNDEGQLG  4476


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 66/137 (48%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +  + P  +E  S I  + +  G   +  ++  G+ +++
Sbjct  3237  EDGAVFSWGDGDFGKLGRGGSEGSATPHEIERLSGIGVIQIECGAQFSLALTRAGEVWTW  3296

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH     D  V +      P+ +  L+    RV+ +++        H  A+T
Sbjct  3297  GKGDYYRLGHGG---DQHVRK------PQPIGGLR--GRRVIHVAVG-----ALHCLAVT  3340

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3341  DAGQVYAWGDNDHGQQG  3357


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 69/136 (51%), Gaps = 18/136 (13%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G    WG G YG LG+GN +    P +VE    ++ +    G  ++  ++ +G  YS+ 
Sbjct  738  EGLVYAWGDGDYGKLGNGNCNSSLQPILVETLPRVQRIF--AGAQSSMALTTEGHLYSW-  794

Query  384  CGESSSLGHNAVVXDGQVNRHSNILS-PELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G++S LGH       QV R     S P LV+SL+   +R+V +++       AH  ALT
Sbjct  795  -GKASCLGHQ------QVERSVQGCSVPRLVSSLQH--KRLVDVAVG-----VAHCLALT  840

Query  207  EXGKLFAFGAGDKGQL  160
              G++F +G  D  Q+
Sbjct  841  SCGEVFGWGRNDSQQI  856


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 63/136 (46%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G    WG G  G LGHGN      PK+VE  + +    +A G   +  ++  G   ++G
Sbjct  4251  EGEVYAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMSVADIACGSAHSAAITSSGHVLTWG  4310

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4311  KGRYGRLGH---------GDSEDQLRPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4356

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4357  DDNVWSWGDGDYGKLG  4372


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG+ D    PK V A    K + +ATG       S+ G+ Y++
Sbjct  4408  KSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDAGEVYTW  4467

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV +L+   + +V+++       +AHT AL+
Sbjct  4468  GDNDEGQLG------DGTV---TAIQRPRLVAALQ--GKHIVKVTCG-----SAHTLALS  4511


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 63/148 (43%), Gaps = 17/148 (11%)
 Frame = -2

Query  549   TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
              WG      LG         P   +  S ++ +H++ G  + F+VS+DG    F CGE  
Sbjct  3031  VWGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHISGGSKSLFIVSQDGKV--FACGE--  3086

Query  369   SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
               G N  +  G  +   N+  P  +  L Q   + V +          H  ALT  GK+F
Sbjct  3087  --GTNGRLGLGVTH---NVPLPHQLPVLHQYVVKKVAVH-----SGGKHALALTLDGKVF  3136

Query  189   AFGAGDKGQLGVALSANQTERANPERVE  106
             ++G G+ G+LG     N+T    P  VE
Sbjct  3137  SWGEGEDGKLG---HGNRTTLDKPRLVE  3161



>ref|XP_002182991.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC45727.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=341

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 77/152 (51%), Gaps = 19/152 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   TWG G++G LGH +E    +P +V+     K   V+ G + T VVSEDG  Y+FG 
Sbjct  209  GELFTWGEGKFGRLGHMSERNCHSPTIVDYMVGKKPRQVSCGGFHTAVVSEDGRLYTFGG  268

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            GE   LGHN  V         N ++P  V +L  +   V QI+   S     H+ ALT  
Sbjct  269  GEHGQLGHNDRV---------NKMTPTFVEALDGMF--VSQITCGWS-----HSVALTVK  312

Query  201  GKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            G ++ +G GD G+LG     N  + A P+ VE
Sbjct  313  GLVYTWGNGDHGKLG---HGNGRKVAVPQAVE  341


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 67/136 (49%), Gaps = 15/136 (11%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G   TWG G YG LGHG+E   + PK VEA        +A G   T +V+  G  Y++G
Sbjct  103  NGDLYTWGGGMYGKLGHGDEAGHATPKRVEALVGATVAQIACGSRHTAIVTASGALYTWG  162

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              E+   GH      G+   H  +  P L+ S+    +RV QIS         HT  +T+
Sbjct  163  DKENGVAGH------GETEGHQYL--PRLLESM--AAKRVAQISAC-----GFHTAIVTD  207

Query  204  XGKLFAFGAGDKGQLG  157
             G+LF +G G  G+LG
Sbjct  208  AGELFTWGEGKFGRLG  223


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 69/148 (47%), Gaps = 19/148 (13%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            TWG G  G LG G+   +  P  V+A   +    +A G   T V++ DG+ +++G G+  
Sbjct  4    TWGRGEDGQLGLGDTSDQDEPTYVDALRGVGVQQIACGSGHTVVLTTDGEVFTWGRGDDG  63

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH           +     P +  SL    + V+Q++  +      HT A+T  G L+
Sbjct  64   RLGH---------GDNGWKYVPRMTQSL--AGQIVLQVTCGSY-----HTAAVTGNGDLY  107

Query  189  AFGAGDKGQLGVALSANQTERANPERVE  106
             +G G  G+LG     ++   A P+RVE
Sbjct  108  TWGGGMYGKLG---HGDEAGHATPKRVE  132



>gb|KJB43031.1| hypothetical protein B456_007G180500 [Gossypium raimondii]
Length=297

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 76/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  +++DG+ Y +
Sbjct  118  EDGTLWAWGNNEYGQLGTGDTQPRSQPIPVQGLSGLTLVDIAAGGWHSTALTDDGEVYGW  177

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E +VQ+S   +     H+ ALT
Sbjct  178  GRGEHGRLGFGD-------NDKSSKMVPQRVQLL--AGEDIVQVSCGGT-----HSVALT  223

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F+FG GD G+LG    A       P  V ++L  P
Sbjct  224  RDGRMFSFGRGDHGRLGYGRKATT---GQPMEVPINLPAP  260



>ref|XP_004681471.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Condylura cristata]
Length=1023

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 50/143 (35%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D + +P +VE   + K   +  G + T ++++DG  ++FG 
Sbjct  209  GNVYSWGRNDFGQLGLGHTDNKDSPALVEPLDHQKVEFLTCGGFHTALLTKDGLVFTFGA  268

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV QI+      W  HT A +++
Sbjct  269  GKFGQLGHNST---------QNELRPCLVTEL--TGNRVTQIACGR---W--HTLAYVSD  312

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG +   NQ
Sbjct  313  LGKVFSFGSGKEGQLGNSGKHNQ  335



>ref|XP_003898997.1| PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--protein ligase HERC5 
[Papio anubis]
Length=1023

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ + + +P ++EA  N K   +A G   + ++++DG  ++FG 
Sbjct  209  GNVYSWGKNEFGQLGLGHTESKDSPSLIEALDNQKVEFLACGGSHSALLTQDGLLFTFGA  268

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L  V  RV QI+      W  HT A +++
Sbjct  269  GKHGQLGHNST---------QNELRPCLVAEL--VGNRVTQIACGR---W--HTLAYVSD  312

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G  GQLG   + +Q
Sbjct  313  LGKVFSFGSGKDGQLGNGGTLDQ  335


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   +G LG G +    + P++VE  + +    ++ G+  +  +S  G+ YS
Sbjct  154  KGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNVYS  213

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E   LG         +    +  SP L+ +L    ++V  ++   S     H+  L
Sbjct  214  WGKNEFGQLG---------LGHTESKDSPSLIEALDN--QKVEFLACGGS-----HSALL  257

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G LF FGAG  GQLG   + N+
Sbjct  258  TQDGLLFTFGAGKHGQLGHNSTQNE  282



>ref|XP_006182667.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Camelus ferus]
Length=852

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 50/143 (35%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D +  P ++EA  N     +A G   + ++++DG  ++FG 
Sbjct  113  GNVYSWGRNDFGQLGLGHTDNKDYPALIEALDNQTIEFLACGGSHSALLTKDGLVFTFGA  172

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L  V  RV QI+         HT A +++
Sbjct  173  GKYGQLGHNST---------QNELKPCLVTGL--VGNRVTQIACGRR-----HTLAFVSD  216

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  217  LGKVFSFGSGKEGQLGNGGTHNQ  239



>ref|XP_004391581.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Odobenus rosmarus 
divergens]
Length=954

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 71/143 (50%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+ D E  P ++EA  N K   +A G   T +++ DG  ++FG 
Sbjct  215  GNIYSWGRNDLGQLGLGHTDGEDFPSLIEALDNQKVEFLACGGSHTALLTTDGLVFTFGA  274

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN            N L P LVT L     RV QI+         HT A +++
Sbjct  275  GKYGQLGHNCT---------QNELRPRLVTEL--AGNRVTQIACGRR-----HTLAYVSD  318

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+ +FG+G +GQLG   + NQ
Sbjct  319  LGKVLSFGSGKEGQLGNGGTHNQ  341


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 43/145 (30%), Positives = 64/145 (44%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCE-SAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   +G LG G        P++VE  S +  V ++ G   +  +S  G+ YS
Sbjct  160  KGGELFAWGQNLHGQLGVGRLFASIPTPQIVENLSGVPLVQISAGKAHSMALSMSGNIYS  219

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  +   LG      DG+         P L+ +L    ++V  ++   S     HT  L
Sbjct  220  WGRNDLGQLGLGHT--DGED-------FPSLIEALDN--QKVEFLACGGS-----HTALL  263

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T  G +F FGAG  GQLG   + N+
Sbjct  264  TTDGLVFTFGAGKYGQLGHNCTQNE  288



>ref|XP_008055693.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Tarsius syrichta]
Length=941

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ + + +P ++E   N +   +A G   T ++++DG  ++FG 
Sbjct  127  GNIYSWGNNEFGQLGLGHTENKDSPSLIEKLDNQEVEFLACGGSHTALLTQDGLVFTFGA  186

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV     V  RV QI+   S     HT A +++
Sbjct  187  GKYGQLGHNST---------QNELIPRLVAEF--VGNRVSQIACGRS-----HTLAYVSD  230

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  231  LGKVFSFGSGKEGQLGNGGTCNQ  253


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/145 (30%), Positives = 65/145 (45%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG  ++G LG G        P++VE  + +  V +A G+  +  +S  G+ YS
Sbjct  72   KGGELFAWGQNQHGQLGIGRMFPSTCTPQIVEDLAGVPLVQIAAGEAHSMALSMSGNIYS  131

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E   LG         +    N  SP L+  L    + V  ++   S     HT  L
Sbjct  132  WGNNEFGQLG---------LGHTENKDSPSLIEKLDN--QEVEFLACGGS-----HTALL  175

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G +F FGAG  GQLG   + N+
Sbjct  176  TQDGLVFTFGAGKYGQLGHNSTQNE  200



>ref|XP_007997417.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Chlorocebus sabaeus]
Length=1023

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ + + +P ++EA  N K   +A G   + ++++DG  ++FG 
Sbjct  209  GNIYSWGKNEFGQLGLGHTESKDSPSLIEALDNQKVEFLACGGSHSALLTQDGLLFTFGA  268

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L  V  RV QI+      W  HT A +++
Sbjct  269  GKHGQLGHNST---------QNELRPCLVAEL--VGNRVTQIACGR---W--HTLAYVSD  312

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G  GQLG   + +Q
Sbjct  313  LGKVFSFGSGKDGQLGNGGTLDQ  335


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   +G LG G +    + P++VE  + +    ++ G+  +  +S  G+ YS
Sbjct  154  KGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYS  213

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E   LG         +    +  SP L+ +L    ++V  ++   S     H+  L
Sbjct  214  WGKNEFGQLG---------LGHTESKDSPSLIEALDN--QKVEFLACGGS-----HSALL  257

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G LF FGAG  GQLG   + N+
Sbjct  258  TQDGLLFTFGAGKHGQLGHNSTQNE  282



>ref|XP_005555451.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Macaca fascicularis]
Length=1023

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ + + +P ++EA  N K   +A G   + ++++DG  ++FG 
Sbjct  209  GNIYSWGKNEFGQLGLGHTESKDSPSLIEALDNQKVEFLACGGSHSALLTQDGLLFTFGA  268

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L  V  RV QI+      W  HT A +++
Sbjct  269  GKHGQLGHNST---------QNELRPCLVAEL--VGNRVTQIACGR---W--HTLAYVSD  312

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G  GQLG   + +Q
Sbjct  313  FGKVFSFGSGKDGQLGNGGTLDQ  335


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   +G LG G +    + P++VE  + +    ++ G+  +  +S  G+ YS
Sbjct  154  KGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYS  213

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E   LG         +    +  SP L+ +L    ++V  ++   S     H+  L
Sbjct  214  WGKNEFGQLG---------LGHTESKDSPSLIEALDN--QKVEFLACGGS-----HSALL  257

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G LF FGAG  GQLG   + N+
Sbjct  258  TQDGLLFTFGAGKHGQLGHNSTQNE  282



>gb|EHH53834.1| E3 ISG15--protein ligase HERC5 [Macaca fascicularis]
Length=854

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ + + +P ++EA  N K   +A G   + ++++DG  ++FG 
Sbjct  135  GNIYSWGKNEFGQLGLGHTESKDSPSLIEALDNQKVEFLACGGSHSALLTQDGLLFTFGA  194

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L  V  RV QI+      W  HT A +++
Sbjct  195  GKHGQLGHNST---------QNELRPCLVAEL--VGNRVTQIACGR---W--HTLAYVSD  238

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G  GQLG   + +Q
Sbjct  239  FGKVFSFGSGKDGQLGNGGTLDQ  261


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/145 (28%), Positives = 67/145 (46%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            + G    WG   +G LG G +    + P++VE  + +    ++ G+  +  +S  G+ YS
Sbjct  80   RGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYS  139

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E   LG         +    +  SP L+ +L    ++V  ++   S     H+  L
Sbjct  140  WGKNEFGQLG---------LGHTESKDSPSLIEALDN--QKVEFLACGGS-----HSALL  183

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G LF FGAG  GQLG   + N+
Sbjct  184  TQDGLLFTFGAGKHGQLGHNSTQNE  208



>ref|XP_011011190.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Populus 
euphratica]
Length=392

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P +V+  S +  V +A G + +  +++DG+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPILVQGLSGLNLVDIAAGGWHSTALTDDGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E ++Q+S   +     H+ ALT
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMVPQKVNLL--AGEDIIQVSCGGT-----HSVALT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F+FG GD G+LG      +     P  V +D+  P
Sbjct  320  RDGQMFSFGRGDHGRLGY---GRKVTTGQPMEVPIDIPPP  356


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 79/192 (41%), Gaps = 42/192 (22%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DG+  TWGW + G LGH  E   E+ P  V+A +N+  V  A G +    V + G AYS+
Sbjct  56   DGKLFTWGWNQRGTLGHPPETKTENIPSQVKALANVNIVQAAIGGWHCLAVDDQGRAYSW  115

Query  387  G------CGE----------------------SSSLGHNAVVXDGQ----VNRHSNILS-  307
            G      CGE                      +S L    V   G     + R  ++ S 
Sbjct  116  GGNEYGQCGEEPERKNETGRPLRRDIVIPQRCASKLAVRQVAAGGTHSVVLTREGHVWSW  175

Query  306  --PELVTSLKQ--VXERVVQISLTNSIYWNA-HTFALTEXGKLFAFGAGDKGQLGVALSA  142
              P     +KQ  V  RV  +     I   A H  AL E G L+A+G  + GQLG   + 
Sbjct  176  GQPWPPGDIKQISVPVRVQGLERVRLIAVGAFHNLALQEDGTLWAWGNNEYGQLG---TG  232

Query  141  NQTERANPERVE  106
            +   R+ P  V+
Sbjct  233  DTQPRSQPILVQ  244



>ref|XP_010592357.1| PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--protein ligase HERC5 
[Loxodonta africana]
Length=796

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D + +P ++E   N     +  G   T ++++DG  ++FG 
Sbjct  119  GNVYSWGKNDFGQLGLGHTDSKDSPSLIEELDNQDVEFLTCGGSHTALLTKDGLVFTFGA  178

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N   P LVT L  V  RV QI+         HT A +++
Sbjct  179  GQYGQLGHNSA---------QNEPRPRLVTEL--VGNRVTQIACGRD-----HTLAYVSD  222

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  223  LGKVFSFGSGKEGQLGNGGTHNQ  245


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATG-DYTTFVVSEDGDAYS  391
            KDG   T+G G+YG LGH +   E  P++V      +   +A G D+T   VS+ G  +S
Sbjct  169  KDGLVFTFGAGQYGQLGHNSAQNEPRPRLVTELVGNRVTQIACGRDHTLAYVSDLGKVFS  228

Query  390  FGCGESSSLG----HNAVV  346
            FG G+   LG    HN ++
Sbjct  229  FGSGKEGQLGNGGTHNQLI  247



>gb|KGN52576.1| hypothetical protein Csa_5G644530 [Cucumis sativus]
Length=387

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (48%), Gaps = 17/163 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  ++++G+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPIPVQGLSGLTLVDIAAGGWHSTALTDNGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E +VQIS   +     H+ A+T
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMVPQKVQLLS--GEEIVQISCGGT-----HSVAVT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*PLIR  79
              G++F+FG GD G+LG      +     PE V +D+  P  R
Sbjct  320  SDGRMFSFGRGDHGRLGY---GRKVTTGQPEEVPIDIPPPRGR  359


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 76/194 (39%), Gaps = 44/194 (23%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGH-GNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            +DG+  TWGW + G LGH      E+ P  V+A SN+K V  A G +    V + G AY+
Sbjct  55   EDGKLFTWGWNQRGTLGHPAGTKSENVPSQVKALSNVKIVQAAIGGWHCLAVDDQGRAYA  114

Query  390  FG------CGESSSLGHNA--------------------------------VVXDGQVNR  325
            +G      CGE      N                                 +  +G V  
Sbjct  115  WGGNEYGQCGEEPEKKDNTGRPPRRDIAIPQRCAPKLIVRQVAAGGTHSVVLTREGHVWT  174

Query  324  HSNILSPELVTSLKQVXERVVQISLTNSIYWNA-HTFALTEXGKLFAFGAGDKGQLGVAL  148
                  P  +T +  V  RV  + +   I   A H  AL E G L+A+G  + GQLG   
Sbjct  175  WGQPWPPGDITQIS-VPVRVQGLDMVRLIAVGAFHNLALQEDGTLWAWGNNEYGQLG---  230

Query  147  SANQTERANPERVE  106
            + +   R+ P  V+
Sbjct  231  TGDTQPRSQPIPVQ  244



>ref|XP_004156186.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin-protein 
ligase HERC1-like [Cucumis sativus]
Length=390

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (48%), Gaps = 17/163 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  ++++G+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPIPVQGLSGLTLVDIAAGGWHSTALTDNGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E +VQIS   +     H+ A+T
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMVPQKVQLLS--GEEIVQISCGGT-----HSVAVT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*PLIR  79
              G++F+FG GD G+LG      +     PE V +D+  P  R
Sbjct  320  SDGRMFSFGRGDHGRLGY---GRKVTTGQPEEVPIDIPPPRGR  359


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 76/194 (39%), Gaps = 44/194 (23%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGH-GNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            +DG+  TWGW + G LGH      E+ P  V+A SN+K V  A G +    V + G AY+
Sbjct  55   EDGKLFTWGWNQRGTLGHPAGTKSENVPSQVKALSNVKIVQAAIGGWHCLAVDDQGRAYA  114

Query  390  FG------CGESSSLGHNA--------------------------------VVXDGQVNR  325
            +G      CGE      N                                 +  +G V  
Sbjct  115  WGGNEYGQCGEEPEKKDNTGRPPRRDIAIPQRCAPKLIVRQVAAGGTHSVVLTREGHVWT  174

Query  324  HSNILSPELVTSLKQVXERVVQISLTNSIYWNA-HTFALTEXGKLFAFGAGDKGQLGVAL  148
                  P  +T +  V  RV  + +   I   A H  AL E G L+A+G  + GQLG   
Sbjct  175  WGQPWPPGDITQIS-VPVRVQGLDMVRLIAVGAFHNLALQEDGTLWAWGNNEYGQLG---  230

Query  147  SANQTERANPERVE  106
            + +   R+ P  V+
Sbjct  231  TGDTQPRSQPIPVQ  244



>ref|XP_004141502.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin-protein 
ligase HERC1-like [Cucumis sativus]
Length=390

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (48%), Gaps = 17/163 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  ++++G+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPIPVQGLSGLTLVDIAAGGWHSTALTDNGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E +VQIS   +     H+ A+T
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMVPQKVQLLS--GEEIVQISCGGT-----HSVAVT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*PLIR  79
              G++F+FG GD G+LG      +     PE V +D+  P  R
Sbjct  320  SDGRMFSFGRGDHGRLGY---GRKVTTGQPEEVPIDIPPPRGR  359


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 76/194 (39%), Gaps = 44/194 (23%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGH-GNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            +DG+  TWGW + G LGH      E+ P  V+A SN+K V  A G +    V + G AY+
Sbjct  55   EDGKLFTWGWNQRGTLGHPAGTKSENVPSQVKALSNVKIVQAAIGGWHCLAVDDQGRAYA  114

Query  390  FG------CGESSSLGHNA--------------------------------VVXDGQVNR  325
            +G      CGE      N                                 +  +G V  
Sbjct  115  WGGNEYGQCGEEPEKKDNTGRPPRRDIAIPQRCAPKLIVRQVAAGGTHSVVLTREGHVWT  174

Query  324  HSNILSPELVTSLKQVXERVVQISLTNSIYWNA-HTFALTEXGKLFAFGAGDKGQLGVAL  148
                  P  +T +  V  RV  + +   I   A H  AL E G L+A+G  + GQLG   
Sbjct  175  WGQPWPPGDITQIS-VPVRVQGLDMVRLIAVGAFHNLALQEDGTLWAWGNNEYGQLG---  230

Query  147  SANQTERANPERVE  106
            + +   R+ P  V+
Sbjct  231  TGDTQPRSQPIPVQ  244



>gb|KHG04352.1| putative E3 ubiquitin-protein ligase HERC4 [Gossypium arboreum]
Length=365

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 76/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  +++DG+ Y +
Sbjct  186  EDGTLWAWGNNEYGQLGTGDTQPRSQPIPVQGLSGLTLVDIAAGGWHSTALTDDGEVYGW  245

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E +VQ+S   +     H+ ALT
Sbjct  246  GRGEHGRLGFGD-------NDKSSKMVPQRVQLL--AGEDIVQVSCGGT-----HSVALT  291

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F+FG GD G+LG    A       P  V ++L  P
Sbjct  292  RDGRMFSFGRGDHGRLGYGRKATT---GQPMEVPINLPAP  328



>gb|KDP32937.1| hypothetical protein JCGZ_12968 [Jatropha curcas]
Length=392

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  + +  V +A G + +  +++DG+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPIPVQGLAGLNLVDIAAGGWHSTALTDDGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E +VQ+S   +     H+ ALT
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMLPQRVQLL--AGEDIVQVSCGGT-----HSVALT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F+FG GD G+LG      +     P  V +D+S P
Sbjct  320  RDGRMFSFGRGDHGRLGY---GRKVTTGQPMEVPIDISPP  356


