BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF020O01

Length=168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABY21254.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  61.2    5e-10   Solanum tuberosum [potatoes]
gb|ABY21253.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  60.8    6e-10   Solanum tuberosum [potatoes]
emb|CAH59401.1|  Rubisco SSU                                          60.8    6e-10   Plantago major [cart-track plant]
sp|P26574.1|RBS1_SOLTU  RecName: Full=Ribulose bisphosphate carbo...  60.8    6e-10   Solanum tuberosum [potatoes]
gb|ABY21255.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  60.8    7e-10   Solanum tuberosum [potatoes]
emb|CAH59404.1|  Rubisco SSU                                          60.5    1e-09   Plantago major [cart-track plant]
sp|P08705.1|RBS_HELAN  RecName: Full=Ribulose bisphosphate carbox...  60.1    1e-09   Helianthus annuus
gb|AAO25119.1|  ribulose-1,5-bisphosphate carboxylase small subunit   60.1    1e-09   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004962611.1|  PREDICTED: ribulose bisphosphate carboxylase...  59.7    2e-09   Setaria italica
ref|NP_198659.1|  ribulose bisphosphate carboxylase small chain 1B    59.7    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198658.1|  ribulose bisphosphate carboxylase small chain 2B    59.3    2e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAA32701.1|  ribulose bisphosphate carboxylase                    59.3    2e-09   Arabidopsis thaliana [mouse-ear cress]
sp|P26573.1|RBS8_NICPL  RecName: Full=Ribulose bisphosphate carbo...  59.3    2e-09   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_001119331.1|  ribulose bisphosphate carboxylase small chai...  59.3    2e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAA32702.1|  ribulose bisphosphate carboxylase                    59.3    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198657.1|  ribulose bisphosphate carboxylase small chain 3B    59.3    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AFW90575.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  59.3    3e-09   Solanum tuberosum [potatoes]
ref|NP_001031981.1|  ribulose bisphosphate carboxylase small chai...  58.9    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006358055.1|  PREDICTED: ribulose-1,5-bisphosphate carboxy...  58.9    3e-09   Solanum tuberosum [potatoes]
ref|XP_006363111.1|  PREDICTED: ribulose bisphosphate carboxylase...  58.9    3e-09   Solanum tuberosum [potatoes]
gb|KJB10450.1|  hypothetical protein B456_001G201800                  58.9    3e-09   Gossypium raimondii
sp|Q39746.1|RBS4_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  58.9    3e-09   Flaveria pringlei
gb|AEX60841.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  58.9    3e-09   Gossypium hirsutum [American cotton]
sp|P26576.1|RBSB_SOLTU  RecName: Full=Ribulose bisphosphate carbo...  58.9    3e-09   Solanum tuberosum [potatoes]
sp|P26575.1|RBSA_SOLTU  RecName: Full=Ribulose bisphosphate carbo...  58.9    4e-09   Solanum tuberosum [potatoes]
gb|AFS41724.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  58.9    4e-09   Gossypium raimondii
ref|XP_009758143.1|  PREDICTED: ribulose bisphosphate carboxylase...  58.5    4e-09   Nicotiana sylvestris
ref|XP_009795055.1|  PREDICTED: ribulose bisphosphate carboxylase...  58.5    4e-09   Nicotiana sylvestris
ref|XP_009800809.1|  PREDICTED: ribulose bisphosphate carboxylase...  58.5    4e-09   Nicotiana sylvestris
sp|P07180.1|RBS3A_SOLLC  RecName: Full=Ribulose bisphosphate carb...  58.5    5e-09   Solanum lycopersicum
ref|XP_004232356.1|  PREDICTED: ribulose bisphosphate carboxylase...  58.2    5e-09   
ref|WP_033581579.1|  ribulose 1,5-bisphosphate carboxylase small ...  56.6    6e-09   
gb|AFS41753.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  58.2    6e-09   Gossypium mustelinum
gb|AAA34192.1|  ribulose-1,5-bisphosphate carboxylase, small subu...  58.2    6e-09   Solanum lycopersicum
ref|XP_004234568.1|  PREDICTED: ribulose bisphosphate carboxylase...  58.2    6e-09   
gb|ABS57004.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    6e-09   synthetic construct
gb|AAA33718.1|  ribulose 1,5-bisphosphate carboxylase                 56.2    7e-09   Petunia x hybrida [garden petunia]
gb|AFS41754.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    7e-09   Gossypium mustelinum
gb|AFS41733.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    7e-09   Gossypium hirsutum [American cotton]
gb|AEX60839.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    7e-09   Gossypium hirsutum [American cotton]
gb|AEX60842.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    7e-09   Gossypium hirsutum [American cotton]
gb|KHG18747.1|  Ribulose bisphosphate carboxylase small chain, ch...  57.8    7e-09   Gossypium arboreum [tree cotton]
gb|AFB70994.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    7e-09   Nicotiana attenuata
gb|AFS41748.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    8e-09   Gossypium tomentosum
ref|XP_010265357.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.4    8e-09   
gb|AFS41744.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    8e-09   Gossypium tomentosum
gb|KJB43046.1|  hypothetical protein B456_007G181300                  57.8    8e-09   Gossypium raimondii
gb|AFS41732.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    8e-09   Gossypium hirsutum [American cotton]
gb|AFS41725.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    8e-09   Gossypium raimondii
gb|AIF75285.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  57.8    8e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75289.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  57.4    9e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75288.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  57.4    9e-09   Arabidopsis suecica
sp|P32764.1|RBS3_SOLTU  RecName: Full=Ribulose bisphosphate carbo...  57.8    9e-09   Solanum tuberosum [potatoes]
gb|AEX60843.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.8    9e-09   Gossypium hirsutum [American cotton]
gb|AIF75295.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  57.4    1e-08   Arabidopsis suecica
ref|XP_009403968.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.4    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009602965.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.4    1e-08   Nicotiana tomentosiformis
ref|XP_009774104.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.4    1e-08   Nicotiana sylvestris
ref|XP_009625434.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.4    1e-08   Nicotiana tomentosiformis
ref|XP_009767108.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.4    1e-08   Nicotiana sylvestris
sp|Q39749.1|RBS7_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  57.0    1e-08   Flaveria pringlei
sp|Q39745.1|RBS3_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  57.0    1e-08   Flaveria pringlei
gb|AAA34111.1|  ribulose-1,5-bisphosphate carboxylase                 56.2    1e-08   Nicotiana sylvestris
ref|XP_004962302.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.0    1e-08   Setaria italica
gb|AAG40356.1|AF325004_1  At1g67090                                   57.0    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176880.1|  ribulose bisphosphate carboxylase small chain 1A    57.0    1e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q39748.1|RBS6_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  57.0    1e-08   Flaveria pringlei
sp|Q39747.1|RBS5_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  57.0    1e-08   Flaveria pringlei
ref|XP_010916368.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.0    1e-08   Elaeis guineensis
ref|XP_006391132.1|  hypothetical protein EUTSA_v10019199mg           57.0    1e-08   Eutrema salsugineum [saltwater cress]
pdb|3RUB|S  Chain S, Crystal Structure Of The Unactivated Form Of...  56.6    1e-08   Nicotiana tabacum [American tobacco]
sp|Q39744.1|RBS2_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  57.0    2e-08   Flaveria pringlei
ref|XP_010435745.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.0    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010435743.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.0    2e-08   Camelina sativa [gold-of-pleasure]
sp|P04715.1|RBS2_PETHY  RecName: Full=Ribulose bisphosphate carbo...  57.0    2e-08   Petunia x hybrida [garden petunia]
emb|CAL07985.1|  ribulose-bisphosphate carboxylase                    55.8    2e-08   Platanus x hispanica [London plane tree]
gb|AAW31667.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  57.0    2e-08   Ammopiptanthus mongolicus
emb|CAD21856.1|  putative ribulose 1,5 biphosphate carboxylase sm...  57.0    2e-08   Rumex obtusifolius
gb|AAA34191.1|  ribulose-1,5-bisphosphate carboxylase, small subu...  57.0    2e-08   Solanum lycopersicum
ref|XP_006285820.1|  hypothetical protein CARUB_v10007296mg           57.0    2e-08   Capsella rubella
ref|XP_006285696.1|  hypothetical protein CARUB_v10007166mg           57.0    2e-08   Capsella rubella
ref|XP_004233493.1|  PREDICTED: ribulose bisphosphate carboxylase...  57.0    2e-08   
sp|P04714.1|RBS1_PETHY  RecName: Full=Ribulose bisphosphate carbo...  56.6    2e-08   Petunia x hybrida [garden petunia]
ref|XP_006284616.1|  hypothetical protein CARUB_v10005847mg           56.6    2e-08   Capsella rubella
sp|Q08186.1|RBS6_MESCR  RecName: Full=Ribulose bisphosphate carbo...  56.6    2e-08   Mesembryanthemum crystallinum
ref|XP_010440948.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.6    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010440945.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.6    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004962301.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.6    2e-08   Setaria italica
ref|XP_010511625.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.6    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004962610.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.6    2e-08   Setaria italica
emb|CAA31948.1|  ribulose bisphosphate carboxylase                    56.6    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAK16228.1|AF044396_1  ribulose-1,5-bisphosphate carboxylase s...  56.2    2e-08   Flaveria ramosissima
gb|AAA33036.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...  56.6    2e-08   Mesembryanthemum crystallinum
sp|P16032.2|RBS1_MESCR  RecName: Full=Ribulose bisphosphate carbo...  56.6    2e-08   Mesembryanthemum crystallinum
ref|XP_010263795.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.6    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010032637.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.6    2e-08   Eucalyptus grandis [rose gum]
gb|KCW52065.1|  hypothetical protein EUGRSUZ_J01502                   56.2    2e-08   Eucalyptus grandis [rose gum]
ref|XP_010265138.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.2    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_008807113.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.2    2e-08   Phoenix dactylifera
ref|XP_002888576.1|  ribulose bisphosphate carboxylase small chai...  56.2    2e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_008797838.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.2    3e-08   Phoenix dactylifera
gb|ACO35888.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  56.2    3e-08   Ageratina adenophora
sp|Q08183.1|RBS3_MESCR  RecName: Full=Ribulose bisphosphate carbo...  56.2    3e-08   Mesembryanthemum crystallinum
gb|AFS41727.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  56.2    3e-08   Gossypium hirsutum [American cotton]
gb|AAA33037.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...  56.2    3e-08   Mesembryanthemum crystallinum
dbj|BAI53118.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  56.2    3e-08   Eucalyptus globulus [blue gum]
ref|XP_010263805.1|  PREDICTED: ribulose bisphosphate carboxylase...  56.2    3e-08   Nelumbo nucifera [Indian lotus]
ref|NP_001275244.1|  ribulose bisphosphate carboxylase small chai...  55.8    3e-08   Solanum tuberosum [potatoes]
gb|AFS41729.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  55.8    3e-08   Gossypium hirsutum [American cotton]
sp|O65349.1|RBS_CAPAN  RecName: Full=Ribulose bisphosphate carbox...  55.8    4e-08   Capsicum annuum
sp|Q08185.1|RBS5_MESCR  RecName: Full=Ribulose bisphosphate carbo...  55.8    4e-08   Mesembryanthemum crystallinum
ref|WP_026003795.1|  hypothetical protein                             55.5    4e-08   
ref|XP_009380302.1|  PREDICTED: ribulose bisphosphate carboxylase...  55.8    4e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA37517.1|  NySS42 protein                                       53.9    4e-08   Nicotiana sylvestris
sp|Q08184.1|RBS4_MESCR  RecName: Full=Ribulose bisphosphate carbo...  55.8    4e-08   Mesembryanthemum crystallinum
gb|AAR83879.1|  Cristal-Glass1 protein                                55.5    5e-08   Capsicum annuum
emb|CDY67657.1|  BnaCnng55860D                                        55.5    5e-08   Brassica napus [oilseed rape]
ref|XP_002868775.1|  ribulose bisphosphate carboxylase small chai...  55.5    5e-08   
sp|Q04450.1|RBS2_MESCR  RecName: Full=Ribulose bisphosphate carbo...  55.5    5e-08   Mesembryanthemum crystallinum
ref|XP_010926041.1|  PREDICTED: ribulose bisphosphate carboxylase...  55.5    5e-08   Elaeis guineensis
ref|XP_010450913.1|  PREDICTED: ribulose bisphosphate carboxylase...  55.5    5e-08   Camelina sativa [gold-of-pleasure]
gb|AHI85721.1|  stress-induced protein 16                             55.5    5e-08   Capsicum annuum
dbj|BAE46384.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  55.5    5e-08   Panax ginseng [Asiatic ginseng]
sp|P31333.2|RBS_GOSHI  RecName: Full=Ribulose bisphosphate carbox...  55.5    5e-08   Gossypium hirsutum [American cotton]
ref|XP_010450912.1|  PREDICTED: ribulose bisphosphate carboxylase...  55.5    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010450911.1|  PREDICTED: ribulose bisphosphate carboxylase...  55.5    5e-08   Camelina sativa [gold-of-pleasure]
sp|P19311.1|RBS5_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  55.5    6e-08   Lemna gibba
ref|XP_002868776.1|  ribulose bisphosphate carboxylase                55.5    6e-08   Arabidopsis lyrata subsp. lyrata
gb|AIF75283.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  55.5    6e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ABA46900.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  55.5    6e-08   Musa acuminata AAA Group [Cavendish banana]
gb|AIF75342.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  55.5    6e-08   Brassica oleracea
gb|AGT97045.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...  55.5    6e-08   Capsicum annuum
ref|XP_004299075.1|  PREDICTED: ribulose bisphosphate carboxylase...  55.5    6e-08   Fragaria vesca subsp. vesca
gb|AAK16229.1|AF044397_1  ribulose-1,5-bisphosphate carboxylase s...  55.1    6e-08   Flaveria ramosissima
gb|AIF75344.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  55.5    6e-08   Brassica oleracea
gb|AAB81105.1|  ribulose 1,5-bisphosphate carboxylase small subunit   55.5    6e-08   Spinacia oleracea
sp|Q43832.1|RBS2_SPIOL  RecName: Full=Ribulose bisphosphate carbo...  55.1    6e-08   Spinacia oleracea
sp|P19312.1|RBS6_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  55.1    7e-08   Lemna gibba
sp|P19308.1|RBS2_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  55.1    7e-08   Lemna gibba
gb|AAK16227.1|AF044395_1  ribulose-1,5-bisphosphate carboxylase s...  55.1    7e-08   Flaveria ramosissima
ref|XP_006405770.1|  hypothetical protein EUTSA_v10027955mg           55.1    7e-08   Eutrema salsugineum [saltwater cress]
ref|XP_006391472.1|  hypothetical protein EUTSA_v10019202mg           55.1    7e-08   Eutrema salsugineum [saltwater cress]
gb|AEJ33935.1|  chloroplast putative ribulose-1,5-bisphosphate ca...  55.1    7e-08   Wolffia australiana
ref|XP_009595081.1|  PREDICTED: ribulose bisphosphate carboxylase...  55.1    7e-08   Nicotiana tomentosiformis
gb|AFI60243.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  54.7    8e-08   Panicum virgatum
ref|XP_008381263.1|  PREDICTED: ribulose bisphosphate carboxylase...  55.1    8e-08   
gb|ABA46901.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  54.7    9e-08   Musa acuminata AAA Group [Cavendish banana]
gb|ABS72189.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  54.7    9e-08   Corchorus olitorius [Nalta jute]