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 78/192 (41%), Gaps = 42/192 (22%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGH-GNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DG+  TWGW + G LGH      E+ P  V+A +++  V  A G +    V + G AY++
Sbjct  56   DGKLFTWGWNQRGTLGHPSGTKTENVPSQVKALASVSIVQAAIGGWHCLAVDDQGRAYAW  115

Query  387  G------CGES--------SSLGHNAVVXDGQVNR-----------HSNILS--------  307
            G      CGE           L  + V+      +           HS +L+        
Sbjct  116  GGNEYGQCGEEPERKEDTGKPLRRDIVIPQRCAPKLVVRQVAAGGTHSVVLTCEGHVWTW  175

Query  306  --PELVTSLKQ--VXERVVQISLTNSIYWNA-HTFALTEXGKLFAFGAGDKGQLGVALSA  142
              P     +KQ  V  RV  +     I   A H  AL E G L+A+G  + GQLG   + 
Sbjct  176  GQPWPPGDIKQISVPVRVQGLERVKLIAVGAFHNLALQEDGTLWAWGNNEYGQLG---TG  232

Query  141  NQTERANPERVE  106
            +   R+ P  V+
Sbjct  233  DTQPRSQPIPVQ  244



>gb|ENN75748.1| hypothetical protein YQE_07708, partial [Dendroctonus ponderosae]
Length=4676

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++EA  + K   +A G   +  +S  G+ Y++G
Sbjct  3071  DGKVFSWGEGEDGKLGHGNRLNLDKPKLIEALKSKKIRDIACGSSHSAAISSGGELYTWG  3130

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH   V           L P++V +L  V  R+VQ++  +    +A T AL++
Sbjct  3131  LGEYGRLGHGDNVTQ---------LKPKMVKAL--VGHRIVQVACGSR---DAQTLALSD  3176

Query  204   XGKLFAFGAGDKGQLG  157
              G++F++G GD G+LG
Sbjct  3177  QGQVFSWGDGDFGKLG  3192


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 16/135 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG G YG LG G  +    P+++E   +++ V+V  G + +  +S++G  Y++G 
Sbjct  626  GLVLSWGDGDYGKLGRGGAEGSKVPRIIEQLQDVEIVNVWCGPHFSVALSKEGKVYTWGK  685

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            GE   LGH +           N+  PELV +L+      V + ++       H  ALT  
Sbjct  686  GEGWKLGHES---------EDNVRKPELVEALQDKAVVFVAVGIS-------HCLALTSD  729

Query  201  GKLFAFGAGDKGQLG  157
            G +  +G  D  Q+ 
Sbjct  730  GLVLGWGKNDNRQIA  744


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 67/137 (49%), Gaps = 14/137 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            + G   +WG G  G LGHG+   +  P V+EA    K + +  G   +  +S +G  Y++
Sbjct  518  RHGVVYSWGSGDGGRLGHGDTLAKEEPAVIEALCGTKIIAIECGATYSAAISSNGYLYTW  577

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH             ++L P  +TSL +    +V ++L +    +AH+  +T
Sbjct  578  GRGNYGRLGHGTF---------EDVLIPTPITSLAE--HHIVAVALGSG---DAHSLCVT  623

Query  207  EXGKLFAFGAGDKGQLG  157
              G + ++G GD G+LG
Sbjct  624  AQGLVLSWGDGDYGKLG  640


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 66/136 (49%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  + V  G   +  ++  G  Y++G
Sbjct  4136  DDNVWSWGDGDYGKLGRGGSDGCKVPTKIESLAGLGVMKVECGSQFSIALTRSGSVYTWG  4195

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH             ++  P+ V +L+   +++V I+ T S+    H  A +E
Sbjct  4196  KGDYHRLGHGTA---------DHVRRPKKVAALQ--GKKIVSIA-TGSL----HCVACSE  4239

Query  204   XGKLFAFGAGDKGQLG  157
              G++F +G  D+GQLG
Sbjct  4240  EGEVFTWGDNDEGQLG  4255


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 65/136 (48%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G  G LGHGN      PK+++A   ++ V VA G   +  ++  G  Y++G
Sbjct  4030  DNEVYSWGEGEDGKLGHGNRISCEKPKLIDAFQALEVVDVACGGAHSAAITASGHLYTWG  4089

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV  L     +VV ++  +    +A T  +T+
Sbjct  4090  KGRYGRLGH---------GDSEDQLKPKLVEELANY--KVVGVACGSG---DAQTLCITD  4135

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4136  DDNVWSWGDGDYGKLG  4151


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 67/135 (50%), Gaps = 16/135 (12%)
 Frame = -2

Query  561   GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             G+  +WG G +G LG G  +  + P  +E  +N+  V +  G   +  +++ G  +++G 
Sbjct  3178  GQVFSWGDGDFGKLGRGGSEGCNVPHNIERLNNLGIVQIECGAQFSLALAKSGQIWTWGK  3237

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G+   LGH         ++H  I  P LV  LK   + +V +++        H  A+T+ 
Sbjct  3238  GDYFRLGHGT-------DQH--IRKPTLVDCLKD--KVIVHVAVG-----ALHCLAVTDS  3281

Query  201   GKLFAFGAGDKGQLG  157
             G+++A+G  D GQ G
Sbjct  3282  GQVYAWGDNDHGQQG  3296


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 54/118 (46%), Gaps = 14/118 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             + G   TWG G Y  LGHG  D    PK V A    K V +ATG       SE+G+ +++
Sbjct  4187  RSGSVYTWGKGDYHRLGHGTADHVRRPKKVAALQGKKIVSIATGSLHCVACSEEGEVFTW  4246

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
             G  +   LG      DG     S I  P L++ L+   +++     TN    +AHT A
Sbjct  4247  GDNDEGQLG------DGTT---SGIHIPRLISCLQPKVKKI-----TNVACGSAHTLA  4290


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 59/141 (42%), Gaps = 10/141 (7%)
 Frame = -2

Query  570   GKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
              K G+  TWG G Y  LGHG +     P +V+   +   VHVA G      V++ G  Y+
Sbjct  3227  AKSGQIWTWGKGDYFRLGHGTDQHIRKPTLVDCLKDKVIVHVAVGALHCLAVTDSGQVYA  3286

Query  390   FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             +G  +    G+ +      VN+      P LV  L+ V    V    ++SI W  H    
Sbjct  3287  WGDNDHGQQGNGST----SVNK-----KPALVQGLEDVQINRVACGSSHSIAWILHDNQT  3337

Query  210   TEXGKLFAFGAGDKGQLGVAL  148
                 +   F A  K  LG A+
Sbjct  3338  ITKAEPVIF-AAPKDPLGSAM  3357



>ref|XP_005761231.1| hypothetical protein EMIHUDRAFT_358730 [Emiliania huxleyi CCMP1516]
 gb|EOD08802.1| hypothetical protein EMIHUDRAFT_358730 [Emiliania huxleyi CCMP1516]
Length=260

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 80/154 (52%), Gaps = 19/154 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            DG   +WGWG  G LGHG++  +  PK VEA +  + V V+ G   +  ++  G  +S+G
Sbjct  16   DGAVWSWGWGNSGRLGHGDQQRQLLPKKVEAFAGRRVVAVSAGVSHSLALTAGGAVWSWG  75

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G+   LGH     D Q     + L P+ + +L    +RV+ +S   S     H+ ALT 
Sbjct  76   DGDYGQLGHG----DTQ-----DQLLPKRIEAL--AGQRVIAVSAGYS-----HSLALTA  119

Query  204  XGKLFAFGAGDKGQLGVALSANQTERANPERVEV  103
             G ++++G GD G+LG     +Q  +  P++VE 
Sbjct  120  DGAVWSWGGGDYGKLG---HGDQQSQLLPKKVEA  150


 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 74/154 (48%), Gaps = 18/154 (12%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            DG   +WG G YG LGHG++  +  PK VEA +  + + V+ G   +  ++ DG   S+G
Sbjct  120  DGAVWSWGGGDYGKLGHGDQQSQLLPKKVEAFTGQRVITVSAGGRHSLALAADGSVCSWG  179

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G    LGH      G   R    L P+ + +      RVV +S       + H+ AL  
Sbjct  180  LGGDGRLGH------GDEQRQ---LLPKKIEAF--AGRRVVAVSAG-----SCHSLALAA  223

Query  204  XGKLFAFGAGDKGQLGVALSANQTERANPERVEV  103
             G ++A+G G+ G LG     + + +  P++VE 
Sbjct  224  DGAVYAWGEGEHGCLG--HGEDLSNQLLPKKVEA  255



>gb|ERL87037.1| hypothetical protein D910_04439 [Dendroctonus ponderosae]
Length=4753

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++EA  + K   +A G   +  +S  G+ Y++G
Sbjct  3082  DGKVFSWGEGEDGKLGHGNRLNLDKPKLIEALKSKKIRDIACGSSHSAAISSGGELYTWG  3141

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH   V           L P++V +L  V  R+VQ++  +    +A T AL++
Sbjct  3142  LGEYGRLGHGDNVTQ---------LKPKMVKAL--VGHRIVQVACGSR---DAQTLALSD  3187

Query  204   XGKLFAFGAGDKGQLG  157
              G++F++G GD G+LG
Sbjct  3188  QGQVFSWGDGDFGKLG  3203


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 16/135 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG G YG LG G  +    P+++E   +++ V+V  G + +  +S++G  Y++G 
Sbjct  626  GLVLSWGDGDYGKLGRGGAEGSKVPRIIEQLQDVEIVNVWCGPHFSVALSKEGKVYTWGK  685

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            GE   LGH +           N+  PELV +L+      V + ++       H  ALT  
Sbjct  686  GEGWKLGHES---------EDNVRKPELVEALQDKAVVFVAVGIS-------HCLALTSD  729

Query  201  GKLFAFGAGDKGQLG  157
            G +  +G  D  Q+ 
Sbjct  730  GVVLGWGKNDNRQIA  744


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 67/137 (49%), Gaps = 14/137 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            + G   +WG G  G LGHG+   +  P V+EA    K + +  G   +  +S +G  Y++
Sbjct  518  RHGVVYSWGSGDGGRLGHGDTLAKEEPAVIEALCGTKIIAIECGATYSAAISSNGYLYTW  577

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH             ++L P  +TSL +    +V ++L +    +AH+  +T
Sbjct  578  GRGNYGRLGHGTF---------EDVLIPTPITSLAE--HHIVAVALGSG---DAHSLCVT  623

Query  207  EXGKLFAFGAGDKGQLG  157
              G + ++G GD G+LG
Sbjct  624  AQGLVLSWGDGDYGKLG  640


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 66/136 (49%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  + V  G   +  ++  G  Y++G
Sbjct  4147  DDNVWSWGDGDYGKLGRGGSDGCKVPTKIESLAGLGVMKVECGSQFSIALTRSGSVYTWG  4206

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH             ++  P+ V +L+   +++V I+ T S+    H  A +E
Sbjct  4207  KGDYHRLGHGTA---------DHVRRPKKVAALQ--GKKIVSIA-TGSL----HCVACSE  4250

Query  204   XGKLFAFGAGDKGQLG  157
              G++F +G  D+GQLG
Sbjct  4251  EGEVFTWGDNDEGQLG  4266


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 65/136 (48%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G  G LGHGN      PK+++A   ++ V VA G   +  ++  G  Y++G
Sbjct  4041  DNEVYSWGEGEDGKLGHGNRISCEKPKLIDAFQALEVVDVACGGAHSAAITASGHLYTWG  4100

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV  L     +VV ++  +    +A T  +T+
Sbjct  4101  KGRYGRLGH---------GDSEDQLKPKLVEELANY--KVVGVACGSG---DAQTLCITD  4146

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4147  DDNVWSWGDGDYGKLG  4162


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 67/135 (50%), Gaps = 16/135 (12%)
 Frame = -2

Query  561   GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             G+  +WG G +G LG G  +  + P  +E  +N+  V +  G   +  +++ G  +++G 
Sbjct  3189  GQVFSWGDGDFGKLGRGGSEGCNVPHNIERLNNLGIVQIECGAQFSLALAKSGQIWTWGK  3248

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G+   LGH         ++H  I  P LV  LK   + +V +++        H  A+T+ 
Sbjct  3249  GDYFRLGHGT-------DQH--IRKPTLVDCLKD--KVIVHVAVG-----ALHCLAVTDS  3292

Query  201   GKLFAFGAGDKGQLG  157
             G+++A+G  D GQ G
Sbjct  3293  GQVYAWGDNDHGQQG  3307


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 54/118 (46%), Gaps = 14/118 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             + G   TWG G Y  LGHG  D    PK V A    K V +ATG       SE+G+ +++
Sbjct  4198  RSGSVYTWGKGDYHRLGHGTADHVRRPKKVAALQGKKIVSIATGSLHCVACSEEGEVFTW  4257

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
             G  +   LG      DG     S I  P L++ L+   +++     TN    +AHT A
Sbjct  4258  GDNDEGQLG------DGTT---SGIHIPRLISCLQPKVKKI-----TNVACGSAHTLA  4301


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 59/141 (42%), Gaps = 10/141 (7%)
 Frame = -2

Query  570   GKDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
              K G+  TWG G Y  LGHG +     P +V+   +   VHVA G      V++ G  Y+
Sbjct  3238  AKSGQIWTWGKGDYFRLGHGTDQHIRKPTLVDCLKDKVIVHVAVGALHCLAVTDSGQVYA  3297

Query  390   FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             +G  +    G+ +      VN+      P LV  L+ V    V    ++SI W  H    
Sbjct  3298  WGDNDHGQQGNGST----SVNK-----KPALVQGLEDVQINRVACGSSHSIAWILHDNQT  3348

Query  210   TEXGKLFAFGAGDKGQLGVAL  148
                 +   F A  K  LG A+
Sbjct  3349  ITKAEPVIF-AAPKDPLGSAM  3368



>ref|XP_011203204.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 [Bactrocera 
dorsalis]
 ref|XP_011203205.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 [Bactrocera 
dorsalis]
Length=5042

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++EA    K   +A G   +  ++  G+ Y++G
Sbjct  3194  DGKVFSWGEGEDGKLGHGNRLTMDKPKLIEALRAKKIRDIACGSSHSAAITSAGELYTWG  3253

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH   V           L P+LVT+L    +RV+Q++  +    +A T ALTE
Sbjct  3254  LGEYGRLGHGDNVTQ---------LKPKLVTALS--GKRVIQVACGSR---DAQTLALTE  3299

Query  204   XGKLFAFGAGDKGQLG  157
              G ++++G GD G+LG
Sbjct  3300  DGIVYSWGDGDFGKLG  3315


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 73/147 (50%), Gaps = 17/147 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  V V  G   +  +++ G  Y++G
Sbjct  4389  DDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWG  4448

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH  V          ++  P+ V +L+   +++V I+ T S+    H  A T+
Sbjct  4449  KGDFHRLGHGTV---------DHVRRPKKVAALQ--GKKIVSIA-TGSL----HCVACTD  4492

Query  204   XGKLFAFGAGDKGQLGV-ALSANQTER  127
              G++F +G  D+GQLG   +SA Q  R
Sbjct  4493  AGEVFTWGDNDEGQLGDGTVSAIQRPR  4519


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 65/136 (48%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G   +WG G  G LGHGN      PK++E  + I  V +A G   +  ++  G   ++G
Sbjct  4283  EGEVYSWGEGEDGKLGHGNRMSYDRPKLIEDLTGIGIVDIACGSAHSAAITSSGHVLTWG  4342

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + ++  +    +A T  +T+
Sbjct  4343  KGRYGRLGH---------GDSEDQLRPKLVEAL--LGYRAIDVACGSG---DAQTLCITD  4388

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4389  DDNVWSWGDGDYGKLG  4404


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 68/137 (50%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +  S P  +E  + I  + +  G   +  ++  G+ +++
Sbjct  3299  EDGIVYSWGDGDFGKLGRGGSEGSSIPHEIERLTGIGVIQIECGAQFSLALTRTGEVWTW  3358

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH +   D  V +      P+ + +L+    +V+ +++        H  A+T
Sbjct  3359  GKGDYYRLGHGS---DQHVRK------PQPIQALR--GRKVIHLAVG-----ALHCLAVT  3402

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3403  DTGQVYAWGDNDHGQQG  3419


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 62/147 (42%), Gaps = 17/147 (12%)
 Frame = -2

Query  546   WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
             WG      LG         P   +  S ++ +H+A G  + F+VS+DG  Y+ G G +  
Sbjct  3094  WGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACGEGTNGR  3153

Query  366   LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
             LG    V         N+  P  +  L Q   + V +          H  ALT  GK+F+
Sbjct  3154  LGLGISV---------NVSVPRQIPVLHQYVVKKVAVH-----SGGKHAMALTLDGKVFS  3199

Query  186   FGAGDKGQLGVALSANQTERANPERVE  106
             +G G+ G+LG     N+     P+ +E
Sbjct  3200  WGEGEDGKLG---HGNRLTMDKPKLIE  3223


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 65/139 (47%), Gaps = 22/139 (16%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYS  391
            +G   TWG G YG LGHGN D +  P  V A      + VA  +GD  T  ++ +G  ++
Sbjct  675  NGNLYTWGRGTYGRLGHGNSDDKLLPTHVYALREHSIIDVALGSGDSHTLCLTAEGLVFA  734

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAH-TFA  214
            +G G+   LG N      Q+        P+L+ +L           L   +Y  +  + A
Sbjct  735  WGDGDYGKLG-NGSCNGSQL--------PQLIETL----------PLIKRVYAGSQFSMA  775

Query  213  LTEXGKLFAFGAGDKGQLG  157
            L+  GKL+++G    G+LG
Sbjct  776  LSCDGKLYSWGKAYDGRLG  794



>gb|KEH17300.1| chromosome condensation regulator RCC1 repeat protein [Medicago 
truncatula]
Length=398

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  +++DG+ Y +
Sbjct  212  EDGTLWAWGNNEYGQLGTGDTQPRSQPVPVQGLSGLTVVDIAAGGWHSTALTDDGEVYGW  271

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG       G  ++ S +L P+ V  L    E +VQ+S   +     H+ ALT
Sbjct  272  GRGEHGRLGF------GDSDKSSKML-PQRVQLL--AGEDIVQVSCGGT-----HSVALT  317

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F+FG GD G+LG      +     P  V +D+  P
Sbjct  318  RDGRIFSFGRGDHGRLGY---GRKVTTGQPMEVPIDIPPP  354


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 76/192 (40%), Gaps = 42/192 (22%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DG+  TWGW + G LGH  E   E+ P  V+A S+   V  A G +    V + G AY++
Sbjct  54   DGKLFTWGWNQRGTLGHPAETKTENIPSQVKALSHAHIVQAAIGGWHCLAVDDHGKAYAW  113

Query  387  G------CGESS--------SLGHNAVVXDGQVNR-----------HSNILS--------  307
            G      CGE           L  + V+      +           HS +L+        
Sbjct  114  GGNEYGQCGEEPERKDDNGRPLRRDIVIPQPCAPKLSVRQVAAGGTHSVVLTREGHVWTW  173

Query  306  --PELVTSLKQVXERVVQISLTNSIYWNA---HTFALTEXGKLFAFGAGDKGQLGVALSA  142
              P     +KQ+   V    L N         H  AL E G L+A+G  + GQLG   + 
Sbjct  174  GQPWPPGDIKQISVPVRVQGLDNIKLIAVGAFHNLALQEDGTLWAWGNNEYGQLG---TG  230

Query  141  NQTERANPERVE  106
            +   R+ P  V+
Sbjct  231  DTQPRSQPVPVQ  242



>gb|KJB43030.1| hypothetical protein B456_007G180500 [Gossypium raimondii]
Length=392

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 76/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  +++DG+ Y +
Sbjct  213  EDGTLWAWGNNEYGQLGTGDTQPRSQPIPVQGLSGLTLVDIAAGGWHSTALTDDGEVYGW  272

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E +VQ+S   +     H+ ALT
Sbjct  273  GRGEHGRLGFGD-------NDKSSKMVPQRVQLL--AGEDIVQVSCGGT-----HSVALT  318

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F+FG GD G+LG    A       P  V ++L  P
Sbjct  319  RDGRMFSFGRGDHGRLGYGRKATT---GQPMEVPINLPAP  355


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 78/192 (41%), Gaps = 42/192 (22%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DG+  TWGW + G LGH  E   E+ P  V+A +N+K V  A G +    V ++G AY++
Sbjct  55   DGKLFTWGWNQRGTLGHPPETKTENIPSQVKALANVKIVQAAIGGWHCLAVDDEGRAYAW  114

Query  387  GCGESSSLGHNAVVXD--GQVNRHSNIL----SPELVT----------------------  292
            G  E    G      D  G+  R   ++    +P+LV                       
Sbjct  115  GGNEYGQCGEEPERKDDTGRPLRRDIVIPQRCAPKLVVRQVAAGGTHSVVLTREGYVWTW  174

Query  291  -------SLKQVXERVVQISLTNSIYWNA---HTFALTEXGKLFAFGAGDKGQLGVALSA  142
                    +KQ+   V    L N         H  AL E G L+A+G  + GQLG   + 
Sbjct  175  GQPWPPGDIKQISVPVRVQGLENVRLITVGAFHNLALQEDGTLWAWGNNEYGQLG---TG  231

Query  141  NQTERANPERVE  106
            +   R+ P  V+
Sbjct  232  DTQPRSQPIPVQ  243



>gb|KFN08373.1| fibronectin type III domain protein [Paenibacillus macerans]
Length=1611

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 22/154 (14%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G GRYG LGHG+ + +  PK +E+ S+I+   +A GD  +  ++  GD YSF
Sbjct  596  KSGDVYSFGRGRYGQLGHGDTEDQYTPKKIESLSDIQA--IAAGDNHSLALTVSGDVYSF  653

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH         N  S +++P+ +  L  +               + H+ ALT
Sbjct  654  GYGRYGQLGHG--------NTDSQLITPKKIEGLSDIQAIAAG---------DNHSLALT  696

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            + G +++FG G  GQLG     NQ     P+++E
Sbjct  697  KSGDVYSFGRGMYGQLGHGDKENQL---TPKKIE  727


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 53/158 (34%), Positives = 84/158 (53%), Gaps = 25/158 (16%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G G +G LGHG+ D +  PK +E  S+I+ +  A GD+ +  +++ GD YSF
Sbjct  102  KSGDVYSFGLGLFGRLGHGDTDSQLEPKKIEGLSDIQAI--AAGDFHSLALTKSGDVYSF  159

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G +S LGH      G     S   +P+ + SL  V                 H+ ALT
Sbjct  160  GNG-TSGLGH------GNTEDQS---TPKKIESLSDVQAIAAG---------GNHSLALT  200