gb|AAK49590.1|AF372874_1  F1O19.10/F1O19.10                           54.3    9e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693054.1|  PREDICTED: ribulose bisphosphate carboxylase...  54.7    9e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009357812.1|  PREDICTED: ribulose bisphosphate carboxylase...  54.7    1e-07   Pyrus x bretschneideri [bai li]
gb|AAL82195.1|AF396697_1  s/s2                                        54.3    1e-07   Nicotiana benthamiana
sp|Q39743.1|RBS1_FLAPR  RecName: Full=Ribulose bisphosphate carbo...  54.7    1e-07   Flaveria pringlei
sp|P08135.1|RBS_RAPSA  RecName: Full=Ribulose bisphosphate carbox...  54.7    1e-07   Raphanus sativus
ref|XP_009140170.1|  PREDICTED: ribulose bisphosphate carboxylase...  54.7    1e-07   Brassica rapa
gb|ABQ42552.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  54.7    1e-07   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006302885.1|  hypothetical protein CARUB_v10021016mg           54.7    1e-07   Capsella rubella
gb|KHN07520.1|  Ribulose bisphosphate carboxylase small chain 4, ...  54.3    1e-07   Glycine soja [wild soybean]
ref|XP_009390221.1|  PREDICTED: ribulose bisphosphate carboxylase...  54.3    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAA33035.1|  ribulose-1-5-bisphosphate carboxylase                 54.3    1e-07   Mesembryanthemum crystallinum
ref|XP_006663954.1|  PREDICTED: ribulose bisphosphate carboxylase...  54.3    1e-07   Oryza brachyantha
ref|XP_002531624.1|  Ribulose bisphosphate carboxylase small chai...  54.3    1e-07   Ricinus communis
sp|Q02980.1|RBS_MALSP  RecName: Full=Ribulose bisphosphate carbox...  54.3    1e-07   Malus sp.
ref|XP_009342656.1|  PREDICTED: ribulose bisphosphate carboxylase...  54.3    1e-07   Pyrus x bretschneideri [bai li]
sp|O24045.1|RBS_MUSAC  RecName: Full=Ribulose bisphosphate carbox...  54.3    1e-07   Musa acuminata [banana]
pdb|4RUB|S  Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate ...  53.9    1e-07   Nicotiana tabacum [American tobacco]
gb|AIF75321.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  54.3    1e-07   Brassica rapa
gb|AIF75296.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  54.3    1e-07   Arabidopsis arenosa
sp|P13951.1|RBS_SINAL  RecName: Full=Ribulose bisphosphate carbox...  53.5    1e-07   Sinapis alba [bai jie]
gb|AAA33717.1|  ribulose 1,5-bisphosphate carboxylase                 53.1    1e-07   Petunia x hybrida [garden petunia]
sp|P24007.1|RBS_PYRPY  RecName: Full=Ribulose bisphosphate carbox...  54.3    1e-07   Pyrus pyrifolia [sha li]
sp|P19310.1|RBS4_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  54.3    1e-07   Lemna gibba
ref|XP_008446602.1|  PREDICTED: ribulose bisphosphate carboxylase...  54.3    1e-07   Cucumis melo [Oriental melon]
ref|XP_009618419.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.1    1e-07   
ref|XP_010044264.1|  PREDICTED: ribulose bisphosphate carboxylase...  54.3    2e-07   Eucalyptus grandis [rose gum]
gb|AAP31053.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  53.9    2e-07   Flaveria bidentis
gb|AAP31054.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  53.9    2e-07   Flaveria bidentis
sp|P07089.1|RBS_FLATR  RecName: Full=Ribulose bisphosphate carbox...  53.9    2e-07   Flaveria trinervia
sp|P00872.2|RBS1_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  53.9    2e-07   Lemna gibba
ref|XP_008368660.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.9    2e-07   Malus domestica [apple tree]
gb|AAA33866.1|  ribulose 1,5-bisphosphate carboxylase small subunit   53.9    2e-07   Malus domestica x Pyrus communis
prf||0902172A  carboxylase/oxygenase,RBP                              53.5    2e-07   Nicotiana tabacum [American tobacco]
ref|XP_006663961.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.9    2e-07   Oryza brachyantha
ref|XP_004303137.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.9    2e-07   Fragaria vesca subsp. vesca
gb|ABA46899.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  53.9    2e-07   Musa acuminata AAA Group [Cavendish banana]
gb|AIF75291.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  53.9    2e-07   Arabidopsis arenosa
sp|Q96542.1|RBS_BETPN  RecName: Full=Ribulose bisphosphate carbox...  53.9    2e-07   Betula pendula [white birch]
emb|CAA24969.1|  unnamed protein product                              53.5    2e-07   Lemna gibba
sp|P19309.1|RBS3_LEMGI  RecName: Full=Ribulose bisphosphate carbo...  53.9    2e-07   Lemna gibba
gb|AIF75294.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  53.5    2e-07   Arabidopsis suecica
ref|WP_037767734.1|  hypothetical protein                             53.5    2e-07   
gb|AAK16232.1|AF044400_1  ribulose-1,5-bisphosphate carboxylase s...  53.5    2e-07   Flaveria palmeri
gb|AAK16231.1|AF044399_1  ribulose-1,5-bisphosphate carboxylase s...  53.5    2e-07   Flaveria palmeri
emb|CAA53083.1|  ribulose-1,5-bisphosphate carboxylase /oxygenase...  53.5    2e-07   Brassica napus [oilseed rape]
gb|AFK36660.1|  unknown                                               53.5    2e-07   Lotus japonicus
ref|XP_009127523.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.5    2e-07   Brassica rapa
emb|CDY52468.1|  BnaA04g27920D                                        53.5    2e-07   Brassica napus [oilseed rape]
emb|CDY12616.1|  BnaA02g12840D                                        53.5    2e-07   Brassica napus [oilseed rape]
gb|AFO67218.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...  53.5    3e-07   Aralia elata
ref|XP_006664952.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.5    3e-07   Oryza brachyantha
gb|AFS41765.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  53.5    3e-07   Gossypium armourianum
ref|XP_006663955.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.5    3e-07   Oryza brachyantha
gb|AIF75322.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  53.5    3e-07   Brassica napus [oilseed rape]
sp|Q41351.1|RBS_STELP  RecName: Full=Ribulose bisphosphate carbox...  53.5    3e-07   Stellaria longipes
gb|AFS41770.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  53.5    3e-07   Gossypium gossypioides
gb|AIF75311.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  53.5    3e-07   Brassica rapa
ref|XP_010693073.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.5    3e-07   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX99682.1|  BnaC04g34390D                                        53.5    3e-07   
emb|CDX67402.1|  BnaA07g14420D                                        53.5    3e-07   
ref|XP_010693099.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.5    3e-07   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK33868.1|  unknown                                               53.5    3e-07   Lotus japonicus
ref|XP_004135094.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.5    3e-07   Cucumis sativus [cucumbers]
sp|Q9XGX5.1|RBS2_AMAHP  RecName: Full=Ribulose bisphosphate carbo...  53.5    3e-07   Amaranthus hypochondriacus [prince's feather]
ref|XP_009127518.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.5    3e-07   Brassica rapa
ref|XP_009127519.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.5    3e-07   Brassica rapa
ref|XP_010669829.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.5    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010103758.1|  hypothetical protein L484_014647                 53.5    3e-07   Morus notabilis
ref|XP_010693059.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.5    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003581511.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.1    3e-07   Brachypodium distachyon [annual false brome]
pdb|1IR1|S  Chain S, Crystal Structure Of Spinach Ribulose-1,5-Bi...  53.1    3e-07   Spinacia oleracea
gb|AIF75323.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  53.1    3e-07   Brassica napus [oilseed rape]
emb|CCF55356.1|  ribulose-1,5-bisphosphate carboxylase small subunit  53.5    3e-07   Cucumis sativus [cucumbers]
ref|XP_009125072.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.1    3e-07   Brassica rapa
emb|CAA30290.1|  rubisco ssu precursor                                53.1    3e-07   Brassica napus [oilseed rape]
gb|AIF75340.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  53.1    3e-07   Brassica oleracea
ref|XP_009139778.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.1    3e-07   Brassica rapa
sp|P05346.2|RBS1_BRANA  RecName: Full=Ribulose bisphosphate carbo...  53.1    3e-07   Brassica napus [oilseed rape]
ref|XP_003555148.2|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...  53.1    3e-07   
gb|ACQ90230.1|  virus-resistance protein                              54.3    3e-07   Brassica rapa subsp. chinensis [bok-choy]
emb|CDY42338.1|  BnaC02g17150D                                        53.1    3e-07   Brassica napus [oilseed rape]
sp|P08474.1|RBS_CUCSA  RecName: Full=Ribulose bisphosphate carbox...  53.1    3e-07   Cucumis sativus [cucumbers]
gb|AIF75324.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  53.1    3e-07   Brassica rapa
gb|ABK15574.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  53.1    3e-07   Camellia sinensis [black tea]
sp|O22077.1|RBS_FAGCR  RecName: Full=Ribulose bisphosphate carbox...  53.1    3e-07   Fagus crenata
ref|XP_002521232.1|  Ribulose bisphosphate carboxylase small chai...  53.1    3e-07   Ricinus communis
gb|AIF75332.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  53.1    4e-07   Brassica oleracea
gb|ABB51649.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  53.1    4e-07   Brassica napus [oilseed rape]
gb|AIF75317.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  53.1    4e-07   Brassica rapa
dbj|BAJ08160.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase      53.1    4e-07   Brassica rapa subsp. chinensis [bok-choy]
emb|CDY12612.1|  BnaA02g12800D                                        52.8    4e-07   Brassica napus [oilseed rape]
ref|XP_003577109.1|  PREDICTED: ribulose bisphosphate carboxylase...  53.1    4e-07   Brachypodium distachyon [annual false brome]
gb|ABL97962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  53.1    4e-07   Brassica rapa
emb|CDY42341.1|  BnaC02g17180D                                        53.1    4e-07   Brassica napus [oilseed rape]
gb|AIF75313.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  52.8    4e-07   Brassica rapa
emb|CDY01665.1|  BnaC04g30870D                                        52.8    4e-07   
pdb|3AXK|S  Chain S, Structure Of Rice Rubisco In Complex With Na...  52.8    4e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AIF75337.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  52.8    4e-07   Brassica oleracea
ref|XP_010528479.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...  53.1    4e-07   Tarenaya hassleriana [spider flower]
gb|AFS41772.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  52.8    4e-07   Gossypioides kirkii
ref|XP_003576920.1|  PREDICTED: ribulose bisphosphate carboxylase...  52.8    4e-07   Brachypodium distachyon [annual false brome]
sp|P18960.1|RBS_SILPR  RecName: Full=Ribulose bisphosphate carbox...  52.8    5e-07   
ref|WP_033581592.1|  ribulose 1,5-bisphosphate carboxylase small ...  51.6    5e-07   
gb|AHC28978.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  52.8    5e-07   Phragmites australis
ref|XP_007044343.1|  Ribulose bisphosphate carboxylase small chai...  52.4    5e-07   
ref|XP_003573910.1|  PREDICTED: ribulose bisphosphate carboxylase...  52.8    5e-07   Brachypodium distachyon [annual false brome]
ref|XP_009357814.1|  PREDICTED: ribulose bisphosphate carboxylase...  52.4    6e-07   
pdb|1AUS|S  Chain S, Activated Unliganded Spinach Rubisco             52.0    6e-07   Spinacia oleracea
ref|XP_007033269.1|  Ribulose bisphosphate carboxylase (small cha...  52.4    6e-07   
gb|ADT78691.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  52.4    7e-07   Litchi chinensis [litchi]
ref|XP_007033270.1|  Ribulose bisphosphate carboxylase (small cha...  52.4    7e-07   Theobroma cacao [chocolate]
gb|ABK25403.1|  unknown                                               52.4    8e-07   Picea sitchensis
emb|CBY05833.1|  Ribulose 1,5-bisphosphate carboxylase small subu...  52.4    8e-07   Coffea canephora [robusta coffee]
gb|AIF75330.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  52.0    8e-07   Brassica oleracea
gb|AFS41763.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  52.0    8e-07   Gossypium herbaceum [Arabian cotton]
gb|ACQ90229.1|  TuMV resistance protein-like protein                  52.0    8e-07   Brassica rapa subsp. chinensis [bok-choy]
sp|Q42823.1|RBS_GLYTA  RecName: Full=Ribulose bisphosphate carbox...  52.0    9e-07   Glycine tabacina
gb|AAK16230.1|AF044398_1  ribulose-1,5-bisphosphate carboxylase s...  51.6    9e-07   Flaveria palmeri
gb|AFS41766.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  52.0    9e-07   Gossypium armourianum
gb|AFS41771.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  52.0    9e-07   Gossypium gossypioides
dbj|BAA35179.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  52.0    9e-07   Bromus catharticus [cebadilla]
gb|ABL97974.1|  ribulose bisphosphate carboxylase                     51.6    1e-06   Brassica rapa
dbj|BAP19135.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.8    1e-06   Monotropastrum humile [qiu guo jia sha jing lan]
sp|Q42516.1|RBS1_AMAHP  RecName: Full=Ribulose bisphosphate carbo...  52.0    1e-06   Amaranthus hypochondriacus [prince's feather]
dbj|BAB19810.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  51.6    1e-06   Triticum aestivum [Canadian hard winter wheat]
gb|AAF17589.1|AF202645_1  ribulose-1,5-bisphosphate carboxylase s...  51.6    1e-06   Avena clauda
gb|AAC83372.1|  ribulose-1,5-bisphosphate carboxylase small subunit   51.6    1e-06   Avena agadiriana
ref|WP_039311073.1|  hypothetical protein                             51.2    1e-06   Paenibacillus sp. IHB B 3415
emb|CAA10497.1|  hypothetical protein                                 51.6    1e-06   Secale cereale
gb|EMT06085.1|  hypothetical protein F775_43781                       51.6    1e-06   
sp|Q42822.1|RBS_GLYTO  RecName: Full=Ribulose bisphosphate carbox...  51.6    1e-06   
gb|AAF07946.1|AF192777_1  ribulose-1,5-bisphosphate carboxylase s...  51.2    1e-06   
gb|AAC83374.1|  ribulose-1,5-bisphosphate carboxylase small subunit   51.2    1e-06   
gb|AAF17590.1|AF202646_1  ribulose-1,5-bisphosphate carboxylase s...  51.2    1e-06   
gb|AAC67588.1|  ribulose-1,5-bisphosphate carboxylase small subunit   51.2    1e-06   
gb|ABN41481.1|  putative chloroplast ribulose-1,5-bisphosphate ca...  50.8    2e-06   
gb|AAU14862.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  51.2    2e-06   
ref|XP_007215051.1|  hypothetical protein PRUPE_ppa012123mg           51.2    2e-06   
gb|EMT25898.1|  Ribulose bisphosphate carboxylase small chain PWS...  51.2    2e-06   
ref|WP_039311749.1|  hypothetical protein                             50.8    2e-06   
gb|ABK96567.1|  unknown                                               51.2    2e-06   
sp|P12468.1|RBS4_SOYBN  RecName: Full=Ribulose bisphosphate carbo...  51.2    2e-06   
gb|AAF07949.1|AF192780_1  ribulose-1,5-bisphosphate carboxylase s...  51.2    2e-06   
gb|ACU13285.1|  unknown                                               51.2    2e-06   
ref|XP_009356790.1|  PREDICTED: ribulose bisphosphate carboxylase...  51.2    2e-06   
ref|XP_008244506.1|  PREDICTED: ribulose bisphosphate carboxylase...  51.2    2e-06   
ref|XP_002532149.1|  Ribulose bisphosphate carboxylase small chai...  51.2    2e-06   
gb|AGJ76629.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  51.2    2e-06   
gb|AEA48975.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  51.2    2e-06   
ref|NP_001235314.1|  uncharacterized protein LOC100500504             51.2    2e-06   
gb|AFS41762.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  50.8    2e-06   
gb|AIF75292.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  50.8    2e-06   
ref|NP_001241137.1|  ribulose bisphosphate carboxylase small chai...  50.8    2e-06   
ref|NP_001235266.1|  ribulose-1,5-bisphosphate carboxylase small ...  50.8    2e-06   
ref|WP_017428783.1|  hypothetical protein                             50.4    2e-06   
gb|AAG24884.1|AF303941_1  ribulose-1,5-bisphosphate carboxylase s...  50.8    2e-06   
dbj|BAK23964.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.8    2e-06   
sp|P00865.1|RBS1_SOYBN  RecName: Full=Ribulose bisphosphate carbo...  50.8    2e-06   