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            + G++++FG G+ G+LG   + +Q E   P+++E DLS
Sbjct  201  KSGEVYSFGMGNSGRLGHGDTDSQLE---PKKIE-DLS  234


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 47/154 (31%), Positives = 75/154 (49%), Gaps = 22/154 (14%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G G YG LGHGN + +  PK +E  S+I+   +A GD+ +  +++ GD YSF
Sbjct  546  KSGDVYSFGRGMYGRLGHGNTENQPKPKKIEGLSDIQA--IAAGDFHSLALTKSGDVYSF  603

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH             +  +P+ + SL  +               + H+ ALT
Sbjct  604  GRGRYGQLGHGDT---------EDQYTPKKIESLSDIQAIAAG---------DNHSLALT  645

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
              G +++FG G  GQLG   + +Q     P+++E
Sbjct  646  VSGDVYSFGYGRYGQLGHGNTDSQL--ITPKKIE  677


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 50/154 (32%), Positives = 79/154 (51%), Gaps = 24/154 (16%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++GWG +G LGHG+ + +  PK +E  S+I+   VA G   +  +++ G+ YSF
Sbjct  251  KSGDVYSFGWGLHGQLGHGDTENQLTPKKIEDLSDIQA--VAAGANHSLALTKSGEVYSF  308

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G +  LGH     D Q       L+P+ +  LK +               + H+ ALT
Sbjct  309  GRGNTGQLGHGDT--DDQ-------LTPKKIEGLKDIQAIAAG---------DFHSLALT  350

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            + G +++FG G  G LG   +ANQ E   P+++E
Sbjct  351  KSGDVYSFGNGTSG-LGHGDTANQLE---PKKIE  380


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 46/154 (30%), Positives = 76/154 (49%), Gaps = 23/154 (15%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G G YG LGHG+++ +  PK +E  ++I+   +A G+  +  +++ GD YSF
Sbjct  697  KSGDVYSFGRGMYGQLGHGDKENQLTPKKIEGLADIQA--IAAGEDQSLALTKSGDVYSF  754

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH      G     S   +P+ + SL  V                 H+ ALT
Sbjct  755  GRGMYGRLGH------GNTEDQS---TPKKIESLSDVQAIAAG---------GNHSLALT  796

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            + G +++FG G  GQLG     +  ++  P+++E
Sbjct  797  KSGDVYSFGYGRYGQLG---HGDTEDQPTPKKIE  827


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 78/158 (49%), Gaps = 25/158 (16%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G G  G LGHGN + +S PK +E+ S+++ +  A G   +  +++ G+ YSF
Sbjct  152  KSGDVYSFGNGTSG-LGHGNTEDQSTPKKIESLSDVQAI--AAGGNHSLALTKSGEVYSF  208

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G S  LGH     D Q       L P+ +  L  +                 H+ ALT
Sbjct  209  GMGNSGRLGHGDT--DSQ-------LEPKKIEDLSDIQAIAAG---------GNHSLALT  250

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            + G +++FG G  GQLG   + NQ     P+++E DLS
Sbjct  251  KSGDVYSFGWGLHGQLGHGDTENQL---TPKKIE-DLS  284


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 45/148 (30%), Positives = 72/148 (49%), Gaps = 24/148 (16%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            ++G G YG LGHG+   + APK +E  S+I+   +A G   +  +++ GD YSFG G   
Sbjct  58   SFGMGMYGKLGHGDTANQLAPKKIEGLSDIQA--IAAGTNHSLALTKSGDVYSFGLGLFG  115

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH     D Q       L P+ +  L  +               + H+ ALT+ G ++
Sbjct  116  RLGHGDT--DSQ-------LEPKKIEGLSDIQAIAAG---------DFHSLALTKSGDVY  157

Query  189  AFGAGDKGQLGVALSANQTERANPERVE  106
            +FG G  G LG     N  +++ P+++E
Sbjct  158  SFGNGTSG-LG---HGNTEDQSTPKKIE  181


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 23/148 (16%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            ++G   YG LGHG++  +  PK +E+ S+++ +  A G   +  +++ GD YSFG G   
Sbjct  502  SFGLDDYGQLGHGDKKNQLEPKKIESLSDVQAI--AAGSKHSLALTKSGDVYSFGRGMYG  559

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH             N   P+ +  L  +               + H+ ALT+ G ++
Sbjct  560  RLGHGNT---------ENQPKPKKIEGLSDIQAIAAG---------DFHSLALTKSGDVY  601

Query  189  AFGAGDKGQLGVALSANQTERANPERVE  106
            +FG G  GQLG     +  ++  P+++E
Sbjct  602  SFGRGRYGQLG---HGDTEDQYTPKKIE  626



>ref|XP_004788941.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Mustela putorius furo]
Length=1124

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+ D E  P +VEA  + K   +A G   T +++EDG  ++FG 
Sbjct  310  GNIYSWGRNDLGQLGLGHTDGEEFPSLVEALDSQKVEFLACGGSHTALLTEDGQVFTFGA  369

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L  +  RV Q++         HT A +++
Sbjct  370  GKHGQLGHNST---------QNELRPRLVTELTGI--RVTQVACGRR-----HTLAYVSD  413

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  414  LGKVFSFGSGKEGQLGNGGTHNQ  436



>gb|EPS68557.1| hypothetical protein M569_06211, partial [Genlisea aurea]
Length=381

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 78/162 (48%), Gaps = 18/162 (11%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            DG    WG   YG LG G+    S P VV+  S++  V +A G + +  ++ DG  Y +G
Sbjct  215  DGTVMAWGNNEYGQLGTGDTQPRSQPVVVQGLSDLNLVDIAAGGWHSTALTIDGQVYGWG  274

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             GE   LG          +  S+ + P+ V  L    E +VQIS   +     H+ ALTE
Sbjct  275  RGEHGRLGFG--------DDKSSKMVPQKVHLL--ATENIVQISCGGT-----HSVALTE  319

Query  204  XGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*PLIR  79
             G++++FG GD G+LG    A      +P  V +++  P  R
Sbjct  320  DGRIYSFGRGDHGRLGYGRKATT---GHPAEVPINVPPPRGR  358


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 11/131 (8%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            ++G+  TWGW + G LGH  E   E+ P  + A S +K V  A G +    V + G AY+
Sbjct  55   ENGKLFTWGWNQRGTLGHPPESKTETVPSQLTALSTVKIVQAAIGGWHCLAVDDQGRAYA  114

Query  390  FGCGESSSLGHNA-VVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
            +G  E    G     V D       +I+ P+           V ++S+        H+  
Sbjct  115  WGGNEYGQCGEEPERVDDADRPVRRDIIIPQRC---------VPKLSVRQVAAGGTHSVV  165

Query  213  LTEXGKLFAFG  181
            LT+ G ++ +G
Sbjct  166  LTQGGHVWTWG  176



>ref|XP_010355204.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Rhinopithecus roxellana]
Length=1022

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ + + +P ++EA  N K   +A G   + ++++DG  ++FG 
Sbjct  208  GNIYSWGKNEFGQLGLGHTESKDSPSLIEALDNQKVEFLACGGSHSALLTQDGLLFTFGA  267

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L  V  +V QI+      W  HT A +++
Sbjct  268  GKHGQLGHNST---------QNELRPCLVAEL--VGNKVTQIACGR---W--HTLAYVSD  311

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G  GQLG   + +Q
Sbjct  312  LGKVFSFGSGKDGQLGNGGTLDQ  334


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/145 (28%), Positives = 67/145 (46%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   +G LG G +    + P++VE  + +    ++ G+  +  ++  G+ YS
Sbjct  153  KGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALTMSGNIYS  212

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E   LG         +    +  SP L+ +L    ++V  ++   S     H+  L
Sbjct  213  WGKNEFGQLG---------LGHTESKDSPSLIEALDN--QKVEFLACGGS-----HSALL  256

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G LF FGAG  GQLG   + N+
Sbjct  257  TQDGLLFTFGAGKHGQLGHNSTQNE  281



>ref|XP_003708187.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Megachile 
rotundata]
Length=4755

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 75/137 (55%), Gaps = 14/137 (10%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DGR  +WG G  G LGHGN      P+++E+  + +   VA G   +  ++  G+ Y++
Sbjct  3013  QDGRVFSWGEGEDGKLGHGNCSSLDKPRLIESLKSKRIRDVACGSGHSAAITSSGELYTW  3072

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G GE   LGH      G  N     L P+LV SL  V +RV+Q++  +    +A T ALT
Sbjct  3073  GLGEYGRLGH------GDTNTQ---LKPKLVQSL--VGQRVIQVACGSR---DAQTMALT  3118

Query  207   EXGKLFAFGAGDKGQLG  157
               G ++++G GD G+LG
Sbjct  3119  ADGSVYSWGDGDFGKLG  3135


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 66/136 (49%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  + V  G   +  ++  G  Y++G
Sbjct  4107  DDNVWSWGDGDYGKLGRGGSDGCKVPMKIESLAGLGVIKVECGSQFSVALTRSGSIYTWG  4166

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH     D  V R      P  V +L+   ++++ I+ T S+    H  A ++
Sbjct  4167  KGDYHRLGHGT---DDHVRR------PRKVAALQ--GKKIISIA-TGSL----HCVACSD  4210

Query  204   XGKLFAFGAGDKGQLG  157
              G++F +G  D+GQLG
Sbjct  4211  KGEVFTWGDNDEGQLG  4226


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 68/136 (50%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G   +WG G  G LGHGN      PK++E     + V VA G + +  ++  G  Y++G
Sbjct  4001  EGHVYSWGEGDDGKLGHGNRLSYDRPKLIEELLGTEIVDVACGGHHSAAITSAGWLYTWG  4060

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L+P+LV +L+    +V+ ++  +    +A T  +T+
Sbjct  4061  KGRYGRLGH---------GDSEDQLTPKLVEALQDY--KVIDVACGSG---DAQTLCVTD  4106

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4107  DDNVWSWGDGDYGKLG  4122


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 67/137 (49%), Gaps = 14/137 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +D    +WG G  G LGHG+      PK++E+  +     +A G   +  +S +G+ Y++
Sbjct  523  EDSSVYSWGNGDGGRLGHGDRTWYEEPKLIESLVDKNITFIACGSTYSAALSSNGELYTW  582

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH             +++ P LV++L      +V ++  +    ++ T  +T
Sbjct  583  GRGNYGRLGH---------GNSDDVMVPTLVSALN--GHMIVYVACGSG---DSQTLCVT  628

Query  207  EXGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  629  ASGIVFSWGDGDYGKLG  645


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 65/139 (47%), Gaps = 18/139 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNE--DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAY  394
             ++G+    G G  G LG G++   CE  P    +   IK V V +G      +++DG  +
Sbjct  2959  QEGKLYACGEGTNGRLGLGDDGNACEPKPIPFLSQYVIKKVAVHSGGKHALALTQDGRVF  3018

Query  393   SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
             S+G GE   LGH            S++  P L+ SLK    R V          + H+ A
Sbjct  3019  SWGEGEDGKLGHGNC---------SSLDKPRLIESLKSKRIRDVACG-------SGHSAA  3062

Query  213   LTEXGKLFAFGAGDKGQLG  157
             +T  G+L+ +G G+ G+LG
Sbjct  3063  ITSSGELYTWGLGEYGRLG  3081


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 60/130 (46%), Gaps = 14/130 (11%)
 Frame = -2

Query  546   WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
             WG      LG         P   E+ S +K VH+A G  T FVVS++G  Y+ G G +  
Sbjct  2914  WGLNDKDQLGGLKGSKIKLPVYSESLSKLKPVHIAGGSKTLFVVSQEGKLYACGEGTNGR  2973

Query  366   LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
             LG   +  DG      N   P+ +  L Q   + V +          H  ALT+ G++F+
Sbjct  2974  LG---LGDDG------NACEPKPIPFLSQYVIKKVAVH-----SGGKHALALTQDGRVFS  3019

Query  186   FGAGDKGQLG  157
             +G G+ G+LG
Sbjct  3020  WGEGEDGKLG  3029


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 68/136 (50%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG   +WG G +G LG G  D    P +V+  + +  V +  G   +  +++ G+ +++G
Sbjct  3120  DGSVYSWGDGDFGKLGRGGSDGCYTPLLVDRLNGLGVVQIECGAQFSLALTKYGEVWTWG  3179

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH         N H ++  P LV  L+   ++V+ +++        H  A+T+
Sbjct  3180  KGDYFRLGHG--------NDH-HVRKPTLVEGLR--GKKVIHVAVG-----ALHCLAVTD  3223

Query  204   XGKLFAFGAGDKGQLG  157
              G+++A+G  D GQ G
Sbjct  3224  TGQVYAWGDNDHGQQG  3239


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 64/134 (48%), Gaps = 16/134 (12%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            +WG G YG LG G  +    PK+V+   +I    V  G   +  ++  G+ Y++G GE+ 
Sbjct  635  SWGDGDYGKLGRGGCNGSKTPKIVDKLLDINVAKVYCGGQFSAALTAYGEVYTWGKGEAY  694

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH             ++  P+ + +LK   ++V ++ +      + H  ALTE   ++
Sbjct  695  RLGH---------GNEEHVRYPKAIEALK--TKKVKELCVG-----SLHVLALTEDQLVY  738

Query  189  AFGAGDKGQLGVAL  148
             +G  D GQ+  AL
Sbjct  739  GWGRNDYGQIDPAL  752



>gb|EEZ97761.1| hect domain and RLD 2-like protein [Tribolium castaneum]
Length=3894

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++EA  + K   +A G   +  ++  G+ Y++G
Sbjct  2160  DGKVFSWGEGEDGKLGHGNRLNLDKPKMIEALRSKKIRDIACGSSHSAAITSSGELYTWG  2219

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH   +           L P+L+ SL  V  R+VQ++  +    +A T ALT+
Sbjct  2220  LGEYGRLGHGDNITQ---------LKPKLIKSL--VGHRIVQVACGSR---DAQTLALTD  2265

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  2266  EGWVFSWGDGDFGKLG  2281


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 65/136 (48%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G  G LGHGN      PK++EA    + + +A G   +  ++  G  Y++G
Sbjct  3136  DNDVYSWGEGDDGKLGHGNRLACETPKLIEALQGYEIIDIACGGAHSAAITSTGQLYTWG  3195

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+L+  L  V  +V+ ++  +    +A T  +T+
Sbjct  3196  KGRYGRLGHGD---------SEDQLKPKLIEEL--VGYKVIDVACGSG---DAQTLCITD  3241

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  3242  DDNVWSWGDGDYGKLG  3257


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 67/136 (49%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    PK +E+ + +  + V  G   +  ++  G  Y++G
Sbjct  3242  DDNVWSWGDGDYGKLGRGGSDGCKVPKKIESLAGLGVIKVECGSQFSVALTRSGSVYTWG  3301

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH             ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  3302  KGDYHRLGHGT---------GEHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  3345

Query  204   XGKLFAFGAGDKGQLG  157
              G++F +G  D+GQLG
Sbjct  3346  EGEVFTWGDNDEGQLG  3361


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 9/112 (8%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G Y  LGHG++     P V+E+  + K +HVA G      V++ G  Y++
Sbjct  2317  KTGEVWTWGKGDYFRLGHGSDQHVRKPTVIESLKDKKVIHVAVGALHCLAVTDTGQVYAW  2376

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYW  232
             G  +    G+   +    VNR      P LV  L+ V    V    ++SI W
Sbjct  2377  GDNDHGQQGNGTTI----VNR-----KPALVHGLEDVHINRVACGSSHSIAW  2419


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 70/136 (51%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G   +WG G +G LG G  +  + P  +E  + ++ V +  G   +  +++ G+ +++G
Sbjct  2266  EGWVFSWGDGDFGKLGRGGSEGCNIPHNIERLNALEVVQIECGAQFSLALTKTGEVWTWG  2325

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH +   D  V +      P ++ SLK   ++V+ +++        H  A+T+
Sbjct  2326  KGDYFRLGHGS---DQHVRK------PTVIESLKD--KKVIHVAVG-----ALHCLAVTD  2369

Query  204   XGKLFAFGAGDKGQLG  157
              G+++A+G  D GQ G
Sbjct  2370  TGQVYAWGDNDHGQQG  2385



>ref|XP_008459465.1| PREDICTED: ultraviolet-B receptor UVR8 [Cucumis melo]
Length=387

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 77/163 (47%), Gaps = 17/163 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  +++ G+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPIPVQGLSGLTLVDIAAGGWHSTALTDSGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E +VQ+S   +     H+ A+T
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMVPQKVQLLS--GEEIVQVSCGGT-----HSVAVT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*PLIR  79
              G++F+FG GD G+LG      +     PE V +D+  P  R
Sbjct  320  SDGRMFSFGRGDHGRLGY---GRKVTTGQPEEVPIDIPPPRGR  359


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 81/194 (42%), Gaps = 44/194 (23%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGH-GNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            +DG+  TWGW + G LGH      E+ P  V+A SN+K V  A G +    V + G AY+
Sbjct  55   EDGKLFTWGWNQRGTLGHPAGTKSENVPSQVKALSNVKIVQAAIGGWHCLAVDDQGRAYA  114

Query  390  FG------CGES------------------------------SSLGHNAVV--XDGQVNR  325
            +G      CGE                               ++ G ++VV   +G V  
Sbjct  115  WGGNEYGQCGEEPEKKDDTGRPPRRDIAIPQRCAPKLIVRQVAAGGTHSVVLTREGHVWT  174

Query  324  HSNILSPELVTSLKQVXERVVQISLTNSIYWNA-HTFALTEXGKLFAFGAGDKGQLGVAL  148
                  P  +T +  V  RV  + +   I   A H  AL E G L+A+G  + GQLG   
Sbjct  175  WGQPWPPGDITQIS-VPVRVQGLDMVRLIAVGAFHNLALQEDGTLWAWGNNEYGQLG---  230

Query  147  SANQTERANPERVE  106
            + +   R+ P  V+
Sbjct  231  TGDTQPRSQPIPVQ  244



>ref|XP_008199122.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HERC2 
[Tribolium castaneum]
Length=4782

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++EA  + K   +A G   +  ++  G+ Y++G
Sbjct  3048  DGKVFSWGEGEDGKLGHGNRLNLDKPKMIEALRSKKIRDIACGSSHSAAITSSGELYTWG  3107

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH   +           L P+L+ SL  V  R+VQ++  +    +A T ALT+
Sbjct  3108  LGEYGRLGHGDNITQ---------LKPKLIKSL--VGHRIVQVACGSR---DAQTLALTD  3153

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  3154  EGWVFSWGDGDFGKLG  3169


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 67/134 (50%), Gaps = 16/134 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G+  +WG G YG LG G  D    P+++E   N+K V V  G   +  +SEDG  Y++G 
Sbjct  666  GKVYSWGDGDYGKLGRGGSDGSKLPRLIEKLQNVKIVQVYCGAQFSVALSEDGHVYTWGK  725

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            GE   LGH             N+  PE+V  L+    +VV +SL  S     H  ALT+ 
Sbjct  726  GEGWKLGHPT---------EENVRFPEMVEVLRD--RKVVGVSLGVS-----HVLALTDQ  769

Query  201  GKLFAFGAGDKGQL  160
            G+++ +G  +  Q+
Sbjct  770  GEVYGWGKNENKQI  783


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 14/137 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            KD    +WG G  G LGHG+   +  P +++A      + V  G   +  +S +G  Y++
Sbjct  558  KDYEVYSWGNGDGGRLGHGDTSTKEEPTLIQALKGKDIIDVECGGTYSAAISANGALYTW  617

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH             + L+P ++++L    E +++++   S Y  AHT  +T
Sbjct  618  GRGNYGRLGHGTA---------EDCLTPTMISALSD--EHIIKVA-CGSFY--AHTLCIT  663

Query  207  EXGKLFAFGAGDKGQLG  157
              GK++++G GD G+LG
Sbjct  664  SQGKVYSWGDGDYGKLG  680


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 65/136 (48%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G  G LGHGN      PK++EA    + + +A G   +  ++  G  Y++G
Sbjct  4024  DNDVYSWGEGDDGKLGHGNRLACETPKLIEALQGYEIIDIACGGAHSAAITSTGQLYTWG  4083

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+L+  L  V  +V+ ++  +    +A T  +T+
Sbjct  4084  KGRYGRLGH---------GDSEDQLKPKLIEEL--VGYKVIDVACGSG---DAQTLCITD  4129

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4130  DDNVWSWGDGDYGKLG  4145


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 67/136 (49%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    PK +E+ + +  + V  G   +  ++  G  Y++G
Sbjct  4130  DDNVWSWGDGDYGKLGRGGSDGCKVPKKIESLAGLGVIKVECGSQFSVALTRSGSVYTWG  4189

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH             ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  4190  KGDYHRLGHGT---------GEHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  4233

Query  204   XGKLFAFGAGDKGQLG  157
              G++F +G  D+GQLG
Sbjct  4234  EGEVFTWGDNDEGQLG  4249


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 9/112 (8%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G Y  LGHG++     P V+E+  + K +HVA G      V++ G  Y++
Sbjct  3205  KTGEVWTWGKGDYFRLGHGSDQHVRKPTVIESLKDKKVIHVAVGALHCLAVTDTGQVYAW  3264

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYW  232
             G  +    G+   +    VNR      P LV  L+ V    V    ++SI W
Sbjct  3265  GDNDHGQQGNGTTI----VNR-----KPALVHGLEDVHINRVACGSSHSIAW  3307


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 70/136 (51%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G   +WG G +G LG G  +  + P  +E  + ++ V +  G   +  +++ G+ +++G
Sbjct  3154  EGWVFSWGDGDFGKLGRGGSEGCNIPHNIERLNALEVVQIECGAQFSLALTKTGEVWTWG  3213

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH +   D  V +      P ++ SLK   ++V+ +++        H  A+T+
Sbjct  3214  KGDYFRLGHGS---DQHVRK------PTVIESLKD--KKVIHVAVG-----ALHCLAVTD  3257

Query  204   XGKLFAFGAGDKGQLG  157
              G+++A+G  D GQ G
Sbjct  3258  TGQVYAWGDNDHGQQG  3273



>pdb|4O2W|A Chain A, Crystal Structure Of The Third Rcc1-like Domain Of Herc1
 pdb|4O2W|B Chain B, Crystal Structure Of The Third Rcc1-like Domain Of Herc1
 pdb|4O2W|C Chain C, Crystal Structure Of The Third Rcc1-like Domain Of Herc1
 pdb|4O2W|D Chain D, Crystal Structure Of The Third Rcc1-like Domain Of Herc1
Length=404

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 80/156 (51%), Gaps = 20/156 (13%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            + G   +WG G YG LGHGN D +  P+ +EA    + V ++ G   + VV+ DG  ++F
Sbjct  143  ESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTF  202

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG         +   SN   PE VT+L+      V   L        HT A++
Sbjct  203  GNGDYGRLG---------LGNTSNKKLPERVTALEGYQIGQVACGLN-------HTLAVS  246