emb|CAA30393.1|  ribulose bisphosphate carboxylase                    50.8    2e-06   
dbj|BAJ89884.1|  predicted protein                                    50.8    2e-06   
gb|AAA82069.1|  ribulose 1,5-bisphosphate carboxylase small subun...  50.8    2e-06   
gb|EMS48023.1|  Ribulose bisphosphate carboxylase small chain, ch...  50.8    2e-06   
ref|XP_011021244.1|  PREDICTED: ribulose bisphosphate carboxylase...  50.8    2e-06   
gb|AGV08375.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  50.8    3e-06   
ref|NP_001066606.1|  Os12g0291400                                     50.4    3e-06   
dbj|BAJ86022.1|  predicted protein                                    50.4    3e-06   
dbj|BAJ90404.1|  predicted protein                                    50.4    3e-06   
emb|CDY42337.1|  BnaC02g17140D                                        50.8    3e-06   
emb|CAD11990.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.8    3e-06   
gb|ABR26089.1|  ribulose bisphosphate carboxylase small chain c       49.3    3e-06   
ref|XP_006383456.1|  Ribulose bisphosphate carboxylase small chai...  50.8    3e-06   
ref|NP_001066604.1|  Os12g0291100                                     50.4    3e-06   
gb|EPS63610.1|  ribulose bisphosphate carboxylase small chain         50.4    3e-06   
gb|ABR25937.1|  ribulose bisphosphate carboxylase small chain c       49.7    3e-06   
sp|O65194.1|RBS_MEDSA  RecName: Full=Ribulose bisphosphate carbox...  50.4    3e-06   
dbj|BAA35165.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.4    3e-06   
gb|AAF07947.1|AF192778_1  ribulose-1,5-bisphosphate carboxylase s...  50.4    3e-06   
gb|AAC78643.1|  ribulose-1,5-bisphosphate carboxylase small subunit   50.4    3e-06   
gb|AAF07945.1|AF192776_1  ribulose-1,5-bisphosphate carboxylase s...  50.4    3e-06   
dbj|BAK23963.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.4    3e-06   
gb|AAF07985.1|AF200303_1  ribulose-1,5-bisphosphate carboxylase s...  50.4    3e-06   
dbj|BAB19812.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.4    3e-06   
dbj|BAJ90202.1|  predicted protein                                    50.4    3e-06   
dbj|BAA35145.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.4    3e-06   
gb|AAA84592.1|  ribulose 1,5-bisphosphate carboxylase                 50.4    3e-06   
gb|AAF17591.1|AF202647_1  ribulose-1,5-bisphosphate carboxylase s...  50.4    3e-06   
ref|NP_001066559.1|  Os12g0274700                                     50.4    3e-06   
dbj|BAA35150.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.4    3e-06   
gb|AAF07942.1|AF192773_1  ribulose-1,5-bisphosphate carboxylase s...  50.4    3e-06   
gb|EAY97115.1|  hypothetical protein OsI_19041                        50.4    3e-06   
sp|Q9XGX4.1|RBS3_AMAHP  RecName: Full=Ribulose bisphosphate carbo...  50.4    3e-06   
dbj|BAA00539.1|  small subunit of ribulose-1,5-bisphosphate carbo...  50.4    3e-06   
dbj|BAA35167.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.4    3e-06   
dbj|BAA35158.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.4    3e-06   
gb|AIF75326.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  50.4    3e-06   
gb|ABR26002.1|  ribulose bisphosphate carboxylase small chain c       49.3    4e-06   
dbj|BAA35164.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.1    4e-06   
gb|AIF75328.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...  50.4    4e-06   
emb|CAH10356.1|  ribulose 1,5 bisphosphate carboxylase/oxygenase,...  50.1    4e-06   
ref|XP_002990955.1|  hypothetical protein SELMODRAFT_236158           50.1    4e-06   
sp|P07398.1|RBS3_WHEAT  RecName: Full=Ribulose bisphosphate carbo...  50.1    4e-06   
gb|AIB04188.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  50.4    4e-06   
dbj|BAK23962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.4    4e-06   
pdb|4MKV|S  Chain S, Structure Of Pisum Sativum Rubisco With Aba      50.1    4e-06   
ref|XP_002305162.2|  Ribulose bisphosphate carboxylase small chai...  50.4    4e-06   
dbj|BAA35175.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.1    4e-06   
gb|EYU44637.1|  hypothetical protein MIMGU_mgv1a0165712mg             49.7    4e-06   
gb|EMS67205.1|  Ribulose bisphosphate carboxylase small chain, ch...  50.1    4e-06   
gb|EMS44969.1|  Ribulose bisphosphate carboxylase small chain PW9...  50.1    4e-06   
emb|CCJ09777.1|  putative ribulose-1,5-bisphosphate carboxylase/o...  48.9    4e-06   
gb|EMT21846.1|  Ribulose bisphosphate carboxylase small chain PW9...  50.1    4e-06   
ref|XP_010036887.1|  PREDICTED: ribulose bisphosphate carboxylase...  50.1    4e-06   
gb|ABJ74187.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  49.7    4e-06   
gb|ABK95229.1|  unknown                                               50.1    4e-06   
dbj|BAB19811.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.1    4e-06   
dbj|BAP82418.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  50.1    4e-06   
gb|EMT21850.1|  Ribulose bisphosphate carboxylase small chain PW9...  50.1    4e-06   
gb|ABR25969.1|  ribulose bisphosphate carboxylase small chain c       49.7    5e-06   
sp|P00871.2|RBS1_WHEAT  RecName: Full=Ribulose bisphosphate carbo...  50.1    5e-06   
ref|NP_001066607.1|  Os12g0292400                                     50.1    5e-06   
ref|XP_006842277.1|  hypothetical protein AMTR_s00079p00061090        50.1    5e-06   
gb|ABR26086.1|  ribulose bisphosphate carboxylase small chain c       49.7    5e-06   
gb|AIB55758.1|  ribulose bisphosphate carboxylase small chain, pa...  49.7    5e-06   
emb|CDP20139.1|  unnamed protein product                              49.7    5e-06   
gb|EMT09369.1|  Ribulose bisphosphate carboxylase small chain PWS...  49.7    5e-06   
emb|CAA10496.1|  hypothetical protein                                 50.1    5e-06   
gb|EAY82834.1|  hypothetical protein OsI_38046                        50.1    5e-06   
dbj|BAA35162.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  49.7    5e-06   
gb|AIR75141.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  49.7    5e-06   
gb|AIR75140.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  49.7    5e-06   
sp|P26667.1|RBS2_WHEAT  RecName: Full=Ribulose bisphosphate carbo...  50.1    5e-06   
dbj|BAJ90550.1|  predicted protein                                    50.1    5e-06   
emb|CAA59218.1|  ribulose-bisphosphate carboxylase                    49.7    5e-06   
pdb|3AXM|S  Chain S, Structure Of Rice Rubisco In Complex With 6pg    49.7    5e-06   
pdb|1WDD|S  Chain S, Crystal Structure Of Activated Rice Rubisco ...  49.7    5e-06   
dbj|BAJ89663.1|  predicted protein                                    49.7    5e-06   
ref|WP_028130706.1|  hypothetical protein                             49.3    5e-06   
ref|XP_011035062.1|  PREDICTED: ribulose bisphosphate carboxylase...  50.1    6e-06   
gb|EMT21848.1|  Ribulose bisphosphate carboxylase small chain PW9...  49.7    6e-06   
sp|Q40004.1|RBS_HORVU  RecName: Full=Ribulose bisphosphate carbox...  49.7    6e-06   
gb|AAL15646.1|AF411547_1  ribulose-1,5-bisphosphate carboxylase s...  48.9    7e-06   
pir||A05117  ribulose-bisphosphate carboxylase (EC 4.1.1.39) smal...  48.1    7e-06   
dbj|BAB19813.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  49.7    7e-06   
gb|AAA33716.1|  ribulose 1,5-bisphosphate carboxylase                 48.9    7e-06   
gb|EMS47672.1|  Ribulose bisphosphate carboxylase small chain PWS...  49.7    7e-06   
dbj|BAA35169.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  49.3    7e-06   
dbj|BAI53119.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  49.7    7e-06   
dbj|BAA35153.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  49.3    8e-06   
emb|CAH10355.1|  ribulose 1,5 bisphosphate carboxylase/oxygenase,...  49.3    8e-06   
dbj|BAA35156.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  49.3    8e-06   
dbj|BAA35170.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  49.3    9e-06   
dbj|BAA35161.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  49.3    9e-06   
gb|EMS44967.1|  Ribulose bisphosphate carboxylase small chain PW9...  48.9    9e-06   
sp|O22645.1|RBS5_FRIAG  RecName: Full=Ribulose bisphosphate carbo...  49.3    9e-06   
pir||A05005  ribulose-bisphosphate carboxylase (EC 4.1.1.39) smal...  48.9    9e-06   
ref|XP_008339672.1|  PREDICTED: ribulose bisphosphate carboxylase...  49.3    1e-05   
gb|EMS44968.1|  Ribulose bisphosphate carboxylase small chain PW9...  48.9    1e-05   
emb|CAG25595.1|  putative rubisco small subunit                       48.9    1e-05   
dbj|BAB19814.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  48.9    1e-05   
dbj|BAA35178.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  48.9    1e-05   
dbj|BAA35151.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  48.9    1e-05   
gb|EMS44970.1|  Ribulose bisphosphate carboxylase small chain PWS...  48.9    1e-05   
emb|CAA10290.1|  ribulose 1,5-bisphosphate carboxylase small subunit  48.9    1e-05   
gb|EMT21849.1|  Ribulose bisphosphate carboxylase small chain PW9...  48.5    1e-05   
dbj|BAA35172.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  48.9    1e-05   
dbj|BAA35173.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  48.9    1e-05   
ref|XP_010521010.1|  PREDICTED: ribulose bisphosphate carboxylase...  48.9    1e-05   
gb|EMT21847.1|  Ribulose bisphosphate carboxylase small chain PW9...  48.9    1e-05   
ref|XP_008352922.1|  PREDICTED: ribulose bisphosphate carboxylase...  48.9    1e-05   
sp|O22573.1|RBS3_FRIAG  RecName: Full=Ribulose bisphosphate carbo...  48.9    1e-05   
sp|O22572.1|RBS2_FRIAG  RecName: Full=Ribulose bisphosphate carbo...  48.9    1e-05   
gb|ABC86738.1|  ribulose-1,5-bisphophate carboxylase/oxygenase sm...  48.9    1e-05   
dbj|BAA35176.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  48.5    1e-05   
sp|O24634.1|RBS1_FRIAG  RecName: Full=Ribulose bisphosphate carbo...  48.9    1e-05   
emb|CBN72500.1|  putative ribulose-bisphosphate carboxylase/oxyge...  47.8    1e-05   
gb|ABR26049.1|  ribulose bisphosphate carboxylase small chain c       47.4    1e-05   
gb|AFK48034.1|  unknown                                               48.9    1e-05   
gb|ABC17790.1|  plastid ribulose-1,5-bisphosphate carboxylase/oxy...  48.1    1e-05   
ref|XP_002982855.1|  hypothetical protein SELMODRAFT_17395            48.1    1e-05   
sp|O48550.1|RBS_ZANAE  RecName: Full=Ribulose bisphosphate carbox...  48.5    1e-05   
gb|ABR17099.1|  unknown                                               48.1    2e-05   
pdb|4HHH|S  Chain S, Structure Of Pisum Sativum Rubisco               48.1    2e-05   
gb|ABR45725.1|  RBCS1                                                 48.5    2e-05   
ref|XP_003600302.1|  Ribulose bisphosphate carboxylase small chai...  48.5    2e-05   
gb|KEH21538.1|  ribulose bisphosphate carboxylase small chain         48.5    2e-05   
ref|XP_003637843.1|  Ribulose bisphosphate carboxylase small chai...  48.5    2e-05   
ref|XP_003636970.1|  Ribulose bisphosphate carboxylase small chai...  48.5    2e-05   
gb|ABK96431.1|  unknown                                               48.5    2e-05   
sp|P16031.1|RBS_LARLA  RecName: Full=Ribulose bisphosphate carbox...  48.5    2e-05   
emb|CAA38347.1|  ribulose bisphosphate carboxylase                    47.4    2e-05   
sp|Q40250.1|RBS_LACSA  RecName: Full=Ribulose bisphosphate carbox...  48.1    2e-05   
emb|CAA38346.1|  ribulose bisphosphate carboxylase                    48.1    2e-05   
ref|XP_002276967.1|  PREDICTED: ribulose bisphosphate carboxylase...  48.1    2e-05   
ref|XP_008243231.1|  PREDICTED: ribulose bisphosphate carboxylase...  48.1    2e-05   
sp|P10053.1|RBS_PINTH  RecName: Full=Ribulose bisphosphate carbox...  48.1    2e-05   
ref|XP_007225932.1|  hypothetical protein PRUPE_ppa012174mg           48.1    2e-05   
sp|P17673.1|RBS_TRIRP  RecName: Full=Ribulose bisphosphate carbox...  48.1    2e-05   
gb|ABR17527.1|  unknown                                               47.8    3e-05   
ref|XP_003618735.1|  Ribulose bisphosphate carboxylase small chain    48.1    3e-05   
ref|XP_003618736.1|  Ribulose bisphosphate carboxylase small chain    48.1    3e-05   
gb|AFK40375.1|  unknown                                               48.1    3e-05   
gb|AAD27881.1|AF139469_1  ribulose-1,5-bisphosphate carboxylase s...  48.1    3e-05   
gb|AFK42721.1|  unknown                                               48.1    3e-05   
emb|CAA38345.1|  ribulose bisphosphate carboxylase                    47.0    3e-05   
gb|KDP29409.1|  hypothetical protein JCGZ_18330                       47.4    3e-05   
pir||A05118  ribulose-bisphosphate carboxylase (EC 4.1.1.39) smal...  47.0    3e-05   
emb|CAA37905.1|  ribulose bisphosphate carboxylase                    47.0    3e-05   
emb|CBI15452.3|  unnamed protein product                              47.4    4e-05   
gb|AIR75139.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  47.4    4e-05   
dbj|BAA35148.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  47.4    4e-05   
gb|AIR75136.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  47.4    4e-05   
gb|AIL82451.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  47.4    4e-05   
ref|XP_010551266.1|  PREDICTED: ribulose bisphosphate carboxylase...  47.8    4e-05   
gb|ABK21347.1|  unknown                                               47.8    4e-05   
gb|ACN39871.1|  unknown                                               47.0    4e-05   
gb|AAF06100.1|  ribulose 1,5-bisphosphate carboxylase small chain...  47.4    5e-05   
sp|P00869.1|RBS2_PEA  RecName: Full=Ribulose bisphosphate carboxy...  47.4    5e-05   
ref|XP_006485852.1|  PREDICTED: ribulose bisphosphate carboxylase...  48.5    5e-05   
gb|AAF06098.1|  ribulose 1,5-bisphosphate carboxylase small chain...  47.4    5e-05   
sp|P07689.1|RBS3_PEA  RecName: Full=Ribulose bisphosphate carboxy...  47.4    5e-05   
dbj|BAA35147.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...  47.0    5e-05   
gb|ACN40281.1|  unknown                                               47.4    5e-05   
gb|AAC14064.1|  ribulose 1,5-bisphosphate carboxylase small subunit   47.4    5e-05   
gb|ABK21690.1|  unknown                                               47.4    5e-05   
gb|AEB00556.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  47.4    6e-05   
gb|ABK21259.1|  unknown                                               47.4    6e-05   
gb|ABR26015.1|  ribulose bisphosphate carboxylase small chain c       45.8    6e-05   
gb|ABK26083.1|  unknown                                               46.6    7e-05   
gb|AAF07943.1|AF192774_1  ribulose-1,5-bisphosphate carboxylase s...  46.6    7e-05   
gb|ACN40080.1|  unknown                                               47.0    7e-05   
gb|ACN39774.1|  unknown                                               46.2    7e-05   
emb|CAC84492.1|  putative ribulose bisphosphate carboxylase small...  46.2    8e-05   
gb|ACJ85905.1|  unknown                                               46.6    8e-05   
gb|KEH21536.1|  ribulose bisphosphate carboxylase small chain         46.6    8e-05   
gb|AIR75138.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  46.6    9e-05   
gb|ACN40169.1|  unknown                                               47.0    9e-05   
gb|AAC83373.1|  ribulose-1,5-bisphosphate carboxylase small subunit   46.6    9e-05   
gb|KEH21539.1|  ribulose bisphosphate carboxylase small chain         46.6    9e-05   
gb|KEH21531.1|  ribulose bisphosphate carboxylase small chain         46.6    9e-05   
gb|ABK21852.1|  unknown                                               46.6    1e-04   
gb|AFO59569.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  46.2    1e-04   
gb|ABK21876.1|  unknown                                               46.6    1e-04   
gb|ABK22359.1|  unknown                                               46.6    1e-04   
gb|ABK21447.1|  unknown                                               46.6    1e-04   
gb|KDP20120.1|  hypothetical protein JCGZ_05889                       46.6    1e-04   
gb|ADB85091.1|  ribulose 1,5-bisphosphate carboxylase small subunit   46.6    1e-04   
gb|AIR75142.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...  46.2    1e-04   
ref|XP_011099669.1|  PREDICTED: ribulose bisphosphate carboxylase...  46.2    1e-04   
ref|XP_001782729.1|  predicted protein                                46.2    1e-04   
gb|AAA33685.2|  ribulose 1,5 bisphosphate carboxylase                 45.8    1e-04   
ref|XP_007036525.1|  Ribulose bisphosphate carboxylase (small cha...  46.2    1e-04   