Query  207  EXGKL-FAFGAGDKGQLGVALSANQTERANPERVEV  103
              G + +AFG GD G+LG+    N T +++P++++V
Sbjct  247  ADGSMVWAFGDGDYGKLGL---GNSTAKSSPQKIDV  279


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 70/155 (45%), Gaps = 22/155 (14%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVAT---GDYTTFVVSEDGDAY  394
            +G     G G YG LG GN D      V+ A        + T    D  +  ++E G+ +
Sbjct  89   NGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVF  148

Query  393  SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
            S+G G+   LGH      G  +R      P  + +L+   E VVQ+S         H+  
Sbjct  149  SWGDGDYGKLGH------GNSDRQRR---PRQIEALQ--GEEVVQMSCGFK-----HSAV  192

Query  213  LTEXGKLFAFGAGDKGQLGVALSANQTERANPERV  109
            +T  GKLF FG GD G+LG+    N + +  PERV
Sbjct  193  VTSDGKLFTFGNGDYGRLGL---GNTSNKKLPERV  224


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 16/131 (12%)
 Frame = -2

Query  546  WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
            +G G YG LG GN   +S+P+ ++    I    VA G   +  +++DG  Y+F  G+   
Sbjct  255  FGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHVYTF--GQDRL  312

Query  366  LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
            +G    + +G+   H+    P+ +  L  V    V +          HT AL   G ++A
Sbjct  313  IG----LPEGRARNHNR---PQQIPVLAGVIIEDVAVGAE-------HTLALASNGDVYA  358

Query  186  FGAGDKGQLGV  154
            +G+  +GQLG+
Sbjct  359  WGSNSEGQLGL  369



>ref|XP_002602062.1| hypothetical protein BRAFLDRAFT_94436 [Branchiostoma floridae]
 gb|EEN58074.1| hypothetical protein BRAFLDRAFT_94436, partial [Branchiostoma 
floridae]
Length=3971

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 52/155 (34%), Positives = 78/155 (50%), Gaps = 20/155 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             + G   +WG G YG LGHGN D +  P+ +EA    + + +A G   + VVS DG  ++F
Sbjct  3285  ESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEIIQMACGFKHSAVVSADGKLFTF  3344

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LG         +   SN   PE VT+L+      V   L        HT A++
Sbjct  3345  GNGDYGRLG---------LGNTSNKKIPERVTALEGQMVGQVGCGLN-------HTLAVS  3388

Query  207   EXGK-LFAFGAGDKGQLGVALSANQTERANPERVE  106
               G  +++FG GD G+LG+    N T ++ P+RV+
Sbjct  3389  ADGNTVWSFGDGDYGKLGL---GNSTAKSTPQRVD  3420


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 43/148 (29%), Positives = 68/148 (46%), Gaps = 22/148 (15%)
 Frame = -2

Query  543   GWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVAT---GDYTTFVVSEDGDAYSFGCGES  373
             G G YG LG GN D      ++ A        + T    D  +  ++E G+ +S+G G+ 
Sbjct  3238  GEGSYGRLGQGNSDDLHQLTIISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDY  3297

Query  372   SSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKL  193
               LGH      G  +R      P  + +L+   E ++Q++         H+  ++  GKL
Sbjct  3298  GKLGH------GNSDRQRR---PRQIEALQ--GEEIIQMACGFK-----HSAVVSADGKL  3341

Query  192   FAFGAGDKGQLGVALSANQTERANPERV  109
             F FG GD G+LG+    N + +  PERV
Sbjct  3342  FTFGNGDYGRLGL---GNTSNKKIPERV  3366



>ref|XP_004928781.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2-like [Bombyx 
mori]
Length=5209

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 72/136 (53%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      P++++A S  + V VA G   +  V+  G  Y++G
Sbjct  3011  DGKVYSWGEGEDGKLGHGNRLTLEVPRLIDALSGERVVSVACGSAHSACVTARGHLYTWG  3070

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH   +           L P++V +L     RV+Q++  +    +A T ALT 
Sbjct  3071  LGEYGRLGHRDNITQ---------LVPKMVEALANF--RVIQVACGSR---DAQTLALTA  3116

Query  204   XGKLFAFGAGDKGQLG  157
              GK+F++G GD G+LG
Sbjct  3117  CGKVFSWGDGDFGKLG  3132


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 66/135 (49%), Gaps = 16/135 (12%)
 Frame = -2

Query  561   GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             G+  +WG G +G LG G  D  + P  +E  +++  V V  G   +  ++ DG+ +++G 
Sbjct  3118  GKVFSWGDGDFGKLGRGGSDGCAVPMNIERLNSLGVVQVECGAQFSLALTRDGEVWTWGK  3177

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G+   LGH     D  V R      P LV +L+    RVV +++        H  A+T  
Sbjct  3178  GDYFRLGHGC---DAHVRR------PTLVEALR--GRRVVHVAVG-----ALHCLAVTSD  3221

Query  201   GKLFAFGAGDKGQLG  157
              +++A+G  D GQ G
Sbjct  3222  HQVWAWGDNDHGQQG  3236


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 55/131 (42%), Gaps = 14/131 (11%)
 Frame = -2

Query  549   TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
              WG      LG         P      S ++ VH+A G  T F+VS DG  Y+ G G + 
Sbjct  2910  VWGLNDKDQLGGVKGSKVKVPVFSPVLSALRPVHIAGGSKTLFIVSHDGKLYACGEGTNG  2969

Query  369   SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
              LG         +   +N+ +P     L  V  R V +          H  ALT  GK++
Sbjct  2970  RLG---------LGHSNNVSTPRANPYLSHVLVRKVAVHSGGK-----HALALTADGKVY  3015

Query  189   AFGAGDKGQLG  157
             ++G G+ G+LG
Sbjct  3016  SWGEGEDGKLG  3026


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 67/138 (49%), Gaps = 18/138 (13%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNI--KXVHVATGDYTTFVVSEDGDAYS  391
             DG+    G G  G LG G+ +  S P+     S++  + V V +G      ++ DG  YS
Sbjct  2957  DGKLYACGEGTNGRLGLGHSNNVSTPRANPYLSHVLVRKVAVHSGGKHALALTADGKVYS  3016

Query  390   FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             +G GE   LGH         NR + +  P L+ +L    ERVV ++       +AH+  +
Sbjct  3017  WGEGEDGKLGHG--------NRLT-LEVPRLIDALS--GERVVSVACG-----SAHSACV  3060

Query  210   TEXGKLFAFGAGDKGQLG  157
             T  G L+ +G G+ G+LG
Sbjct  3061  TARGHLYTWGLGEYGRLG  3078



>ref|XP_004516679.1| PREDICTED: ultraviolet-B receptor UVR8-like [Cicer arietinum]
Length=394

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  ++++G+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPIPVQGLSGLTLVDIAAGGWHSTALTDEGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG       G  ++ S +L P+ V  L    E +VQ+S   +     H+ AL+
Sbjct  274  GRGEHGRLGF------GDSDKSSKML-PQRVQLL--TGEEIVQVSCGGT-----HSVALS  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F+FG GD G+LG      +     P  V +D+S P
Sbjct  320  RDGRIFSFGRGDHGRLGY---GRKVTTGQPMEVPIDISPP  356


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 77/192 (40%), Gaps = 42/192 (22%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DG+  TWGW + G LGH  E   E+ P  V+A ++++ V  A G +    V + G AY++
Sbjct  56   DGKLFTWGWNQRGTLGHPPETKTENIPSQVKALAHVQIVQAAIGGWHCLAVDDHGRAYAW  115

Query  387  GCGESSSLGHNAVVXD--GQVNRHSNIL----SPELVT----------------------  292
            G  E    G      D  G+  R   ++    +P+LV                       
Sbjct  116  GGNEYGQCGEEPERKDDTGRPLRRDIMIPQRCAPKLVVRQVAAGGTHSVVLTREGHVWTW  175

Query  291  -------SLKQVXERVVQISLTNSIYWNA---HTFALTEXGKLFAFGAGDKGQLGVALSA  142
                    +KQ+   V    L N         H  AL E G L+A+G  + GQLG   + 
Sbjct  176  GQPWPPGDIKQISVPVRVQGLENVRLIAVGAFHNLALQEDGTLWAWGNNEYGQLG---TG  232

Query  141  NQTERANPERVE  106
            +   R+ P  V+
Sbjct  233  DTQPRSQPIPVQ  244



>ref|XP_002305965.2| hypothetical protein POPTR_0004s10130g [Populus trichocarpa]
 gb|EEE86476.2| hypothetical protein POPTR_0004s10130g [Populus trichocarpa]
Length=389

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P +V+  S +  V +A G + +  +++DG+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPILVQGLSGLNLVDIAAGGWHSTALTDDGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   +G          N  S+ + P+ V  L    E ++Q+S   +     H+ ALT
Sbjct  274  GRGEHGRMGFGD-------NDKSSKMVPQKVNLL--AGEDIIQVSCGGT-----HSVALT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F+FG GD G+LG   +    +   P  V +D+  P
Sbjct  320  RDGQMFSFGRGDHGRLGYGRNVTTGQ---PMEVPLDIPPP  356


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 63/151 (42%), Gaps = 13/151 (9%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DG+  TWGW + G LGH  E   E+ P  V+A +N+  V  A G +    V + G AYS+
Sbjct  56   DGKLFTWGWNQRGTLGHPPETKTENIPSQVKALANVNIVQAAIGGWHCLAVDDQGRAYSW  115

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G  E    G        + N     L  ++V   +     VV+           H+  LT
Sbjct  116  GGNEYGQCGEEPE----RKNDTGRPLRRDIVIPQRCASNLVVRQVAAGG----THSVVLT  167

Query  207  EXGKLFAFG----AGDKGQLGVALSANQTER  127
              G ++ +G     GD  Q+ V +     ER
Sbjct  168  REGHVWTWGQPWPPGDIKQISVPVRVQGLER  198



>ref|XP_001661249.1| AAEL002306-PA [Aedes aegypti]
 gb|EAT46534.1| AAEL002306-PA [Aedes aegypti]
Length=4837

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 78/153 (51%), Gaps = 19/153 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++E+    +   +A G   +  ++  G+ Y++G
Sbjct  2997  DGKVFSWGEGEDGKLGHGNRLTLEKPKLIESLRTKRVRDIACGSSHSAAITSSGELYTWG  3056

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           +   L P+LVT+L+    RVVQ++  +    +A T  LTE
Sbjct  3057  LGEYGRLGH---------GDNCTQLKPKLVTTLQ--GHRVVQVACGSR---DAQTLCLTE  3102

Query  204   XGKLFAFGAGDKGQLGVALS-----ANQTERAN  121
              G +F++G GD G+LG   S      +Q ER N
Sbjct  3103  EGLVFSWGDGDFGKLGRGGSEGCSVPHQVERLN  3135


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 69/136 (51%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG   +WG G  G LGHGN D    PK++EA S I  + +A G   +  ++  G   ++G
Sbjct  4042  DGEVFSWGEGEDGKLGHGNRDSYDRPKLIEALSGIGVIDIACGSAHSACITSQGHVLTWG  4101

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH     D +     + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4102  KGRYGRLGHG----DSE-----DQLQPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4147

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4148  DDNVWSWGDGDYGKLG  4163


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 67/155 (43%), Gaps = 25/155 (16%)
 Frame = -2

Query  558   RXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCG  379
             +   WG      LG         P      S +K +H+A G  + F+VS+DG  Y+  CG
Sbjct  2893  KVLVWGLNDKEQLGGLKGSKVKLPTYSSVLSQLKPIHIAGGSKSLFIVSQDGKLYA--CG  2950

Query  378   ESSS----LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             E ++    LGHN           +N+ +P  V  L Q   + V +          H  AL
Sbjct  2951  EGTNGRLGLGHN-----------NNVPTPRQVPILNQYVVKKVAVH-----SGGKHAMAL  2994

Query  210   TEXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             T  GK+F++G G+ G+LG     N+     P+ +E
Sbjct  2995  TLDGKVFSWGEGEDGKLG---HGNRLTLEKPKLIE  3026


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             + G   TWG G Y  LGHGN D    PK V A    K + +ATG       S+ G+ +++
Sbjct  4199  RSGSVYTWGKGDYHRLGHGNTDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVFTW  4258

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV SL+   + +V++     I  +AHT AL+
Sbjct  4259  GDNDEGQLG------DGTV---TAIQRPRLVQSLQ--GKHIVKV-----ICGSAHTLALS  4302


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 66/136 (49%), Gaps = 16/136 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  + V  G   +  ++  G  Y++G
Sbjct  4148  DDNVWSWGDGDYGKLGRGGSDGCKIPMKIESLAGLGVIKVECGSQFSVALTRSGSVYTWG  4207

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH             ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  4208  KGDYHRLGHGNT---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  4251

Query  204   XGKLFAFGAGDKGQLG  157
              G++F +G  D+GQLG
Sbjct  4252  SGEVFTWGDNDEGQLG  4267


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 78/179 (44%), Gaps = 54/179 (30%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYSF  388
            G   TWG G YG LGHGN D +  P  V+A  + K V VA  +GD  +  V+++G  +++
Sbjct  639  GELFTWGRGTYGRLGHGNSDDKLVPTQVQALKSYKVVDVALGSGDAHSMCVTDNGLLFAW  698

Query  387  GCGESSSLGHNA-------VVXDGQVN---------------------------------  328
            G G+   LG+ +       V  D  VN                                 
Sbjct  699  GDGDFGKLGNGSCNGSPIPVQIDTLVNVSRIYSGSQFSVALSCDGTLYTWGKGHGGRLGH  758

Query  327  ---RHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFAFGAGDKGQL  160
                HSN+  P+LV +L+   +++  +++      +AH  ALT  G+L+ +G  D  Q+
Sbjct  759  GNSEHSNV--PKLVRALE--GKKIADVAVG-----SAHCLALTSSGELYGWGRNDYQQI  808



>ref|XP_011403674.1| PREDICTED: E3 ubiquitin-protein ligase HERC2 [Amphimedon queenslandica]
Length=4702

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 76/138 (55%), Gaps = 16/138 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            KDG+  +WG G  G LG GN + ++AP  V A S  + VH++ G   +  V+EDG  Y++
Sbjct  525  KDGKVYSWGQGSNGVLGIGNTESQTAPTAVAALSGDRIVHISAGSMHSAAVTEDGVLYTW  584

Query  387  GCGESSSLGH-NAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            G G    LGH NA           + L P +V  L  V  ++VQ+   +    +AHT AL
Sbjct  585  GKGSYGRLGHGNA----------EDKLIPTIVEGLNGV--KIVQVDCGSG---DAHTLAL  629

Query  210  TEXGKLFAFGAGDKGQLG  157
             + G+++++G GD G+LG
Sbjct  630  DDTGQVWSWGDGDYGKLG  647


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 73/145 (50%), Gaps = 15/145 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G+YG LGHG+      PK++E         V+ G   +  VS +G+ +++G
Sbjct  3030  DGKVFSWGDGQYGQLGHGSLQSYDRPKMIEIFQAKHIREVSCGTGHSAAVSVNGELFTWG  3089

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH      G  N   N   P+LV +L++     V+IS       NAHT A  +
Sbjct  3090  QGADGRLGH------GDSN---NQTKPKLVRALEK-----VRISCVACGSRNAHTLAAGD  3135

Query  204   XGKLFAFGAGDKGQLGVALSANQTE  130
                L+A+G G  G+LG+   ++ T+
Sbjct  3136  -NSLWAWGDGSFGKLGLKDGSSSTD  3159


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 72/154 (47%), Gaps = 21/154 (14%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXS--NIKXVHVATGDYTTFVVSEDGDAYS  391
             DG   TWG GRYG LGH + + +  PK+V A     +  V   +GD  T   +  G  +S
Sbjct  4001  DGSLYTWGKGRYGRLGHNDHETQHKPKLVSALKGEQVTCVACGSGDAQTLCATASGCVFS  4060

Query  390   FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             +G G+   LG          N  S +  P+ + SL    + V+++ L  S +    + AL
Sbjct  4061  WGDGDYGKLGRGG-------NEGSKV--PKKIDSL--TGKHVIKL-LCGSQF----SMAL  4104

Query  210   TEXGKLFAFGAGDKGQLGVALSANQTERANPERV  109
             T  G ++ +G GD  +LG     + + +  P RV
Sbjct  4105  TTAGHVYTWGKGDYYRLG---HGDDSHQRTPRRV  4135


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 63/135 (47%), Gaps = 14/135 (10%)
 Frame = -2

Query  561   GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             G    WG G  G LG G     + P ++E+  +   +    G   +  +++DG  Y++G 
Sbjct  3950  GELYAWGEGEDGKLGLGTTVNMNVPHLIESLKSKHVIDAGCGSSHSACITDDGSLYTWGK  4009

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G    LGH         N H     P+LV++LK   E+V  ++  +    +A T   T  
Sbjct  4010  GRYGRLGH---------NDHETQHKPKLVSALK--GEQVTCVACGSG---DAQTLCATAS  4055

Query  201   GKLFAFGAGDKGQLG  157
             G +F++G GD G+LG
Sbjct  4056  GCVFSWGDGDYGKLG  4070


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 69/159 (43%), Gaps = 25/159 (16%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAX-SNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            G+  +WG G YG LG    D    PK +    S    V +  G+  +  +++DG  YS+G
Sbjct  633  GQVWSWGDGDYGKLGRPGSDQNKVPKPISGIGSTSPVVKIICGNQISMALTKDGKLYSWG  692

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQV--------XERVVQISLTNSIY-W  232
            CG++  LGH             ++  P+L+  L +          +  V ++  + +Y W
Sbjct  693  CGDTYQLGH---------GNQEHVRQPKLIEGLSETVVSDVSVGAQHCVALTTDSDVYAW  743

Query  231  NAH-TFALTEXG-----KLFAFGAGDKGQLGVALSANQT  133
              + +F + E G      L    A  KG L +A  A++T
Sbjct  744  GKNSSFEVNESGDIISSPLMIEAASGKGALLIACGASET  782



>ref|XP_011099566.1| PREDICTED: ultraviolet-B receptor UVR8 [Sesamum indicum]
Length=394

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 18/159 (11%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            DG    WG   YG LG G+    S P  V+  S++  V +A G + +  +++DG+ Y +G
Sbjct  215  DGTLMAWGNNEYGQLGTGDTQPRSQPIAVQGLSDLNLVDIAAGGWHSTALTDDGEVYGWG  274

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             GE   LG          +  S+ + P+ V  L  V E +VQ+S   +     H+ ALT 
Sbjct  275  RGEHGRLGFG--------DDKSSKMVPQRVQLL--VGEDIVQVSCGGT-----HSVALTR  319

Query  204  XGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
             G++++FG GD G+LG      +    +P  V +++  P
Sbjct  320  DGRMYSFGRGDHGRLGY---GRKVTTGHPAEVPINIPPP  355


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 60/132 (45%), Gaps = 13/132 (10%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            ++G+  TWGW + G LGH  E   E+ P  V+A S++K V  A G +    V + G AY+
Sbjct  55   ENGKLFTWGWNQRGTLGHPPETKTENVPSQVKALSSVKIVQAAIGGWHCLAVDDQGRAYA  114

Query  390  FGCGESSSLGHNAVVXD--GQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTF  217
            +G  E    G      D  G+  R   ++    V  L      V Q++   +     H+ 
Sbjct  115  WGGNEYGQCGEEPERKDDTGRPVRRDIVIPQRCVPKLS-----VRQVAAGGT-----HSV  164

Query  216  ALTEXGKLFAFG  181
             LT  G ++ +G
Sbjct  165  VLTREGHVWTWG  176



>ref|XP_002516745.1| Ran GTPase binding protein, putative [Ricinus communis]
 gb|EEF45643.1| Ran GTPase binding protein, putative [Ricinus communis]
Length=393

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 76/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S +  V +A G + +  +++DG+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPIPVQGLSGLTLVDIAAGGWHSTALTDDGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E +VQ+S   +     H+ ALT
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMVPQKVNLL--AGEDIVQLSCGGT-----HSVALT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
            + G++F+FG GD G+LG      +     P  V  D+  P
Sbjct  320  QDGRMFSFGRGDHGRLGY---GKKVTTGQPVEVPTDIPPP  356


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 78/192 (41%), Gaps = 42/192 (22%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DG+  TWGW + G LGH  E   E+ P  V+A +N+  V  A G +    V + G AY++
Sbjct  56   DGKLFTWGWNQRGTLGHPAETKTENIPSQVKALNNVNIVQAAIGGWHCLAVDDQGRAYAW  115

Query  387  GCGESSSLGHNAVVXD--GQVNRHSNIL----SPELVT----------------------  292
            G  E    G      D  G+  R   ++    +P+LV                       
Sbjct  116  GGNEYGQCGEEPERKDDTGKTLRRDIVIPQRCAPKLVVRQVAAGGTHSVVLTREGHVWTW  175

Query  291  -------SLKQ--VXERVVQISLTNSIYWNA-HTFALTEXGKLFAFGAGDKGQLGVALSA  142
                    +KQ  V  RV  +     I   A H  AL E G L+A+G  + GQLG   + 
Sbjct  176  GQPWPPGDIKQISVPVRVQGLEKVKLIAVGAFHNLALQEDGTLWAWGNNEYGQLG---TG  232

Query  141  NQTERANPERVE  106
            +   R+ P  V+
Sbjct  233  DTQPRSQPIPVQ  244



>ref|XP_002283479.1| PREDICTED: ultraviolet-B receptor UVR8 [Vitis vinifera]
 emb|CBI33673.3| unnamed protein product [Vitis vinifera]
Length=395

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 77/157 (49%), Gaps = 18/157 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  V+  S++  V +A G + +  +++DG  Y +
Sbjct  215  EDGILWAWGNNEYGQLGTGDTQPRSQPIAVQGLSDLTLVDIAAGGWHSTALTDDGGVYGW  274

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          +  S+ + P+ V  L  V E +VQIS   +     H+ ALT
Sbjct  275  GRGEHGRLGFG--------DDKSSKMVPQKVQLL--VEENIVQISCGGT-----HSVALT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
              G++F+FG GD G+LG      +    +P  V ++L
Sbjct  320  RDGRMFSFGRGDHGRLGY---GRKVTTGHPMEVPINL  353


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 80/196 (41%), Gaps = 48/196 (24%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            +DG+  TWGW + G LGH  E   E+ P  V+A +N K V  A G +    V + G AY+
Sbjct  56   EDGKLFTWGWNQRGTLGHPPETKTENIPSQVKALANAKIVQAAIGGWHCLAVDDQGRAYA  115

Query  390  FG------CGE----------------------SSSLGHNAVVXDGQVNRHSNILS----  307
            +G      CGE                      +S L    V   G    HS +L+    
Sbjct  116  WGGNEYGQCGEEPERKDDTGRPLRRDITIPQRCASKLSVRQVAAGGT---HSVVLTREGH  172