>gb|ABY21254.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++ECKK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>gb|ABY21253.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++ECKK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>emb|CAH59401.1| Rubisco SSU [Plantago major]
Length=177

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AELEECKK YP  WVRI G DN  QVQCI FIA  P
Sbjct  137  VIAELEECKKEYPNAWVRIIGFDNVRQVQCISFIAAKP  174



>sp|P26574.1|RBS1_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49413.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++ECKK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>gb|ABY21255.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score = 60.8 bits (146),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++ECKK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>emb|CAH59404.1| Rubisco SSU [Plantago major]
Length=174

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AELEECKK YP  WVRI G DN  QVQCI FIA  P
Sbjct  134  VIAELEECKKEYPNAWVRIIGFDNVRQVQCISFIASKP  171



>sp|P08705.1|RBS_HELAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Helianthus annuus]
 emb|CAA68490.1| ribulose bisphosphate carboxylase [Helianthus annuus]
 emb|CAA28737.1| RuBisCO (SSU) [Helianthus annuus]
Length=178

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL ECKK YP  W+RI G DN  QVQCIMFIA  PD
Sbjct  138  VMKELAECKKEYPQAWIRIIGFDNVRQVQCIMFIASRPD  176



>gb|AAO25119.1| ribulose-1,5-bisphosphate carboxylase small subunit [Chrysanthemum 
x morifolium]
Length=179

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL ECKK YP  WVRI G DN  QVQCI FIA+ PD
Sbjct  139  VLKELNECKKEYPQSWVRIIGFDNVRQVQCISFIAHKPD  177



>ref|XP_004962611.1| PREDICTED: ribulose bisphosphate carboxylase small chain A, chloroplastic-like 
[Setaria italica]
Length=173

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V AELEECKK YP  ++RI G DN  QVQCIMFIAY P
Sbjct  126  VYAELEECKKAYPDAYIRILGFDNVRQVQCIMFIAYKP  163



>ref|NP_198659.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
 sp|P10796.1|RBS1B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic; Short=RuBisCO small subunit 1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95269.1|AF410283_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 emb|CAA32700.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
 dbj|BAB09355.1| ribulose bisphosphate carboxylase small chain 1b precursor (RuBisCO 
small subunit 1b) [Arabidopsis thaliana]
 gb|AAN28753.1| At5g38430/F1O19.10 [Arabidopsis thaliana]
 gb|AED94315.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
Length=181