Query  306  ------PELVTSLKQVXE--RVVQISLTNSIYWNA-HTFALTEXGKLFAFGAGDKGQLGV  154
                  P     +KQ+    RV  +     I   A H  AL E G L+A+G  + GQLG 
Sbjct  173  VWTWGQPWPPGDIKQISTPVRVQGLEKVRLIAVGAFHNLALLEDGILWAWGNNEYGQLG-  231

Query  153  ALSANQTERANPERVE  106
              + +   R+ P  V+
Sbjct  232  --TGDTQPRSQPIAVQ  245



>ref|XP_003310459.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Pan troglodytes]
Length=957

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ + +  P ++E   N K   VA G   + ++++DG  ++FG 
Sbjct  143  GNIYSWGKNEFGQLGLGHTESKDYPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGA  202

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L  V  RV QI+      W  HT A +++
Sbjct  203  GKHGQLGHNST---------QNELRPCLVAEL--VEYRVTQIACGR---W--HTLAYVSD  246

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G  GQLG   + +Q
Sbjct  247  LGKVFSFGSGKDGQLGNGGTRDQ  269


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 39/143 (27%), Positives = 64/143 (45%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            G    WG   +G LG G +    + P++VE  + +    ++ G+  +  +S  G+ YS+G
Sbjct  90   GELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYSWG  149

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              E   LG         +    +   P L+  L    ++V  ++   S     H+  LT+
Sbjct  150  KNEFGQLG---------LGHTESKDYPSLIEGLDN--QKVEFVACGGS-----HSALLTQ  193

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             G LF FGAG  GQLG   + N+
Sbjct  194  DGLLFTFGAGKHGQLGHNSTQNE  216



>ref|XP_008961909.1| PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--protein ligase HERC5 
[Pan paniscus]
Length=1024

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ + +  P ++E   N K   VA G   + ++++DG  ++FG 
Sbjct  210  GNIYSWGKNEFGQLGLGHTESKDYPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGA  269

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L  V  RV QI+      W  HT A +++
Sbjct  270  GKHGQLGHNST---------QNELRPCLVAEL--VEYRVTQIACGR---W--HTLAYVSD  313

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G  GQLG   + +Q
Sbjct  314  LGKVFSFGSGKDGQLGNGGTRDQ  336


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 40/145 (28%), Positives = 65/145 (45%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   +G LG G +    + P++VE  + +    ++ G+  +  +S  G+ YS
Sbjct  155  KGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYS  214

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E   LG         +    +   P L+  L    ++V  ++   S     H+  L
Sbjct  215  WGKNEFGQLG---------LGHTESKDYPSLIEGLDN--QKVEFVACGGS-----HSALL  258

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G LF FGAG  GQLG   + N+
Sbjct  259  TQDGLLFTFGAGKHGQLGHNSTQNE  283



>ref|XP_011280084.1| PREDICTED: LOW QUALITY PROTEIN: E3 ISG15--protein ligase HERC5 
[Felis catus]
Length=1031

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D +  P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  216  GNIYSWGRNDFGQLGLGHTDGKDFPSLIEALDNQKVEFLACGGSHTALLTKDGLVFTFGA  275

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV QI+         HT A +++
Sbjct  276  GKHGQLGHNST---------QNELRPRLVTEL--AGNRVTQIACGRQ-----HTLAYVSD  319

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  320  LGKVFSFGSGKEGQLGNGGTHNQ  342



>gb|EHJ72511.1| hypothetical protein KGM_11261 [Danaus plexippus]
Length=4305

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 74/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN     AP+++E+ +  + + +A G   +  V+  G  Y++G
Sbjct  3162  DGKVYSWGEGEDGKLGHGNRITLEAPRLIESLAGERVISIACGSAHSACVTARGHLYTWG  3221

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH     D  +      L P++V +L     RV+Q++  +    +A T ALT 
Sbjct  3222  LGEYGRLGHG----DDNIQ-----LVPKMVEALANY--RVIQVACGSR---DAQTLALTA  3267

Query  204   XGKLFAFGAGDKGQLG  157
              GK+F++G GD G+LG
Sbjct  3268  CGKVFSWGDGDFGKLG  3283


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 69/136 (51%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG   +WG G  G LGHGN      PK++ A S ++ V +A G   +  ++  G  Y++G
Sbjct  4056  DGEVYSWGEGEDGKLGHGNRVSYDRPKLITALSGLEVVCIACGGAHSACLTARGRIYTWG  4115

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH     D +     + L P+LV +L     RV+ ++  +    +A T  +T+
Sbjct  4116  KGRYGRLGHG----DSE-----DQLIPKLVEALSSF--RVIDVACGSG---DAQTLCITD  4161

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4162  DDNVWSWGDGDYGKLG  4177


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 65/135 (48%), Gaps = 16/135 (12%)
 Frame = -2

Query  561   GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             G+  +WG G +G LG G  D  + P  VE  +++    V  G   +  ++ DG+ +++G 
Sbjct  3269  GKVFSWGDGDFGKLGRGGSDGCAIPMNVERLNSLGVTQVECGAQFSLALTRDGEVWTWGK  3328

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             G+   LGH     D  V R      P LV +L+    RV+ +++        H  A+T  
Sbjct  3329  GDYFRLGHGC---DAHVRR------PTLVEALR--GRRVIHVAVG-----ALHCLAVTSE  3372

Query  201   GKLFAFGAGDKGQLG  157
              +++A+G  D GQ G
Sbjct  3373  NQVWAWGDNDHGQQG  3387


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 12/128 (9%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            +WG G  G LGHG+     AP+ +   ++ + V VA G   + V++  G  Y++G G   
Sbjct  548  SWGIGEDGRLGHGDTAARDAPQPLHHLAHHEVVRVAAGLACSAVITSRGALYTWGRGAQG  607

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH  +          N L+P+ V+      ER++ ++L    +    T   T  G + 
Sbjct  608  RLGHGTI---------ENCLTPQPVSFNAHNIERIIDVALG---WGEGSTLCCTWEGAVQ  655

Query  189  AFGAGDKG  166
             FG G+ G
Sbjct  656  VFGEGEAG  663


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 68/138 (49%), Gaps = 18/138 (13%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNI--KXVHVATGDYTTFVVSEDGDAYS  391
             DG+    G G  G LG G+ +  S P+     S++  + V V +G      ++ DG  YS
Sbjct  3108  DGKLFACGEGTNGRLGLGHSNNVSTPRANPYLSHVLVRRVAVHSGGKHALALTADGKVYS  3167

Query  390   FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             +G GE   LGH         NR + + +P L+ SL    ERV+ I+       +AH+  +
Sbjct  3168  WGEGEDGKLGHG--------NRIT-LEAPRLIESL--AGERVISIACG-----SAHSACV  3211

Query  210   TEXGKLFAFGAGDKGQLG  157
             T  G L+ +G G+ G+LG
Sbjct  3212  TARGHLYTWGLGEYGRLG  3229


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 56/130 (43%), Gaps = 14/130 (11%)
 Frame = -2

Query  546   WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
             WG      LG         P    A S ++ VH+A G  T F+VS DG    F CGE   
Sbjct  3062  WGLNDKDQLGGVKGSKVKVPVFSPALSALRPVHIAGGSKTLFIVSHDGKL--FACGE---  3116

Query  366   LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
              G N  +  G  N   N+ +P     L  V  R V +          H  ALT  GK+++
Sbjct  3117  -GTNGRLGLGHSN---NVSTPRANPYLSHVLVRRVAVHSGGK-----HALALTADGKVYS  3167

Query  186   FGAGDKGQLG  157
             +G G+ G+LG
Sbjct  3168  WGEGEDGKLG  3177


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 64/131 (49%), Gaps = 16/131 (12%)
 Frame = -2

Query  549   TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
             +WG G YG LG G  +    P  ++    ++ + V  G   +  + + G  Y++G G+  
Sbjct  4167  SWGDGDYGKLGRGGSEGCKLPMRIDCLKGLRVIKVECGSQFSVALCQCGSVYTWGKGDYH  4226

Query  369   SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
              LGH +         + ++  P  VT ++   + +V I+ T S+    H  A T+ G+++
Sbjct  4227  RLGHGS---------YEHVRRPMRVTGMQ--GKMIVSIA-TGSL----HCVACTDTGEVY  4270

Query  189   AFGAGDKGQLG  157
              +G  D+GQLG
Sbjct  4271  TWGDNDEGQLG  4281



>ref|XP_007240764.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like, partial 
[Astyanax mexicanus]
Length=529

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 85/156 (54%), Gaps = 20/156 (13%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            + G   +WG G YG LGHGN D +  P+ +EA    + V ++ G   + VV+ DG  +SF
Sbjct  21   ESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTADGKLFSF  80

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LG         +   SN   PE VT+L+   ++V Q++   +     HT A++
Sbjct  81   GNGDYGRLG---------LGNTSNKKLPERVTALE--GQQVGQVACGLN-----HTLAVS  124

Query  207  EXGK-LFAFGAGDKGQLGVALSANQTERANPERVEV  103
              G  ++AFG GD G+LG+    N T +++P++V+V
Sbjct  125  ADGSTVWAFGDGDYGKLGL---GNSTAKSSPQKVDV  157


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 16/131 (12%)
 Frame = -2

Query  546  WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
            +G G YG LG GN   +S+P+ V+    +    VA G   +  +++DG+ YSF  G+   
Sbjct  133  FGDGDYGKLGLGNSTAKSSPQKVDVLCGLGIKKVACGTQFSVALTKDGNVYSF--GQDRL  190

Query  366  LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
            +G    + +G+   H+    P+ + +L  V    V +          H+ AL+  G ++A
Sbjct  191  IG----LPEGRARNHNR---PQQIPALTGVFILDVAVG-------AEHSLALSSTGDVYA  236

Query  186  FGAGDKGQLGV  154
            +G+  +GQLG+
Sbjct  237  WGSNSEGQLGL  247



>ref|XP_001861523.1| hect E3 ubiquitin ligase [Culex quinquefasciatus]
 gb|EDS35783.1| hect E3 ubiquitin ligase [Culex quinquefasciatus]
Length=4784

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 78/153 (51%), Gaps = 19/153 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++E+    +   +A G   +  ++  G+ Y++G
Sbjct  3012  DGKVFSWGEGEDGKLGHGNRVTLEKPKLLESLRTKRIRDIACGSSHSAAITSSGELYTWG  3071

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           +   L P+LVT+L+    RVVQ++  +    +A T  LTE
Sbjct  3072  LGEYGRLGH---------GDNCTQLKPKLVTALQ--GHRVVQVACGSR---DAQTLCLTE  3117

Query  204   XGKLFAFGAGDKGQLGVALS-----ANQTERAN  121
              G +F++G GD G+LG   S      +Q ER N
Sbjct  3118  EGLVFSWGDGDFGKLGRGGSEGCSVPHQVERLN  3150


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             + G   TWG G Y  LGHGN D    PK V A    K + +ATG       S+ G+ +++
Sbjct  4185  RSGSVYTWGKGDYHRLGHGNTDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVFTW  4244

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   + I  P LV SL+   + +V++     I  +AHT AL+
Sbjct  4245  GDNDEGQLG------DGTV---TAIQRPRLVQSLQ--GKHIVKV-----ICGSAHTLALS  4288


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 64/153 (42%), Gaps = 17/153 (11%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG   +WG G  G LGHGN D    PK++EA S I  V +A G   +  ++  G   ++G
Sbjct  4049  DGEVFSWGEGEDGKLGHGNRDSYDRPKLIEALSGIGVVDIACGSAHSACITSQGHVLTWG  4108

Query  384   CGESSSLGHNAVVXDGQVNR---HSNILSPELVTSLKQVXERVVQISLTNSIYWNA----  226
              G    LGH       Q  R    + I+    VT++       V +   + +   +    
Sbjct  4109  KGRYGRLGHGDSEDQLQPKRCVLRTTIMCGVGVTAIMASLAEEVPMGARSPMKIESLAGL  4168

Query  225   ----------HTFALTEXGKLFAFGAGDKGQLG  157
                        + ALT  G ++ +G GD  +LG
Sbjct  4169  GVIKVECGSQFSVALTRSGSVYTWGKGDYHRLG  4201


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 67/155 (43%), Gaps = 25/155 (16%)
 Frame = -2

Query  558   RXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCG  379
             +   WG      LG         P      S +K +H++ G  + F+VS+DG  Y+  CG
Sbjct  2908  KVLVWGLNDKEQLGGLKGSKVKLPTYSSVLSQLKPIHISGGSKSLFIVSQDGKLYA--CG  2965

Query  378   ESSS----LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             E ++    LGHN           +N+ +P  V  L Q   + V +          H  AL
Sbjct  2966  EGTNGRLGLGHN-----------NNVPTPRQVPILNQYVVKKVAVH-----SGGKHAMAL  3009

Query  210   TEXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             T  GK+F++G G+ G+LG     N+     P+ +E
Sbjct  3010  TLDGKVFSWGEGEDGKLG---HGNRVTLEKPKLLE  3041


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 69/134 (51%), Gaps = 18/134 (13%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G    WG G +G LG+G+ +    P  +E  S++  ++  +G   +  +S DG  YS+G 
Sbjct  702  GLLFAWGDGDFGKLGNGSCNGSPLPVQIEGVSSVARIY--SGSQFSVALSYDGTLYSWGK  759

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G    LGH         + HSN+  P+LV +L+   +++V +++      +AH  ALT  
Sbjct  760  GHGGRLGHGN-------SEHSNV--PKLVHALE--GKKIVDVAVG-----SAHCLALTSS  803

Query  201  GKLFAFGAGDKGQL  160
            G+L+ +G  D  Q+
Sbjct  804  GELYGWGRNDYQQI  817


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 64/135 (47%), Gaps = 16/135 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG G  G LGHG+   +  P  +     +  ++   G   +  VS  G+ +++G 
Sbjct  598  GEVYSWGAGEGGRLGHGDTASKEVPTKIALEKQVTAIY--AGASYSAAVSSVGELFTWGR  655

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G    LGH             +   P  V +LK    +VV ++L +    +AH+ A+T+ 
Sbjct  656  GTYGRLGH---------GNSDDKFVPTQVQALKAY--KVVDVALGSG---DAHSMAVTDG  701

Query  201  GKLFAFGAGDKGQLG  157
            G LFA+G GD G+LG
Sbjct  702  GLLFAWGDGDFGKLG  716


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 67/137 (49%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             ++G   +WG G +G LG G  +  S P  VE  + +  V +  G   +  +++ G+ +++
Sbjct  3117  EEGLVFSWGDGDFGKLGRGGSEGCSVPHQVERLNGVGVVQIECGAQFSLALTKIGEVWTW  3176

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH     D  V +      P  +  L+   ++V+ +++        H  A+T
Sbjct  3177  GKGDYYRLGHGT---DQHVRK------PTPIQGLR--GKKVIHVAVG-----ALHCLAVT  3220

Query  207   EXGKLFAFGAGDKGQLG  157
             + G++FA+G  D GQ G
Sbjct  3221  DSGQVFAWGDNDHGQQG  3237



>ref|XP_002745648.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Callithrix jacchus]
Length=1024

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG  + + + +P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  210  GNIYSWGKNEFGQLGLDHTESKDSPSLIEALDNQKVEFLACGGSHTALLTQDGLLFTFGA  269

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L     RV QI+      W  HT A +++
Sbjct  270  GKHGQLGHNST---------QNELRPCLVAEL--AGNRVTQIACGR---W--HTLAYVSD  313

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + +Q
Sbjct  314  LGKVFSFGSGKEGQLGNGGTRDQ  336


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 44/145 (30%), Positives = 69/145 (48%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   +G LG G +    +AP++VE  + I    ++ G+  +  +S  G+ YS
Sbjct  155  KGGELFAWGQNLHGQLGVGRKFPSTTAPQIVEHLAGIPLAQISAGEAHSMALSMSGNIYS  214

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E   LG         ++   +  SP L+ +L    ++V  ++   S     HT  L
Sbjct  215  WGKNEFGQLG---------LDHTESKDSPSLIEALDN--QKVEFLACGGS-----HTALL  258

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G LF FGAG  GQLG   + N+
Sbjct  259  TQDGLLFTFGAGKHGQLGHNSTQNE  283



>ref|XP_003924055.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Saimiri boliviensis 
boliviensis]
Length=1024

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG  + + + +P ++EA  N K   +A G   T ++++DG  ++FG 
Sbjct  210  GNIYSWGKNEFGQLGLDHTESKDSPSLIEALDNQKVEFLACGGSHTALLTQDGLLFTFGA  269

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L     RV QI+      W  HT A +++
Sbjct  270  GKHGQLGHNST---------QNELRPCLVAEL--AGNRVTQIACGR---W--HTLAYVSD  313

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + +Q
Sbjct  314  LGKVFSFGSGKEGQLGNGGTRDQ  336


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 44/145 (30%), Positives = 68/145 (47%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   +G LG G +    + P++VE  S I    ++ G+  +  +S  G+ YS
Sbjct  155  KGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLSGIPLAQISAGEAHSMALSMSGNIYS  214

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E   LG         ++   +  SP L+ +L    ++V  ++   S     HT  L
Sbjct  215  WGKNEFGQLG---------LDHTESKDSPSLIEALDN--QKVEFLACGGS-----HTALL  258

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G LF FGAG  GQLG   + N+
Sbjct  259  TQDGLLFTFGAGKHGQLGHNSTQNE  283



>ref|XP_006867837.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Chrysochloris asiatica]
Length=1030

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 47/143 (33%), Positives = 72/143 (50%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ D   +P +VE   N +   +  G   T +++++G  ++FG 
Sbjct  212  GNIYSWGKNDFGQLGLGHTDKTDSPSLVEELDNQEVEFLTCGGSHTALLTKNGQVFTFGA  271

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G    LGHN+V  + +         P LVT L     RV QI+         HT A + +
Sbjct  272  GNYGQLGHNSVQNESR---------PRLVTEL--TGNRVTQIACGRD-----HTLAYVPD  315

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G +GQLG   + NQ
Sbjct  316  LGKVFSFGSGKEGQLGNGRAHNQ  338


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 5/79 (6%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATG-DYTTFVVSEDGDAYS  391
            K+G+  T+G G YG LGH +   ES P++V   +  +   +A G D+T   V + G  +S
Sbjct  262  KNGQVFTFGAGNYGQLGHNSVQNESRPRLVTELTGNRVTQIACGRDHTLAYVPDLGKVFS  321

Query  390  FGCGESSSLG----HNAVV  346
            FG G+   LG    HN ++
Sbjct  322  FGSGKEGQLGNGRAHNQLI  340



>ref|XP_010032623.1| PREDICTED: ultraviolet-B receptor UVR8 [Eucalyptus grandis]
 gb|KCW52037.1| hypothetical protein EUGRSUZ_J01476 [Eucalyptus grandis]
Length=392

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 76/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P +V   + +  V +A G + +  +++DG+ Y +
Sbjct  214  EDGTLLAWGNNEYGQLGTGDTQPRSQPVIVHGLAGLTLVDIAAGGWHSTALTDDGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E ++Q+S   +     H+ ALT
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMVPQKVHLL--TGEDIIQVSCGGT-----HSVALT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F+FG GD G+LG      +     P  V ++L  P
Sbjct  320  RDGRMFSFGRGDHGRLGY---GRKVTTGQPGEVPINLPPP  356


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 68/152 (45%), Gaps = 13/152 (9%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            +DG+  TWGW + G LGH  E   E+ P  V+A +N+K V  A G +    V + G AY+
Sbjct  55   EDGQLFTWGWNQRGTLGHPPETKTENTPSQVKALANVKIVQAAIGGWHCLAVDDQGRAYA  114

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E    G       G+ +     L  ++V   +   + +V+           H+  L
Sbjct  115  WGGNEYGQCGEEP----GRKDDTGKPLRRDIVIPQRCASQLIVRQVAAG----GTHSVVL  166

Query  210  TEXGKLFAFG----AGDKGQLGVALSANQTER  127
            T  G+++ +G     GD  Q+ V +     E+
Sbjct  167  THDGQVWTWGQPWPPGDIKQISVPVRVQGLEK  198



>ref|XP_011176997.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 [Bactrocera 
cucurbitae]
Length=5050

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 72/136 (53%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++EA    K   +A G   +  ++  G+ Y++G
Sbjct  3197  DGKVFSWGEGEDGKLGHGNRLTMDKPKLIEALRAKKIRDIACGSSHSAAITSAGELYTWG  3256

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH   V           L P+LV +L    +RV+Q++  +    +A T ALTE
Sbjct  3257  LGEYGRLGHGDNVTQ---------LKPKLVAALS--GKRVIQVACGSR---DAQTLALTE  3302

Query  204   XGKLFAFGAGDKGQLG  157
              G ++++G GD G+LG
Sbjct  3303  DGIVYSWGDGDFGKLG  3318


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 73/147 (50%), Gaps = 17/147 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +  V V  G   +  +++ G  Y++G
Sbjct  4397  DDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWG  4456

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH  V          ++  P+ V +L+   +++V I+ T S+    H  A T+
Sbjct  4457  KGDFHRLGHGTV---------DHVRRPKKVAALQ--GKKIVSIA-TGSL----HCVACTD  4500

Query  204   XGKLFAFGAGDKGQLGV-ALSANQTER  127
              G++F +G  D+GQLG   +SA Q  R
Sbjct  4501  AGEVFTWGDNDEGQLGDGTVSAIQRPR  4527


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 65/136 (48%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             +G   +WG G  G LGHGN      PK++E  + I  V +A G   +  ++  G   ++G
Sbjct  4291  EGEVYSWGEGEDGKLGHGNRMSYDRPKLIEDLTGIGIVDIACGSAHSAAITSSGHVLTWG  4350

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + ++  +    +A T  +T+
Sbjct  4351  KGRYGRLGH---------GDSEDQLRPKLVEAL--LGYRAIDVACGSG---DAQTLCITD  4396

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4397  DDNVWSWGDGDYGKLG  4412


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 68/137 (50%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +  S P  +E  + I  + +  G   +  ++  G+ +++
Sbjct  3302  EDGIVYSWGDGDFGKLGRGGSEGSSIPHEIERLTGIGVIQIECGAQFSLALTRTGEVWTW  3361

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH +   D  V +      P+ + +L+    +V+ +++        H  A+T
Sbjct  3362  GKGDYYRLGHGS---DQHVRK------PQPIQALR--GRKVIHLAVG-----ALHCLAVT  3405

Query  207   EXGKLFAFGAGDKGQLG  157
             + G+++A+G  D GQ G
Sbjct  3406  DTGQVYAWGDNDHGQQG  3422


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 62/147 (42%), Gaps = 17/147 (12%)
 Frame = -2

Query  546   WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
             WG      LG         P   +  S ++ +H+A G  + F+VS+DG  Y+ G G +  
Sbjct  3097  WGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACGEGTNGR  3156

Query  366   LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
             LG    V         N+  P  +  L Q   + V +          H  ALT  GK+F+
Sbjct  3157  LGLGISV---------NVSVPRQIPVLHQYVVKKVAVH-----SGGKHAIALTLDGKVFS  3202

Query  186   FGAGDKGQLGVALSANQTERANPERVE  106
             +G G+ G+LG     N+     P+ +E
Sbjct  3203  WGEGEDGKLG---HGNRLTMDKPKLIE  3226



>gb|ETN64680.1| hect E3 ubiquitin ligase [Anopheles darlingi]
Length=5239

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 76/153 (50%), Gaps = 19/153 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++E     +   +A G   +  ++  G+ Y++G
Sbjct  3346  DGKVFSWGEGEDGKLGHGNRLTLEKPKLIETLRTKRIRDIACGSSHSAAITSSGELYTWG  3405

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           +   L P+LVT+L     RVVQ++  +    +A T  LTE
Sbjct  3406  LGEYGRLGH---------GDNCTQLKPKLVTALAD--HRVVQVACGSR---DAQTLCLTE  3451

Query  204   XGKLFAFGAGDKGQLGVALS-----ANQTERAN  121
              G +F++G GD G+LG   S      +Q ER N
Sbjct  3452  EGLVFSWGDGDFGKLGRGGSEGCSIPHQVERLN  3484


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 69/136 (51%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG   +WG G  G LGHGN D    PK++EA S I  + +A G   +  ++  G   ++G
Sbjct  4482  DGEVFSWGEGEDGKLGHGNRDSYDRPKLIEALSGIGVIDIACGSAHSACITSQGHVLTWG  4541

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH     D +     + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4542  KGRYGRLGHG----DSE-----DQLQPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4587

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4588  DDNVWSWGDGDYGKLG  4603


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 68/155 (44%), Gaps = 25/155 (16%)
 Frame = -2

Query  558   RXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCG  379
             +   WG      LG         P      S +K +H+A G  + F+VS+DG  Y+  CG
Sbjct  3242  KVLVWGLNDKEQLGGLKGSKVKLPTYSSVLSQLKPIHIAGGSKSLFIVSQDGKLYA--CG  3299

Query  378   ESSS----LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             E ++    LGHN           +N+ +P+ V  L Q   + V +          H  AL
Sbjct  3300  EGTNGRLGLGHN-----------NNVPTPKQVPILSQYVVKKVAVH-----SGGKHAMAL  3343

Query  210   TEXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             T  GK+F++G G+ G+LG     N+     P+ +E
Sbjct  3344  TLDGKVFSWGEGEDGKLG---HGNRLTLEKPKLIE  3375


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             + G   TWG G Y  LGHGN D    PK V A    K + +ATG       S+ G+ +++
Sbjct  4639  RSGSVYTWGKGDYHRLGHGNTDHVRRPKKVAALQGKKIISIATGSLHCVACSDGGEVFTW  4698

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   S I  P LV SL+   + +V++     I  +AHT AL+
Sbjct  4699  GDNDEGQLG------DGTV---SAIQRPRLVQSLQ--GKHIVKV-----ICGSAHTLALS  4742


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 67/135 (50%), Gaps = 14/135 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG G  G LGHG+   +  P  + A +  +   V  G   +  ++  G+ Y++G 
Sbjct  649  GDVFSWGNGEGGRLGHGDTSSKDIPTRIVALAERQVTGVFCGSSYSAAITAAGELYTWGR  708

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G    LGH         ++H     P +V  LKQ  +RV+ ++L      +AH+  +T+ 
Sbjct  709  GTYGRLGHG-----NSEDKH----LPTIVQVLKQ--QRVIHVALGCG---DAHSLCVTDT  754

Query  201  GKLFAFGAGDKGQLG  157
            G ++A+G GD G+LG
Sbjct  755  GIVYAWGDGDFGKLG  769


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 70/139 (50%), Gaps = 18/139 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSN--IKXVHVATGDYTTFVVSEDGDAY  394
             +DG+    G G  G LG G+ +    PK V   S   +K V V +G      ++ DG  +
Sbjct  3291  QDGKLYACGEGTNGRLGLGHNNNVPTPKQVPILSQYVVKKVAVHSGGKHAMALTLDGKVF  3350

Query  393   SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
             S+G GE   LGH         NR + +  P+L+ +L+   +R+  I+  +S     H+ A
Sbjct  3351  SWGEGEDGKLGHG--------NRLT-LEKPKLIETLR--TKRIRDIACGSS-----HSAA  3394

Query  213   LTEXGKLFAFGAGDKGQLG  157
             +T  G+L+ +G G+ G+LG
Sbjct  3395  ITSSGELYTWGLGEYGRLG  3413


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 70/147 (48%), Gaps = 17/147 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +    V  G   +  ++  G  Y++G
Sbjct  4588  DDNVWSWGDGDYGKLGRGGSDGCKVPMKIESLAGLGVTKVECGSQFSVALTRSGSVYTWG  4647

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH             ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  4648  KGDYHRLGHGNT---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  4691

Query  204   XGKLFAFGAGDKGQLGV-ALSANQTER  127
              G++F +G  D+GQLG   +SA Q  R
Sbjct  4692  GGEVFTWGDNDEGQLGDGTVSAIQRPR  4718


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVAT--GDYTTFVVSEDGDAYSF  388
            G   TWG G YG LGHGN + +  P +V+     + +HVA   GD  +  V++ G  Y++
Sbjct  701  GELYTWGRGTYGRLGHGNSEDKHLPTIVQVLKQQRVIHVALGCGDAHSLCVTDTGIVYAW  760

Query  387  GCGESSSLGH  358
            G G+   LG+
Sbjct  761  GDGDFGKLGN  770



>emb|CCA14713.1| regulator of chromosome condensation (RCC1)like protein putative 
[Albugo laibachii Nc14]
Length=393

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 80/156 (51%), Gaps = 14/156 (9%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHG--NEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAY  394
            K+G+  TWG   Y  LGHG  N+D +S P+VV+A   IK V ++ G+Y T  V E+G  +
Sbjct  63   KEGKLYTWGSNEYHQLGHGSSNQDIQSIPRVVDALRGIKIVDISCGEYHTGAVDEEGKLF  122

Query  393  SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
            ++G G S+  G  A+   G  +       P LV +L      V  +          HT A
Sbjct  123  TWGWGGSTMKGSGALGHAGGEDES----IPRLVRTLVDQGVPVKSVECG-----ELHTVA  173

Query  213  LTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            LT+ G+++A+G G+ G+LG   S N      PE VE
Sbjct  174  LTKDGEIWAWGNGEYGRLGNGASDN---FEVPEPVE  206


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 62/130 (48%), Gaps = 10/130 (8%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            KDG    WG G YG LG+G  D    P+ VE  ++     ++ G   TF ++E G+ YS+
Sbjct  176  KDGEIWAWGNGEYGRLGNGASDNFEVPEPVEYFADENIASISAGRDFTFAITEHGEVYSW  235

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G    S LG    +    V+ ++    P +V +L  V   V Q+S         H  A+T
Sbjct  236  GINSHSQLGLGGGLT---VDYYNMETIPVVVEALSNV--NVAQVSAGYD-----HAAAVT  285

Query  207  EXGKLFAFGA  178
              GK+F +GA
Sbjct  286  NDGKMFMWGA  295



>ref|XP_011293627.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 isoform 
X1 [Musca domestica]
 ref|XP_011293628.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 isoform 
X1 [Musca domestica]
 ref|XP_011293629.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 isoform 
X1 [Musca domestica]
 ref|XP_011293630.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 isoform 
X1 [Musca domestica]
Length=5094

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++EA  + K   +A G   +  ++  G+ Y++G
Sbjct  3224  DGKIFSWGEGEDGKLGHGNRLTMDKPKMIEALRSKKIRDIACGSSHSAAITSAGELYTWG  3283

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           ++  L P+LV  L    +RV+Q++  +    +A T ALTE
Sbjct  3284  LGEYGRLGH---------GDNATQLKPKLVAGLS--GKRVIQVACGSR---DAQTLALTE  3329

Query  204   XGKLFAFGAGDKGQLG  157
              G ++++G GD G+LG
Sbjct  3330  DGAVYSWGDGDFGKLG  3345


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 73/147 (50%), Gaps = 17/147 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ S +  + V  G   +  +++ G  Y++G
Sbjct  4441  DDNVWSWGDGDYGKLGRGGSDGCKVPVKIESLSGLGVIKVECGSQFSVALTKSGAVYTWG  4500

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH  V          ++  P+ V +L+   ++VV I+ T S+    H  A T+
Sbjct  4501  KGDFHRLGHGTV---------DHVRRPKKVAALQ--GKKVVSIA-TGSL----HCVACTD  4544

Query  204   XGKLFAFGAGDKGQLGV-ALSANQTER  127
              G+++ +G  D+GQLG   +SA Q  R
Sbjct  4545  NGEVYTWGDNDEGQLGDGTVSAIQRPR  4571


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 69/139 (50%), Gaps = 22/139 (16%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYS  391
            +G   TWG G YG LGHGN D +  P  V A +  K + VA  +GD  T  V+  G  Y+
Sbjct  700  NGTLFTWGRGTYGRLGHGNSDDKLLPMPVTALAEHKIIDVALGSGDAHTLAVTASGLVYA  759

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAH-TFA  214
            +G G+   LG      +G  N  S I  P+++ +L +V            ++  A  + A
Sbjct  760  WGDGDFGKLG------NGSCN-GSPI--PQIIDTLPRVQR----------VFAGAQFSVA  800

Query  213  LTEXGKLFAFGAGDKGQLG  157
            LT  GKL+++G    G+LG
Sbjct  801  LTCDGKLYSWGKSSGGRLG  819


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 67/137 (49%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +  S P  +E  S I  + +  G   +  ++  G+ +++
Sbjct  3329  EDGAVYSWGDGDFGKLGRGGSEGSSVPHEIERLSGIGVIQIECGAQFSLALTRTGEVWTW  3388

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH +   D  V +      P+ +  L+    +V+ +++        H  A+T
Sbjct  3389  GKGDYYRLGHGS---DQHVRK------PQPIQGLR--GRKVIHVAVG-----ALHCLAVT  3432

Query  207   EXGKLFAFGAGDKGQLG  157
             + G++FA+G  D GQ G
Sbjct  3433  DTGQVFAWGDNDHGQQG  3449


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 67/136 (49%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG   +WG G  G LGHGN      PK++E  + I  V +A G   +  ++  G   ++G
Sbjct  4335  DGEVYSWGEGEDGKLGHGNRMGYDRPKLIEDLTGIGIVDIACGSAHSAAITASGHVLTWG  4394

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH     D +     + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4395  KGRYGRLGHG----DSE-----DQLRPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4440

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4441  DDNVWSWGDGDYGKLG  4456


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 63/147 (43%), Gaps = 17/147 (12%)
 Frame = -2

Query  546   WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
             WG      LG         P   +  S ++ +H+A G  + F+VS+DG  Y+ G G +  
Sbjct  3124  WGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACGEGTNGR  3183

Query  366   LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
             LG         +   +N+  P  V  L Q   + V +          H  ALT  GK+F+
Sbjct  3184  LG---------LGTSANVSVPRQVPVLHQYVVKKVAVH-----SGGKHALALTLDGKIFS  3229

Query  186   FGAGDKGQLGVALSANQTERANPERVE  106
             +G G+ G+LG     N+     P+ +E
Sbjct  3230  WGEGEDGKLG---HGNRLTMDKPKMIE  3253


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG  D    PK V A    K V +ATG       +++G+ Y++
Sbjct  4492  KSGAVYTWGKGDFHRLGHGTVDHVRRPKKVAALQGKKVVSIATGSLHCVACTDNGEVYTW  4551

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   S I  P LV +L  V + +V+++       +AHT AL+
Sbjct  4552  GDNDEGQLG------DGTV---SAIQRPRLVHAL--VGKHIVKVTCG-----SAHTLALS  4595



>ref|XP_003265940.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Nomascus leucogenys]
Length=1024

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 48/143 (34%), Positives = 75/143 (52%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ + +  P ++EA  N +   +A G   + ++++DG  ++FG 
Sbjct  210  GNIYSWGKNEFGQLGLGHTESKDYPSLIEALDNQEVEFLACGGSHSALLTQDGLLFTFGA  269

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LV  L  V  RV QI+      W  HT A +++
Sbjct  270  GKHGQLGHNST---------QNELRPCLVAEL--VGNRVTQIACGR---W--HTLAYVSD  313

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG+G  GQLG   + +Q
Sbjct  314  LGKVFSFGSGKDGQLGNGGTRDQ  336


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 40/145 (28%), Positives = 65/145 (45%), Gaps = 17/145 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG   +G LG G +    + P++VE  + +    ++ G+  +  +S  G+ YS
Sbjct  155  KGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYS  214

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +G  E   LG         +    +   P L+ +L    + V  ++   S     H+  L
Sbjct  215  WGKNEFGQLG---------LGHTESKDYPSLIEALDN--QEVEFLACGGS-----HSALL  258

Query  210  TEXGKLFAFGAGDKGQLGVALSANQ  136
            T+ G LF FGAG  GQLG   + N+
Sbjct  259  TQDGLLFTFGAGKHGQLGHNSTQNE  283



>ref|WP_036628254.1| hypothetical protein, partial [Paenibacillus macerans]
Length=729

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 49/154 (32%), Positives = 77/154 (50%), Gaps = 22/154 (14%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G GRYG LGHG+ + +  PK +E+ S+I+   +A GD  +  ++  GD YSF
Sbjct  510  KSGDVYSFGRGRYGQLGHGDTEDQYTPKKIESLSDIQA--IAAGDNHSLALTVSGDVYSF  567

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH         N  S +++P+ +  L  +               + H+ ALT
Sbjct  568  GYGRYGQLGHG--------NTDSQLITPKKIEGLSDIQAIAAG---------DNHSLALT  610

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            + G +++FG G  GQLG     NQ     P+++E
Sbjct  611  KSGDVYSFGRGMYGQLGHGDKENQL---TPKKIE  641


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 53/158 (34%), Positives = 84/158 (53%), Gaps = 25/158 (16%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G G +G LGHG+ D +  PK +E  S+I+ +  A GD+ +  +++ GD YSF
Sbjct  16   KSGDVYSFGLGLFGRLGHGDTDSQLEPKKIEGLSDIQAI--AAGDFHSLALTKSGDVYSF  73

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G +S LGH      G     S   +P+ + SL  V                 H+ ALT
Sbjct  74   GNG-TSGLGH------GNTEDQS---TPKKIESLSDVQAIAAG---------GNHSLALT  114

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            + G++++FG G+ G+LG   + +Q E   P+++E DLS
Sbjct  115  KSGEVYSFGMGNSGRLGHGDTDSQLE---PKKIE-DLS  148


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 47/154 (31%), Positives = 75/154 (49%), Gaps = 22/154 (14%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G G YG LGHGN + +  PK +E  S+I+   +A GD+ +  +++ GD YSF
Sbjct  460  KSGDVYSFGRGMYGRLGHGNTENQPKPKKIEGLSDIQA--IAAGDFHSLALTKSGDVYSF  517

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH             +  +P+ + SL  +               + H+ ALT
Sbjct  518  GRGRYGQLGHGDT---------EDQYTPKKIESLSDIQAIAAG---------DNHSLALT  559

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
              G +++FG G  GQLG   + +Q     P+++E
Sbjct  560  VSGDVYSFGYGRYGQLGHGNTDSQL--ITPKKIE  591


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 50/154 (32%), Positives = 79/154 (51%), Gaps = 24/154 (16%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++GWG +G LGHG+ + +  PK +E  S+I+   VA G   +  +++ G+ YSF
Sbjct  165  KSGDVYSFGWGLHGQLGHGDTENQLTPKKIEDLSDIQA--VAAGANHSLALTKSGEVYSF  222

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G +  LGH     D Q       L+P+ +  LK +               + H+ ALT
Sbjct  223  GRGNTGQLGHGDT--DDQ-------LTPKKIEGLKDIQAIAAG---------DFHSLALT  264

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            + G +++FG G  G LG   +ANQ E   P+++E
Sbjct  265  KSGDVYSFGNGTSG-LGHGDTANQLE---PKKIE  294


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 47/153 (31%), Positives = 75/153 (49%), Gaps = 24/153 (16%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCE-SAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            G   ++G+GRYG LGHGN D +   PK +E  S+I+ +  A GD  +  +++ GD YSFG
Sbjct  562  GDVYSFGYGRYGQLGHGNTDSQLITPKKIEGLSDIQAI--AAGDNHSLALTKSGDVYSFG  619

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G    LGH             N L+P+ +  L  +                  + ALT+
Sbjct  620  RGMYGQLGHG---------DKENQLTPKKIEGLADIQAIAAG---------EDQSLALTK  661

Query  204  XGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             G +++FG G  G+LG     N  +++ P+++E
Sbjct  662  SGDVYSFGRGMYGRLG---HGNTEDQSTPKKIE  691


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 44/137 (32%), Positives = 68/137 (50%), Gaps = 20/137 (15%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G G YG LGHG+++ +  PK +E  ++I+   +A G+  +  +++ GD YSF
Sbjct  611  KSGDVYSFGRGMYGQLGHGDKENQLTPKKIEGLADIQA--IAAGEDQSLALTKSGDVYSF  668

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G    LGH      G     S   +P+ + SL  V                 H+ ALT
Sbjct  669  GRGMYGRLGH------GNTEDQS---TPKKIESLSDVQAIAAG---------GNHSLALT  710

Query  207  EXGKLFAFGAGDKGQLG  157
            + G +++FG G  GQLG
Sbjct  711  KSGDVYSFGYGRYGQLG  727


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 78/158 (49%), Gaps = 25/158 (16%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G G  G LGHGN + +S PK +E+ S+++ +  A G   +  +++ G+ YSF
Sbjct  66   KSGDVYSFGNGTSG-LGHGNTEDQSTPKKIESLSDVQAI--AAGGNHSLALTKSGEVYSF  122

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G S  LGH     D Q       L P+ +  L  +                 H+ ALT
Sbjct  123  GMGNSGRLGHGDT--DSQ-------LEPKKIEDLSDIQAIAAG---------GNHSLALT  164

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            + G +++FG G  GQLG   + NQ     P+++E DLS
Sbjct  165  KSGDVYSFGWGLHGQLGHGDTENQL---TPKKIE-DLS  198


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 23/148 (16%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            ++G   YG LGHG++  +  PK +E+ S+++ +  A G   +  +++ GD YSFG G   
Sbjct  416  SFGLDDYGQLGHGDKKNQLEPKKIESLSDVQAI--AAGSKHSLALTKSGDVYSFGRGMYG  473

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH             N   P+ +  L  +               + H+ ALT+ G ++
Sbjct  474  RLGHGNT---------ENQPKPKKIEGLSDIQAIAAG---------DFHSLALTKSGDVY  515

Query  189  AFGAGDKGQLGVALSANQTERANPERVE  106
            +FG G  GQLG     +  ++  P+++E
Sbjct  516  SFGRGRYGQLG---HGDTEDQYTPKKIE  540


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            K G   ++G G YG LGHGN + +S PK +E+ S+++   +A G   +  +++ GD YSF
Sbjct  661  KSGDVYSFGRGMYGRLGHGNTEDQSTPKKIESLSDVQA--IAAGGNHSLALTKSGDVYSF  718

Query  387  GCGESSSLGH  358
            G G    LGH
Sbjct  719  GYGRYGQLGH  728



>ref|XP_011479995.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin-protein 
ligase HERC1 [Oryzias latipes]
Length=4829

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 77/153 (50%), Gaps = 20/153 (13%)
 Frame = -2

Query  561   GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
             G   +WG G +G LGHGN + +  PK +EA    + V +A G   + VV+ DG  ++FG 
Sbjct  4069  GEVFSWGDGDFGKLGHGNSERQRRPKQIEALQGEEVVQLACGFRHSAVVTADGKLFTFGS  4128

Query  381   GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             GES  LG  +          SN + PE VT+L+      V   L        HT  L+  
Sbjct  4129  GESGRLGQRST---------SNKMLPERVTALEGYHVGQVSCGLN-------HTLVLSLD  4172

Query  201   GK-LFAFGAGDKGQLGVALSANQTERANPERVE  106
             G  ++AFG GD G+LG   + + T +  P+RVE
Sbjct  4173  GMVMWAFGDGDYGKLG---TGSSTAKYYPQRVE  4202


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 75/158 (47%), Gaps = 24/158 (15%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDG-DAYSF  388
            DG   TWG G +G LGH +    S P +V+  S +    VA G   T  V++DG   +SF
Sbjct  539  DGELYTWGEGDFGRLGHSDSQSRSVPTLVKDISGVG--QVACGSSHTIAVAQDGRTVWSF  596

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G++  LGH      G  NR   I  P+++ +L     R V     +S+       ALT
Sbjct  597  GGGDNGKLGH------GDTNR---IYRPKVIEALHGFIIRKVCAGSQSSL-------ALT  640

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
              G++FA+G G      +   +++T    P  VE DLS
Sbjct  641  SAGQVFAWGCGS----CLGCGSSETTSLRPRFVE-DLS  673


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 72/155 (46%), Gaps = 22/155 (14%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVAT---GDYTTFVVSEDGDAY  394
             +G     G G+YG LG GN D    P ++ A        + T    D  +  + E G+ +
Sbjct  4013  NGTVLAIGEGQYGRLGQGNSDDLYVPTIISAFQGYVVTQLVTSCGSDGHSMALMETGEVF  4072

Query  393   SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
             S+G G+   LGH      G   R      P+ + +L+   E VVQ++         H+  
Sbjct  4073  SWGDGDFGKLGH------GNSERQRR---PKQIEALQ--GEEVVQLACGFR-----HSAV  4116

Query  213   LTEXGKLFAFGAGDKGQLGVALSANQTERANPERV  109
             +T  GKLF FG+G+ G+LG   ++N   +  PERV
Sbjct  4117  VTADGKLFTFGSGESGRLGQRSTSN---KMLPERV  4148



>ref|XP_011293631.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC2 isoform 
X2 [Musca domestica]
Length=5070

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++EA  + K   +A G   +  ++  G+ Y++G
Sbjct  3224  DGKIFSWGEGEDGKLGHGNRLTMDKPKMIEALRSKKIRDIACGSSHSAAITSAGELYTWG  3283

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           ++  L P+LV  L    +RV+Q++  +    +A T ALTE
Sbjct  3284  LGEYGRLGH---------GDNATQLKPKLVAGLS--GKRVIQVACGSR---DAQTLALTE  3329

Query  204   XGKLFAFGAGDKGQLG  157
              G ++++G GD G+LG
Sbjct  3330  DGAVYSWGDGDFGKLG  3345


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 73/147 (50%), Gaps = 17/147 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ S +  + V  G   +  +++ G  Y++G
Sbjct  4417  DDNVWSWGDGDYGKLGRGGSDGCKVPVKIESLSGLGVIKVECGSQFSVALTKSGAVYTWG  4476

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH  V          ++  P+ V +L+   ++VV I+ T S+    H  A T+
Sbjct  4477  KGDFHRLGHGTV---------DHVRRPKKVAALQ--GKKVVSIA-TGSL----HCVACTD  4520

Query  204   XGKLFAFGAGDKGQLGV-ALSANQTER  127
              G+++ +G  D+GQLG   +SA Q  R
Sbjct  4521  NGEVYTWGDNDEGQLGDGTVSAIQRPR  4547


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 69/139 (50%), Gaps = 22/139 (16%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVA--TGDYTTFVVSEDGDAYS  391
            +G   TWG G YG LGHGN D +  P  V A +  K + VA  +GD  T  V+  G  Y+
Sbjct  700  NGTLFTWGRGTYGRLGHGNSDDKLLPMPVTALAEHKIIDVALGSGDAHTLAVTASGLVYA  759

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAH-TFA  214
            +G G+   LG      +G  N  S I  P+++ +L +V            ++  A  + A
Sbjct  760  WGDGDFGKLG------NGSCN-GSPI--PQIIDTLPRVQR----------VFAGAQFSVA  800

Query  213  LTEXGKLFAFGAGDKGQLG  157
            LT  GKL+++G    G+LG
Sbjct  801  LTCDGKLYSWGKSSGGRLG  819


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 67/137 (49%), Gaps = 16/137 (12%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             +DG   +WG G +G LG G  +  S P  +E  S I  + +  G   +  ++  G+ +++
Sbjct  3329  EDGAVYSWGDGDFGKLGRGGSEGSSVPHEIERLSGIGVIQIECGAQFSLALTRTGEVWTW  3388

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LGH +   D  V +      P+ +  L+    +V+ +++        H  A+T
Sbjct  3389  GKGDYYRLGHGS---DQHVRK------PQPIQGLR--GRKVIHVAVG-----ALHCLAVT  3432

Query  207   EXGKLFAFGAGDKGQLG  157
             + G++FA+G  D GQ G
Sbjct  3433  DTGQVFAWGDNDHGQQG  3449


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 65/136 (48%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG   +WG G  G LGHGN      PK++E  + I  V +A G   +  ++  G   ++G
Sbjct  4311  DGEVYSWGEGEDGKLGHGNRMGYDRPKLIEDLTGIGIVDIACGSAHSAAITASGHVLTWG  4370

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4371  KGRYGRLGH---------GDSEDQLRPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4416

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4417  DDNVWSWGDGDYGKLG  4432


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 63/147 (43%), Gaps = 17/147 (12%)
 Frame = -2

Query  546   WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
             WG      LG         P   +  S ++ +H+A G  + F+VS+DG  Y+ G G +  
Sbjct  3124  WGLNDKEQLGGLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACGEGTNGR  3183

Query  366   LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
             LG         +   +N+  P  V  L Q   + V +          H  ALT  GK+F+
Sbjct  3184  LG---------LGTSANVSVPRQVPVLHQYVVKKVAVH-----SGGKHALALTLDGKIFS  3229

Query  186   FGAGDKGQLGVALSANQTERANPERVE  106
             +G G+ G+LG     N+     P+ +E
Sbjct  3230  WGEGEDGKLG---HGNRLTMDKPKMIE  3253


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             K G   TWG G +  LGHG  D    PK V A    K V +ATG       +++G+ Y++
Sbjct  4468  KSGAVYTWGKGDFHRLGHGTVDHVRRPKKVAALQGKKVVSIATGSLHCVACTDNGEVYTW  4527

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   S I  P LV +L  V + +V+++       +AHT AL+
Sbjct  4528  GDNDEGQLG------DGTV---SAIQRPRLVHAL--VGKHIVKVTCG-----SAHTLALS  4571



>emb|CCI44832.1| unnamed protein product [Albugo candida]
Length=545

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 70/142 (49%), Gaps = 15/142 (11%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   TWG G YG LGHGNE+    P +VE    +    VA G   T V+ E+ D Y++G 
Sbjct  105  GDLYTWGGGMYGKLGHGNENGHPTPSLVETMKGLYVRQVACGSRHTVVLLENQDVYTWGD  164

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             E+   GH      G  N H    SP  V+ L  V +++ QIS         HT AL+E 
Sbjct  165  KENGVSGH------GDTNGHQ--YSPTCVSEL--VDKKIKQISAC-----GFHTAALSES  209

Query  201  GKLFAFGAGDKGQLGVALSANQ  136
            G+++ FG G  G+LG     NQ
Sbjct  210  GQVYTFGEGKFGRLGHNSEQNQ  231


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 80/156 (51%), Gaps = 21/156 (13%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            + G+  T+G G++G LGH +E  +   K +E+    +   VA G + T  V+E G  +++
Sbjct  208  ESGQVYTFGEGKFGRLGHNSEQNQPVAKCIESLLGKRVKQVACGGFHTAAVTESGHVFTW  267

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LGH   V         N ++P  V +L    + VVQ++      W +HT ALT
Sbjct  268  GGGEHGQLGHGDKV---------NQITPTRVENLTD--KYVVQVTCG----W-SHTVALT  311

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERAN-PERVEV  103
            + G++  +G GD G+LG     N T +   P+ +E+
Sbjct  312  DNGEVLTWGNGDHGKLG----HNDTNKVTVPKLIEM  343


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 68/148 (46%), Gaps = 19/148 (13%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            TWG G  G LG G+   +  P +VEA  + + V ++ G   T V+++DG  Y++G G+  
Sbjct  5    TWGRGEDGQLGLGDTSDQYHPILVEALQDRQIVQISCGSGHTVVLTDDGKVYTWGRGDDG  64

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH           +     P LV  L    + V Q++       + HT A+T  G L+
Sbjct  65   RLGH---------GDNGWKFVPRLVEHLGD--KEVCQVTCG-----SYHTAAVTVTGDLY  108

Query  189  AFGAGDKGQLGVALSANQTERANPERVE  106
             +G G  G+LG     N+     P  VE
Sbjct  109  TWGGGMYGKLG---HGNENGHPTPSLVE  133



>emb|CCI44833.1| unnamed protein product [Albugo candida]
Length=543

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 70/142 (49%), Gaps = 15/142 (11%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   TWG G YG LGHGNE+    P +VE    +    VA G   T V+ E+ D Y++G 
Sbjct  103  GDLYTWGGGMYGKLGHGNENGHPTPSLVETMKGLYVRQVACGSRHTVVLLENQDVYTWGD  162

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             E+   GH      G  N H    SP  V+ L  V +++ QIS         HT AL+E 
Sbjct  163  KENGVSGH------GDTNGHQ--YSPTCVSEL--VDKKIKQISAC-----GFHTAALSES  207

Query  201  GKLFAFGAGDKGQLGVALSANQ  136
            G+++ FG G  G+LG     NQ
Sbjct  208  GQVYTFGEGKFGRLGHNSEQNQ  229


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 80/156 (51%), Gaps = 21/156 (13%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            + G+  T+G G++G LGH +E  +   K +E+    +   VA G + T  V+E G  +++
Sbjct  206  ESGQVYTFGEGKFGRLGHNSEQNQPVAKCIESLLGKRVKQVACGGFHTAAVTESGHVFTW  265

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LGH   V         N ++P  V +L    + VVQ++      W +HT ALT
Sbjct  266  GGGEHGQLGHGDKV---------NQITPTRVENLTD--KYVVQVTCG----W-SHTVALT  309

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERAN-PERVEV  103
            + G++  +G GD G+LG     N T +   P+ +E+
Sbjct  310  DNGEVLTWGNGDHGKLG----HNDTNKVTVPKLIEM  341


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 68/148 (46%), Gaps = 21/148 (14%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            TWG G  G LG G+   +  P +VEA  + + V ++ G   T V+++DG  Y++G G+  
Sbjct  5    TWGRGEDGQLGLGDTSDQYHPILVEALQDRQIVQISCGSGHTVVLTDDGKVYTWGRGDDG  64

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH           +     P LV  L    + V Q++       + HT A+T  G L+
Sbjct  65   RLGH---------GDNGWKFVPRLVEHLGD--KEVCQVTCG-----SYHTAAVT--GDLY  106

Query  189  AFGAGDKGQLGVALSANQTERANPERVE  106
             +G G  G+LG     N+     P  VE
Sbjct  107  TWGGGMYGKLG---HGNENGHPTPSLVE  131



>emb|CCA17552.1| regulator of chromosome condensation (RCC1)like protein putative 
[Albugo laibachii Nc14]
Length=545

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 73/148 (49%), Gaps = 20/148 (14%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   TWG G YG LGHGNE+  S P +VE+   +    VA G   T V+ E+ D Y++G 
Sbjct  105  GELYTWGGGMYGKLGHGNENGHSTPSLVESIKGLYVRQVACGSRHTVVLLENQDVYTWGD  164

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
             E+   GH      G  + H    SP  V+ L       V+I++        HT AL+E 
Sbjct  165  KENGVSGH------GDTSGHQ--YSPYCVSEL-------VEINIKQISACGFHTAALSEN  209

Query  201  GKLFAFGAGDKGQLGVALSANQTERANP  118
            G++F FG G  G+LG     + +ER  P
Sbjct  210  GQVFTFGEGKFGRLG-----HNSERNQP  232


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 81/154 (53%), Gaps = 19/154 (12%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            ++G+  T+G G++G LGH +E  +   K ++A    +   VA G + T  V+E G  +++
Sbjct  208  ENGQVFTFGEGKFGRLGHNSERNQPVAKCIDALIGKRIKQVACGGFHTAAVTESGHVFTW  267

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LGH   V         N + P  V SL  + + ++Q++      W +HT ALT
Sbjct  268  GGGEHGQLGHGDKV---------NQIIPTRVESL--IDKNIIQLTCG----W-SHTVALT  311

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            + G++F +G GD G+LG   +   TE   P+ +E
Sbjct  312  DKGEVFTWGNGDHGKLGHNDTNKVTE---PKLIE  342


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 72/148 (49%), Gaps = 19/148 (13%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            TWG G  G LG G+   +  P +VEA  + + V ++ G   T V+++DG  Y++G G+  
Sbjct  5    TWGRGEDGQLGLGDTSDQYHPILVEALQDRQTVQISCGSGHTVVLTDDGKVYTWGRGDDG  64

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LGH           +     P LV  L+   ++V Q++       + HT A+T  G+L+
Sbjct  65   RLGHGD---------NGWKFVPRLVEDLRD--KKVRQVTCG-----SYHTAAVTVSGELY  108

Query  189  AFGAGDKGQLGVALSANQTERANPERVE  106
             +G G  G+LG     N+   + P  VE
Sbjct  109  TWGGGMYGKLG---HGNENGHSTPSLVE  133


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (49%), Gaps = 16/119 (13%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            + G   TWG G +G LGHG++  +  P  VE+  +   + +  G   T  +++ G+ +++
Sbjct  260  ESGHVFTWGGGEHGQLGHGDKVNQIIPTRVESLIDKNIIQLTCGWSHTVALTDKGEVFTW  319

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            G G+   LGHN           + +  P+L+ +     +RV+ ++      +N HT AL
Sbjct  320  GNGDHGKLGHNDT---------NKVTEPKLIETFN--SKRVISVA-----SYNEHTVAL  362



>ref|XP_005833902.1| hypothetical protein GUITHDRAFT_86569 [Guillardia theta CCMP2712]
 gb|EKX46922.1| hypothetical protein GUITHDRAFT_86569 [Guillardia theta CCMP2712]
Length=306

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 82/148 (55%), Gaps = 17/148 (11%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            +WG G  G LGHG+E  +  P++V A        V+ G+  T ++ E+G+ ++FG G   
Sbjct  10   SWGQGVLGQLGHGDEKTQRQPRLVVAFLGFNVRQVSCGNQHTAILMENGEVFTFGRGNFG  69

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LG  A V        +N+ +P LV++L+   + V Q++      W+ HT AL + G+L+
Sbjct  70   QLGQGASVT-------ANVSTPALVSALQ--GKHVKQVACG----WH-HTCALIDNGQLY  115

Query  189  AFGAGDKGQLGVALSANQTERANPERVE  106
             +G+G+ G+LG     ++  +A+P+ VE
Sbjct  116  TWGSGEYGRLG---HGDEVRQASPKLVE  140


 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 76/156 (49%), Gaps = 16/156 (10%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   TWG G +G LGHG+E     PK+V+         VA G + T ++++  + +++G 
Sbjct  164  GNLLTWGGGYFGQLGHGDETDRKTPKMVKGVQQCIAHEVACGTHHTLMLTQSQEVWTWGS  223

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            GE   LG       G   +H+    P ++T+L+ V   V+ IS         H+ ALT  
Sbjct  224  GEFGKLG------IGDEEKHAE---PIMITALQGVG--VIHISTGG-----FHSAALTSE  267

Query  201  GKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
            G L+ +G GDKGQLG     +Q      E +  D+S
Sbjct  268  GVLYTWGGGDKGQLGHGDENSQNIPVVVEVISCDMS  303


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 76/149 (51%), Gaps = 19/149 (13%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
            +G+  TWG G YG LGHG+E  +++PK+VE+    +   VA G + + V+ E G+  ++G
Sbjct  111  NGQLYTWGSGEYGRLGHGDEVRQASPKLVESLQGKEVTFVAAGGFHSSVIIEGGNLLTWG  170

Query  384  CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
             G    LGH            ++  +P++V  ++Q     V            HT  LT+
Sbjct  171  GGYFGQLGH---------GDETDRKTPKMVKGVQQCIAHEVACG-------THHTLMLTQ  214

Query  204  XGKLFAFGAGDKGQLGVALSANQTERANP  118
              +++ +G+G+ G+LG+    ++ + A P
Sbjct  215  SQEVWTWGSGEFGKLGI---GDEEKHAEP  240


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 67/156 (43%), Gaps = 21/156 (13%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCE--SAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAY  394
            ++G   T+G G +G LG G       S P +V A        VA G + T  + ++G  Y
Sbjct  56   ENGEVFTFGRGNFGQLGQGASVTANVSTPALVSALQGKHVKQVACGWHHTCALIDNGQLY  115

Query  393  SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
            ++G GE   LGH   V            SP+LV SL+      V            H+  
Sbjct  116  TWGSGEYGRLGHGDEVRQA---------SPKLVESLQGKEVTFVAAG-------GFHSSV  159

Query  213  LTEXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
            + E G L  +G G  GQLG     ++T+R  P+ V+
Sbjct  160  IIEGGNLLTWGGGYFGQLG---HGDETDRKTPKMVK  192



>gb|EFA86701.1| hypothetical protein PPL_00504 [Polysphondylium pallidum PN500]
Length=237

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 71/144 (49%), Gaps = 16/144 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DGR  +WG G +G LGHG+    + P  +     I+   V+ G   T ++   GD Y+F
Sbjct  72   RDGRLISWGSGEFGQLGHGDCQHSNTPTAINGFEAIR--FVSCGFSHTMIIDSKGDLYTF  129

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G   S  LG         +   SN   P LV  +    E++  ++        AH+ ALT
Sbjct  130  GWNGSGQLG---------LGDKSNRSVPTLVDPMLFCGEKLKMVAAGR-----AHSVALT  175

Query  207  EXGKLFAFGAGDKGQLGVALSANQ  136
            E G+LF +G+G KG+LG   ++N+
Sbjct  176  ESGRLFTWGSGSKGKLGNGDTSNE  199



>ref|XP_007033301.1| Regulator of chromosome condensation (RCC1) family protein [Theobroma 
cacao]
 gb|EOY04227.1| Regulator of chromosome condensation (RCC1) family protein [Theobroma 
cacao]
Length=393

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 76/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P +V+  S +  V +A G + +  +++DG+ Y +
Sbjct  214  EDGTLWAWGNNEYGQLGTGDTQPRSQPILVQGLSGLTLVDIAAGGWHSTALTDDGEVYGW  273

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          N  S+ + P+ V  L    E +VQ+S   +     H+ ALT
Sbjct  274  GRGEHGRLGFGD-------NDKSSKMVPQRVHLL--ASEDIVQVSCGGT-----HSVALT  319

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G +F+FG GD G+LG      +     P  V V+L  P
Sbjct  320  RDGCMFSFGRGDHGRLGY---GRKVTTGQPMEVPVNLPAP  356


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 63/150 (42%), Gaps = 13/150 (9%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DG+  TWGW + G LGH  E   E+ P  V+A +N+  V  A G +    V + G AY++
Sbjct  56   DGKLFTWGWNQRGTLGHPPETKTENIPSPVKALANVNIVQAAIGGWHCLAVDDKGRAYAW  115

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G  E    G      DG        L  ++V   +   + VV+           H+  LT
Sbjct  116  GGNEYGQCGEEPERKDGT----GRPLRRDIVNPQRCAPKLVVRQVAAGG----THSVVLT  167

Query  207  EXGKLFAFG----AGDKGQLGVALSANQTE  130
              G ++ +G     GD  Q+ V +     E
Sbjct  168  REGHVWTWGQPWPPGDITQISVPVRVQGLE  197



>ref|XP_552411.3| AGAP011823-PA [Anopheles gambiae str. PEST]
 gb|EAL38855.3| AGAP011823-PA [Anopheles gambiae str. PEST]
Length=4947

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 71/136 (52%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG+  +WG G  G LGHGN      PK++E     +   +A G   +  ++  G+ Y++G
Sbjct  3133  DGKVFSWGEGEDGKLGHGNRLTLEKPKLIETLRTKRIRDIACGSSHSAAITSSGELYTWG  3192

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              GE   LGH           +   L P+LVT+L+    RVVQ++  +    +A T  LTE
Sbjct  3193  LGEYGRLGH---------GDNCTQLKPKLVTALQD--HRVVQVACGSR---DAQTLCLTE  3238

Query  204   XGKLFAFGAGDKGQLG  157
              G +F++G GD G+LG
Sbjct  3239  DGLVFSWGDGDFGKLG  3254


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 67/136 (49%), Gaps = 14/136 (10%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             DG   +WG G  G LGHGN D    PK++E+ S I  V +A G   +  ++  G   ++G
Sbjct  4194  DGEVFSWGEGEDGKLGHGNRDSYDRPKLIESLSGIGVVDIACGSAHSACITIQGHVLTWG  4253

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G    LGH             + L P+LV +L  +  R + I+  +    +A T  +T+
Sbjct  4254  KGRYGRLGH---------GDSEDQLQPKLVEAL--LGYRAIDIACGSG---DAQTLCITD  4299

Query  204   XGKLFAFGAGDKGQLG  157
                ++++G GD G+LG
Sbjct  4300  DDNVWSWGDGDYGKLG  4315


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 73/155 (47%), Gaps = 19/155 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG G  G LGHG+   +  P  + A ++ +   V  G   +  ++  G+ Y++G 
Sbjct  628  GDVYSWGSGDGGRLGHGDTSAKELPTRIAALADRQVTGVFCGSSYSAAITASGELYTWGR  687

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEX  202
            G    LGH             +   P LVT+LK    RVV ++L      +AH+  +TE 
Sbjct  688  GTYGRLGH---------GNSEDKYVPTLVTALK--AHRVVHVALGCG---DAHSLCVTEA  733

Query  201  GKLFAFGAGDKGQLGVALSANQTERANPERVEVDL  97
            G  FA+G GD G+LG     N++       V+VDL
Sbjct  734  GLAFAWGDGDFGKLG-----NESCVGTSVPVQVDL  763


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 68/155 (44%), Gaps = 25/155 (16%)
 Frame = -2

Query  558   RXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCG  379
             +   WG      LG         P      S +K +H+A G  + F+VS+DG  Y+  CG
Sbjct  3029  KVLVWGLNDKEQLGGLKGSKVKLPTYSSVLSQLKPIHIAGGSKSLFIVSQDGKLYA--CG  3086

Query  378   ESSS----LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
             E ++    LGHN           +N+ +P+ V  L Q   + V +          H  AL
Sbjct  3087  EGTNGRLGLGHN-----------NNVPTPKQVPILSQYVVKKVAVH-----SGGKHAMAL  3130

Query  210   TEXGKLFAFGAGDKGQLGVALSANQTERANPERVE  106
             T  GK+F++G G+ G+LG     N+     P+ +E
Sbjct  3131  TLDGKVFSWGEGEDGKLG---HGNRLTLEKPKLIE  3162


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 58/120 (48%), Gaps = 16/120 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             + G   TWG G Y  LGHGN D    PK V A    K + +ATG       S+ G+ +++
Sbjct  4351  RSGSVYTWGKGDYHRLGHGNTDHVRRPKKVAALQGKKIISIATGSLHCVACSDAGEVFTW  4410

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G  +   LG      DG V   S I  P LV SL+   + +V++     I  +AHT AL+
Sbjct  4411  GDNDEGQLG------DGTV---SAIQRPRLVQSLQ--GKHIVKV-----ICGSAHTLALS  4454


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 66/138 (48%), Gaps = 20/138 (14%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVAT--GDYTTFVVSEDGDAYSF  388
            G   TWG G YG LGHGN + +  P +V A    + VHVA   GD  +  V+E G A+++
Sbjct  680  GELYTWGRGTYGRLGHGNSEDKYVPTLVTALKAHRVVHVALGCGDAHSLCVTEAGLAFAW  739

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAH-TFAL  211
            G G+   LG+ + V                 TS+  V   + Q S    ++  +  + AL
Sbjct  740  GDGDFGKLGNESCVG----------------TSVP-VQVDLPQASCVVKVFSGSQFSVAL  782

Query  210  TEXGKLFAFGAGDKGQLG  157
            T  G ++ +G G  G+LG
Sbjct  783  TREGTVYTWGKGHGGRLG  800


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 70/139 (50%), Gaps = 18/139 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSN--IKXVHVATGDYTTFVVSEDGDAY  394
             +DG+    G G  G LG G+ +    PK V   S   +K V V +G      ++ DG  +
Sbjct  3078  QDGKLYACGEGTNGRLGLGHNNNVPTPKQVPILSQYVVKKVAVHSGGKHAMALTLDGKVF  3137

Query  393   SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
             S+G GE   LGH         NR + +  P+L+ +L+   +R+  I+  +S     H+ A
Sbjct  3138  SWGEGEDGKLGHG--------NRLT-LEKPKLIETLR--TKRIRDIACGSS-----HSAA  3181

Query  213   LTEXGKLFAFGAGDKGQLG  157
             +T  G+L+ +G G+ G+LG
Sbjct  3182  ITSSGELYTWGLGEYGRLG  3200


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 70/147 (48%), Gaps = 17/147 (12%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFG  385
             D    +WG G YG LG G  D    P  +E+ + +    V  G   +  ++  G  Y++G
Sbjct  4300  DDNVWSWGDGDYGKLGRGGSDGCKVPMKIESLAGLGVTKVECGSQFSVALTRSGSVYTWG  4359

Query  384   CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTE  205
              G+   LGH             ++  P+ V +L+   ++++ I+ T S+    H  A ++
Sbjct  4360  KGDYHRLGHGNT---------DHVRRPKKVAALQ--GKKIISIA-TGSL----HCVACSD  4403

Query  204   XGKLFAFGAGDKGQLGV-ALSANQTER  127
              G++F +G  D+GQLG   +SA Q  R
Sbjct  4404  AGEVFTWGDNDEGQLGDGTVSAIQRPR  4430



>ref|XP_002998335.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY70681.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=2353

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 71/146 (49%), Gaps = 19/146 (13%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDG---DAY  394
            DGR  T G+   G LGHGN   ES PK++ +  N     V+   Y T +  EDG   + Y
Sbjct  666  DGRVATCGYNYRGQLGHGNTTSESVPKIIRSLENKIVRLVSCSYYHTVLACEDGNLQNLY  725

Query  393  SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
            +FG  +   LGHN  + D ++        P+ V +L    +++V ++         HT  
Sbjct  726  TFGRNDYGQLGHNDSI-DRKI--------PQFVEALSD--QQIVSVACG-----QYHTMV  769

Query  213  LTEXGKLFAFGAGDKGQLGVALSANQ  136
            +T  GK FAFG  D GQLG+    NQ
Sbjct  770  VTASGKAFAFGKNDYGQLGIDTMENQ  795


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 64/135 (47%), Gaps = 15/135 (11%)
 Frame = -2

Query  549  TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESS  370
            T+G   YG LGH +      P+ VEA S+ + V VA G Y T VV+  G A++FG  +  
Sbjct  726  TFGRNDYGQLGHNDSIDRKIPQFVEALSDQQIVSVACGQYHTMVVTASGKAFAFGKNDYG  785

Query  369  SLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLF  190
             LG         ++   N L+P     ++   ER   + +    Y   HT AL     LF
Sbjct  786  QLG---------IDTMENQLAP---VQVRGGLERQECLEIRCGYY---HTIALCSGAHLF  830

Query  189  AFGAGDKGQLGVALS  145
            AFG  D GQLG+  S
Sbjct  831  AFGRNDYGQLGLGRS  845



>ref|XP_006143351.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Tupaia chinensis]
Length=945

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG   +G LG G+ + + +P ++ A  + K   +A G   T ++++DG  ++FG 
Sbjct  131  GNVYSWGKNDFGQLGLGHTESKDSPSLLRALDSQKVDFLACGGSHTALLTQDGLVFTFGA  190

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGH++   +         L P LVT L  +  RV QI+      W  HT A ++E
Sbjct  191  GKYGQLGHSSTRDE---------LRPCLVTEL--LGNRVTQIACGR---W--HTLAYVSE  234

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+FAFG+G  GQLG   + NQ
Sbjct  235  LGKVFAFGSGKNGQLGNCGTHNQ  257



>ref|NP_001061858.1| Os08g0430700 [Oryza sativa Japonica Group]
 dbj|BAD01172.1| putative UVB-resistance protein UVR8 [Oryza sativa Japonica Group]
 dbj|BAF23772.1| Os08g0430700 [Oryza sativa Japonica Group]
 dbj|BAG95718.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68730.1| hypothetical protein OsJ_27407 [Oryza sativa Japonica Group]
Length=395

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 79/160 (49%), Gaps = 18/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  VE  S++  V +A G + +  ++++G+ Y++
Sbjct  220  EDGILWAWGNNEYGQLGTGDTQPRSQPIRVEGLSDLSLVDIAAGGWHSTALTKEGEVYAW  279

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          +  S+ + P+ V  L    E ++Q+S   +     H+ ALT
Sbjct  280  GRGEHGRLGFG--------DDKSSHMVPQKVELL--AGEDIIQVSCGGT-----HSVALT  324

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F++G GD G+LG      +    +P  V +DL  P
Sbjct  325  RDGRMFSYGRGDHGRLGY---GRKVTTGHPMEVPIDLPPP  361


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 83/192 (43%), Gaps = 42/192 (22%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DGR  TWGW + G LGH  E   ES+P  V+A + +  V  A G +    V + G AY++
Sbjct  62   DGRLFTWGWNQRGTLGHPPETKTESSPAPVDALAGVSIVQAAIGGWHCLAVDDKGRAYAW  121

Query  387  G------CGESSSL---GHNAVVXDGQVNR----------------HSNILS--------  307
            G      CGE +     G  A+  D  + +                HS +L+        
Sbjct  122  GGNEYGQCGEEAERKEDGTRALRRDIPIPQGCAPKLKVRQVAAGGTHSVVLTQDGHVWTW  181

Query  306  --PELVTSLKQVXE--RVVQISLTNSIYWNA-HTFALTEXGKLFAFGAGDKGQLGVALSA  142
              P     +KQ+    RV  +     I   A H  ALTE G L+A+G  + GQLG   + 
Sbjct  182  GQPWPPGDIKQISTPVRVQGLENVKVIAVGAFHNLALTEDGILWAWGNNEYGQLG---TG  238

Query  141  NQTERANPERVE  106
            +   R+ P RVE
Sbjct  239  DTQPRSQPIRVE  250



>gb|EEC83614.1| hypothetical protein OsI_29322 [Oryza sativa Indica Group]
Length=395

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 79/160 (49%), Gaps = 18/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  VE  S++  V +A G + +  ++++G+ Y++
Sbjct  220  EDGILWAWGNNEYGQLGTGDTQPRSQPIRVEGLSDLSLVDIAAGGWHSTALTKEGEVYAW  279

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          +  S+ + P+ V  L    E ++Q+S   +     H+ ALT
Sbjct  280  GRGEHGRLGFG--------DDKSSHMVPQKVELL--AGEDIIQVSCGGT-----HSVALT  324

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F++G GD G+LG      +    +P  V +DL  P
Sbjct  325  RDGRMFSYGRGDHGRLGY---GRKVTTGHPMEVPIDLPPP  361


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 83/192 (43%), Gaps = 42/192 (22%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DGR  TWGW + G LGH  E   ES+P  V+A + +  V  A G +    V + G AY++
Sbjct  62   DGRLFTWGWNQRGTLGHPPETKTESSPAPVDALAGVSIVQAAIGGWHCLAVDDKGRAYAW  121

Query  387  G------CGESSSL---GHNAVVXDGQVNR----------------HSNILS--------  307
            G      CGE +     G  A+  D  + +                HS +L+        
Sbjct  122  GGNEYGQCGEEAERKEDGTRALRRDIPIPQRCAPKLKVRQVAAGGTHSVVLTQDGHVWTW  181

Query  306  --PELVTSLKQVXE--RVVQISLTNSIYWNA-HTFALTEXGKLFAFGAGDKGQLGVALSA  142
              P     +KQ+    RV  +     I   A H  ALTE G L+A+G  + GQLG   + 
Sbjct  182  GQPWPPGDIKQISTPVRVQGLENVKVIAVGAFHNLALTEDGILWAWGNNEYGQLG---TG  238

Query  141  NQTERANPERVE  106
            +   R+ P RVE
Sbjct  239  DTQPRSQPIRVE  250



>ref|XP_008478281.1| PREDICTED: protein pim1-like [Diaphorina citri]
Length=688

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 16/132 (12%)
 Frame = -2

Query  546  WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
            WG  +YG LG G  D    P+++ A +NI+ V ++ G Y +  ++  G  Y++G G    
Sbjct  41   WGSSQYGQLGIGLIDQSPHPRIIPALANIRVVSISAGQYHSLAITSQGKLYTWGWGVHGQ  100

Query  366  LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
            LG N V          ++  P+LV +L    E  V IS       +AH+ ALT+ G+++A
Sbjct  101  LGLNTV---------EDMSEPQLVKAL----EHEVIISAKGG---HAHSIALTKAGRVWA  144

Query  186  FGAGDKGQLGVA  151
            FG+G  GQLG  
Sbjct  145  FGSGIFGQLGTG  156



>ref|XP_006659424.1| PREDICTED: ultraviolet-B receptor UVR8-like [Oryza brachyantha]
Length=393

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 79/160 (49%), Gaps = 18/160 (11%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            +DG    WG   YG LG G+    S P  VE  S++  V +A G + +  ++++G+ Y++
Sbjct  219  EDGILWAWGNNEYGQLGTGDTQPRSQPIRVEGLSDLSLVDIAAGGWHSTALTKEGEVYAW  278

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G GE   LG          +  S+ + P+ V  L    E ++Q+S   +     H+ ALT
Sbjct  279  GRGEHGRLGFG--------DDKSSHMVPQKVQLL--AGEDIIQVSCGGT-----HSVALT  323

Query  207  EXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS*P  88
              G++F++G GD G+LG      +    +P  V +DL  P
Sbjct  324  SDGRMFSYGRGDHGRLGY---GRKVTTGHPMEVPIDLPPP  360


 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 83/192 (43%), Gaps = 42/192 (22%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
            DGR  TWGW + G LGH  E   ES P  VEA + ++ V  A G +    V + G AY++
Sbjct  61   DGRLFTWGWNQRGTLGHPPETKTESFPGPVEALAGVRIVQAAIGGWHCLAVDDKGRAYAW  120

Query  387  G------CGESSSL---GHNAVVXDGQVNR----------------HSNILS--------  307
            G      CGE +     G  A+  D  + +                HS +L+        
Sbjct  121  GGNEYGQCGEEAERKEDGTRALRRDIPIPQRCAPKLKVRQVAAGGTHSVVLTQEGHVWTW  180

Query  306  --PELVTSLKQVXERVVQISLTN--SIYWNA-HTFALTEXGKLFAFGAGDKGQLGVALSA  142
              P     +KQ+   V    L N   I   A H  ALTE G L+A+G  + GQLG   + 
Sbjct  181  GQPWPPGDIKQISTPVRVQGLENVRMIAVGAFHNLALTEDGILWAWGNNEYGQLG---TG  237

Query  141  NQTERANPERVE  106
            +   R+ P RVE
Sbjct  238  DTQPRSQPIRVE  249



>gb|KFO20813.1| Putative E3 ubiquitin-protein ligase HERC6, partial [Fukomys 
damarensis]
Length=880

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 72/143 (50%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+     +P +VE   + K   +A G   T +V++DG  ++FG 
Sbjct  119  GNAYSWGENDCGQLGLGHTKNTDSPSLVEVPDHQKVEFLACGGAHTALVTQDGLMFTFGA  178

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV QI+      W  HT A +++
Sbjct  179  GKYGQLGHNST---------ENELRPRLVTELS--GNRVTQIACGR---W--HTLAYVSD  222

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG G++GQLG     NQ
Sbjct  223  LGKVFSFGFGEEGQLGNNGKHNQ  245


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFV-VSEDGDAYS  391
            +DG   T+G G+YG LGH + + E  P++V   S  +   +A G + T   VS+ G  +S
Sbjct  169  QDGLMFTFGAGKYGQLGHNSTENELRPRLVTELSGNRVTQIACGRWHTLAYVSDLGKVFS  228

Query  390  FGCGESSSLGHNA  352
            FG GE   LG+N 
Sbjct  229  FGFGEEGQLGNNG  241


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 48/162 (30%), Positives = 67/162 (41%), Gaps = 27/162 (17%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG    G LG G +      P+ V++ + +  V ++ G   +  +S  G+AYS
Sbjct  64   KGGELFAWGQNLRGQLGVGRKFPSTPTPQAVQSLTGVPLVQISAGGAHSVALSMSGNAYS  123

Query  390  FG---CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHT  220
            +G   CG+   LGH             N  SP LV          +           AHT
Sbjct  124  WGENDCGQLG-LGHT-----------KNTDSPSLVEVPDHQKVEFLACG-------GAHT  164

Query  219  FALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
              +T+ G +F FGAG  GQLG     N TE     R+  +LS
Sbjct  165  ALVTQDGLMFTFGAGKYGQLG----HNSTENELRPRLVTELS  202



>ref|XP_006629113.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like [Lepisosteus 
oculatus]
Length=4754

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 80/156 (51%), Gaps = 20/156 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             + G   +WG G YG LGHGN D +  P+ +EA    + V ++ G   + VV+ DG  Y+F
Sbjct  3992  ESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTADGKLYTF  4051

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LG         +   SN   PE VT+L+      V   L        HT A++
Sbjct  4052  GNGDYGRLG---------LGNTSNKKLPERVTALEGYQVGQVACGLN-------HTLAVS  4095

Query  207   EXGKL-FAFGAGDKGQLGVALSANQTERANPERVEV  103
               G + +AFG GD G+LG+    N T +++P++V+V
Sbjct  4096  ADGMMVWAFGDGDYGKLGL---GNSTAKSSPQKVDV  4128


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 72/138 (52%), Gaps = 20/138 (14%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYT-TFVVSEDGDAYSF  388
            +G   +WG G YG LGHGN   +  PK+++     K V   +  Y  +  VSEDG+ Y++
Sbjct  476  EGEVFSWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVSEDGELYTW  535

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LGH      G  N   NI  P LV  +  V E    +S  +S     HT AL+
Sbjct  536  GEGDFGRLGH------GDSNSR-NI--PTLVKDISNVGE----VSCGSS-----HTIALS  577

Query  207  EXGK-LFAFGAGDKGQLG  157
            + G+ +++FG GD G+LG
Sbjct  578  KDGRTVWSFGGGDNGKLG  595


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 69/132 (52%), Gaps = 19/132 (14%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDG-DAYS  391
            +DG   TWG G +G LGHG+ +  + P +V+  SN+    V+ G   T  +S+DG   +S
Sbjct  528  EDGELYTWGEGDFGRLGHGDSNSRNIPTLVKDISNVG--EVSCGSSHTIALSKDGRTVWS  585

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            FG G++  LGH      G  NR   +  P++  +L+ +  R V     +S+       AL
Sbjct  586  FGGGDNGKLGH------GDTNR---VYKPKVTEALQGMFIRKVCAGSQSSL-------AL  629

Query  210  TEXGKLFAFGAG  175
            T  G+++A+G G
Sbjct  630  TSTGQVYAWGCG  641


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 64/138 (46%), Gaps = 18/138 (13%)
 Frame = -2

Query  567  KDGRXC-TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            KDGR   ++G G  G LGHG+ +    PKV EA   +    V  G  ++  ++  G  Y+
Sbjct  578  KDGRTVWSFGGGDNGKLGHGDTNRVYKPKVTEALQGMFIRKVCAGSQSSLALTSTGQVYA  637

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +GCG     G +           +  L P+LV  L     RVV IS+ +S     H  AL
Sbjct  638  WGCGACLGCGSS----------EATALRPKLVEEL--ATTRVVDISIGDS-----HCLAL  680

Query  210  TEXGKLFAFGAGDKGQLG  157
            +   +++A+G    GQ G
Sbjct  681  SHDNEVYAWGNNSMGQCG  698


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 70/155 (45%), Gaps = 22/155 (14%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVAT---GDYTTFVVSEDGDAY  394
             +G     G G YG LG GN D      V+ A        + T    D  +  ++E G+ +
Sbjct  3938  NGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVF  3997

Query  393   SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
             S+G G+   LGH      G  +R      P  + +L+   E VVQ+S         H+  
Sbjct  3998  SWGDGDYGKLGH------GNSDRQRR---PRQIEALQ--GEEVVQMSCGFK-----HSAV  4041

Query  213   LTEXGKLFAFGAGDKGQLGVALSANQTERANPERV  109
             +T  GKL+ FG GD G+LG+    N + +  PERV
Sbjct  4042  VTADGKLYTFGNGDYGRLGL---GNTSNKKLPERV  4073



>ref|XP_004916028.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1 isoform 
X4 [Xenopus (Silurana) tropicalis]
Length=4828

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 81/156 (52%), Gaps = 20/156 (13%)
 Frame = -2

Query  567   KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSF  388
             + G   +WG G YG LGHGN D +  P+ +EA    + V ++ G   + VV+ DG  ++F
Sbjct  4066  ESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTADGKLFTF  4125

Query  387   GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
             G G+   LG         +   SN   PE VT+L+ +    V   L        HT A++
Sbjct  4126  GNGDYGRLG---------LGNTSNKKLPERVTALEGLHIGQVACGLN-------HTLAVS  4169

Query  207   EXGKL-FAFGAGDKGQLGVALSANQTERANPERVEV  103
               G L +AFG GD G+LG+    N T +++P++V+V
Sbjct  4170  ADGSLVWAFGDGDYGKLGL---GNSTAKSSPQKVDV  4202


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 72/138 (52%), Gaps = 20/138 (14%)
 Frame = -2

Query  564  DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYT-TFVVSEDGDAYSF  388
            +G   +WG G YG LGHGN   +  PK+++     K V   +  Y  +  V+EDG+ Y++
Sbjct  476  EGEVFSWGDGDYGKLGHGNSSTQKYPKLIQGTLQGKVVVCVSAGYRHSAAVTEDGELYTW  535

Query  387  GCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALT  208
            G G+   LGH      G  N   NI  P LV  +  V E    +S  +S     HT AL+
Sbjct  536  GEGDFGRLGH------GDSNSR-NI--PTLVKDISNVGE----VSCGSS-----HTIALS  577

Query  207  EXGK-LFAFGAGDKGQLG  157
            + G+ +++FG GD G+LG
Sbjct  578  KDGRTVWSFGGGDNGKLG  595


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 70/132 (53%), Gaps = 19/132 (14%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDG-DAYS  391
            +DG   TWG G +G LGHG+ +  + P +V+  SN+    V+ G   T  +S+DG   +S
Sbjct  528  EDGELYTWGEGDFGRLGHGDSNSRNIPTLVKDISNVG--EVSCGSSHTIALSKDGRTVWS  585

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            FG G++  LGH      G  NR   +  P++V +L+ +  R V     +S+       AL
Sbjct  586  FGGGDNGKLGH------GDTNR---VYKPKVVEALQGMFTRKVCAGSQSSL-------AL  629

Query  210  TEXGKLFAFGAG  175
            T  G+++A+G G
Sbjct  630  TSTGQVYAWGCG  641


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 65/138 (47%), Gaps = 18/138 (13%)
 Frame = -2

Query  567  KDGRXC-TWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            KDGR   ++G G  G LGHG+ +    PKVVEA   +    V  G  ++  ++  G  Y+
Sbjct  578  KDGRTVWSFGGGDNGKLGHGDTNRVYKPKVVEALQGMFTRKVCAGSQSSLALTSTGQVYA  637

Query  390  FGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFAL  211
            +GCG     G +           +  L P+L+  L     R+V IS+ +S     H  AL
Sbjct  638  WGCGACLGCGSS----------EATALRPKLIEEL--AATRIVDISIGDS-----HCLAL  680

Query  210  TEXGKLFAFGAGDKGQLG  157
            +   +++A+G    GQ G
Sbjct  681  SHDNEVYAWGNNSMGQCG  698


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 70/155 (45%), Gaps = 22/155 (14%)
 Frame = -2

Query  564   DGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVAT---GDYTTFVVSEDGDAY  394
             +G     G G YG LG GN D      V+ A        + T    D  +  ++E G+ +
Sbjct  4012  NGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVF  4071

Query  393   SFGCGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA  214
             S+G G+   LGH      G  +R      P  + +L+   E VVQ+S         H+  
Sbjct  4072  SWGDGDYGKLGH------GNSDRQRR---PRQIEALQ--GEEVVQMSCGFK-----HSAV  4115

Query  213   LTEXGKLFAFGAGDKGQLGVALSANQTERANPERV  109
             +T  GKLF FG GD G+LG+    N + +  PERV
Sbjct  4116  VTADGKLFTFGNGDYGRLGL---GNTSNKKLPERV  4147


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 67/131 (51%), Gaps = 16/131 (12%)
 Frame = -2

Query  546   WGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGCGESSS  367
             +G G YG LG GN   +S+P+ V+    I    VA G   +  +++DG  Y+F  G+   
Sbjct  4178  FGDGDYGKLGLGNSTAKSSPQKVDVLCGIGIKKVACGTQFSVALTKDGHVYTF--GQDRL  4235

Query  366   LGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFALTEXGKLFA  187
             +G    + +G+   H+    P+LV  L       + I + +      HT AL+  G+++A
Sbjct  4236  IG----LPEGRARNHNR---PQLVPVL-------LGIFIDDIAVGAEHTLALSASGEVYA  4281

Query  186   FGAGDKGQLGV  154
             +G+  +GQLG+
Sbjct  4282  WGSNSEGQLGL  4292



>ref|XP_010608801.1| PREDICTED: E3 ISG15--protein ligase HERC5 [Fukomys damarensis]
Length=944

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 72/143 (50%), Gaps = 17/143 (12%)
 Frame = -2

Query  561  GRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYSFGC  382
            G   +WG    G LG G+     +P +VE   + K   +A G   T +V++DG  ++FG 
Sbjct  132  GNAYSWGENDCGQLGLGHTKNTDSPSLVEVPDHQKVEFLACGGAHTALVTQDGLMFTFGA  191

Query  381  GESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHTFA-LTE  205
            G+   LGHN+           N L P LVT L     RV QI+      W  HT A +++
Sbjct  192  GKYGQLGHNST---------ENELRPRLVTELS--GNRVTQIACGR---W--HTLAYVSD  235

Query  204  XGKLFAFGAGDKGQLGVALSANQ  136
             GK+F+FG G++GQLG     NQ
Sbjct  236  LGKVFSFGFGEEGQLGNNGKHNQ  258


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNEDCESAPKVVEAXSNIKXVHVATGDYTTFV-VSEDGDAYS  391
            +DG   T+G G+YG LGH + + E  P++V   S  +   +A G + T   VS+ G  +S
Sbjct  182  QDGLMFTFGAGKYGQLGHNSTENELRPRLVTELSGNRVTQIACGRWHTLAYVSDLGKVFS  241

Query  390  FGCGESSSLGHNA  352
            FG GE   LG+N 
Sbjct  242  FGFGEEGQLGNNG  254


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 48/162 (30%), Positives = 67/162 (41%), Gaps = 27/162 (17%)
 Frame = -2

Query  567  KDGRXCTWGWGRYGCLGHGNE-DCESAPKVVEAXSNIKXVHVATGDYTTFVVSEDGDAYS  391
            K G    WG    G LG G +      P+ V++ + +  V ++ G   +  +S  G+AYS
Sbjct  77   KGGELFAWGQNLRGQLGVGRKFPSTPTPQAVQSLTGVPLVQISAGGAHSVALSMSGNAYS  136

Query  390  FG---CGESSSLGHNAVVXDGQVNRHSNILSPELVTSLKQVXERVVQISLTNSIYWNAHT  220
            +G   CG+   LGH             N  SP LV          +           AHT
Sbjct  137  WGENDCGQLG-LGHT-----------KNTDSPSLVEVPDHQKVEFLACG-------GAHT  177

Query  219  FALTEXGKLFAFGAGDKGQLGVALSANQTERANPERVEVDLS  94
              +T+ G +F FGAG  GQLG     N TE     R+  +LS
Sbjct  178  ALVTQDGLMFTFGAGKYGQLG----HNSTENELRPRLVTELS  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500