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|NP_198658.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
 sp|P10797.2|RBS2B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09354.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL24421.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32515.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32536.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32621.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAM13287.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAN72105.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO00914.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO29974.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AED94314.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
Length=181

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>emb|CAA32701.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>sp|P26573.1|RBS8_NICPL RecName: Full=Ribulose bisphosphate carboxylase small chain 8B, 
chloroplastic; Short=RuBisCO small subunit 8B; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA31994.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
 gb|AAA34110.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
Length=180

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  WVRI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVEEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>ref|NP_001119331.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 gb|AED94313.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=186

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  143  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  180



>emb|CAA32702.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|NP_198657.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 sp|P10798.2|RBS3B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK25834.1|AF360124_1 putative ribulose bisphosphate carboxylase small chain 3b precursor 
[Arabidopsis thaliana]
 gb|AAK95300.1|AF410314_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAL58912.1|AF462822_1 At5g38410/F1O19.10 [Arabidopsis thaliana]
 dbj|BAB09353.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAK93702.1| putative RuBisCO small 3b subunit precursor [Arabidopsis thaliana]
 gb|AAK96743.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAL47390.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAM19980.1| At5g38410/F1O19.10 [Arabidopsis thaliana]
 gb|AAN31863.1| putative ribulose bisphosphate carboxylase small chain 3b precursor 
(RuBisCO small subunit 3b) [Arabidopsis thaliana]
 gb|AED94311.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=181

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AFW90575.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Solanum tuberosum]
Length=181

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++ECK  YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVQECKNAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|NP_001031981.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 gb|AED94312.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=174

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  131  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  168



>ref|XP_006358055.1| PREDICTED: ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Solanum tuberosum]
Length=181

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++ECK  YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVQECKNAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_006363111.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 ref|XP_006363112.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 sp|P26577.1|RBSC_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic; Short=RuBisCO small subunit 2C; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49416.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|KJB10450.1| hypothetical protein B456_001G201800 [Gossypium raimondii]
Length=181

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P+
Sbjct  141  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE  179



>sp|Q39746.1|RBS4_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67848.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL+ECKK YP  W+RI G DN  QVQCI FIA  PD
Sbjct  138  VMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  176



>gb|AEX60841.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41728.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41735.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41743.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41750.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41757.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=182

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P+
Sbjct  142  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE  180



>sp|P26576.1|RBSB_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49415.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>sp|P26575.1|RBSA_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49414.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AFS41724.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB10449.1| hypothetical protein B456_001G201800 [Gossypium raimondii]
Length=182

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P+
Sbjct  142  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE  180



>ref|XP_009758143.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana sylvestris]
 sp|P22433.1|RBS2_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain S41, 
chloroplastic; Short=RuBisCO small subunit S41; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA37516.1| NySS41 [Nicotiana sylvestris]
Length=181

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009795055.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009795056.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009772497.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 sp|P69249.1|RBS_TOBAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; AltName: Full=TSSU3-8; 
Flags: Precursor [Nicotiana tabacum]
 sp|P69250.1|RBS1_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA25862.1| unnamed protein product [Nicotiana sylvestris]
 emb|CAA26208.1| small subunit ribulose 1,5-bisphosphate carboxylase [Nicotiana 
tabacum]
 prf||1103193A carboxylase,RBP
Length=180

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_009800809.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>sp|P07180.1|RBS3A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3A/3C, 
chloroplastic; Short=RuBisCO small subunit 3A/3C; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA29402.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 emb|CAA29404.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 gb|AAA34190.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score = 58.5 bits (140),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++E KK YP  WVRI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_004232356.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic [Solanum lycopersicum]
 sp|P05349.1|RBS3B_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA29403.1| ribulose 1,5-bisphosphate carboxylase/oxyenase [Solanum lycopersicum]
 dbj|BAA01888.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score = 58.2 bits (139),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++E KK YP  WVRI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>ref|WP_033581579.1| ribulose 1,5-bisphosphate carboxylase small subunit, partial 
[Dickeya zeae]
Length=58

 Score = 56.6 bits (135),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  18   VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  56



>gb|AFS41753.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score = 58.2 bits (139),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AAA34192.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=180

 Score = 58.2 bits (139),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++E KK YP  WVRI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_004234568.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic [Solanum lycopersicum]
 sp|P07179.2|RBS2A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; AltName: Full=LESS 
5; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34189.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
(EC 4.1.1.39) [Solanum lycopersicum]
 emb|CAA29401.2| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=180

 Score = 58.2 bits (139),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++E KK YP  WVRI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>gb|ABS57004.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[synthetic construct]
Length=129

 Score = 57.8 bits (138),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL ECKK YP  W+RI G DN  QVQCIMFIA  PD
Sbjct  83   VMKELAECKKEYPQAWIRIIGFDNVRQVQCIMFIASRPD  121



>gb|AAA33718.1| ribulose 1,5-bisphosphate carboxylase, partial [Petunia x hybrida]
Length=46

 Score = 56.2 bits (134),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+E KK YP  W+RI G DN  QVQCI FIAY P
Sbjct  6    VLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKP  43



>gb|AFS41754.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AFS41733.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
Length=179

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLKELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AEX60839.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41738.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41746.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41758.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AEX60842.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41722.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41723.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41730.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41731.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41737.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41745.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41752.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41759.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG00063.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
 gb|KHG20485.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=179

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|KHG18747.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  142  VLEELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>gb|AFB70994.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Nicotiana attenuata]
Length=180

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AFS41748.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=179

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLKELEECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>ref|XP_010265357.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Nelumbo nucifera]
Length=118

 Score = 57.4 bits (137),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  78   VLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKP  115



>gb|AFS41744.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  142  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>gb|KJB43046.1| hypothetical protein B456_007G181300 [Gossypium raimondii]
Length=178

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  175



>gb|AFS41732.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41740.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41761.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AFS41725.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB43047.1| hypothetical protein B456_007G181300 [Gossypium raimondii]
 gb|KJB43048.1| hypothetical protein B456_007G181400 [Gossypium raimondii]
Length=179

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75285.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75286.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
 gb|AIF75287.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
Length=163

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  126  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>gb|AIF75289.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75290.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score = 57.4 bits (137),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  126  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>gb|AIF75288.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score = 57.4 bits (137),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  126  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>sp|P32764.1|RBS3_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49417.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score = 57.8 bits (138),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++E KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>gb|AEX60843.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41739.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41747.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41760.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score = 57.8 bits (138),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75295.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YPG ++RI G DN  QVQCI FIAY P
Sbjct  126  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>ref|XP_009403968.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=181

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V  ELEECKK YP  +VRI G DN  QVQCI FIA+ PD
Sbjct  141  VAKELEECKKEYPRAFVRIIGFDNNRQVQCISFIAHKPD  179



>ref|XP_009602965.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=179

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  139  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  177



>ref|XP_009774104.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009625434.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana tomentosiformis]
Length=181

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009767108.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>sp|Q39749.1|RBS7_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 7, 
chloroplastic; Short=RuBisCO small subunit 7; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67851.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL+ECKK YP  W+RI G DN  QVQCI FIA  PD
Sbjct  133  VMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>sp|Q39745.1|RBS3_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67847.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL+ECKK YP  W+RI G DN  QVQCI FIA  PD
Sbjct  133  VMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>gb|AAA34111.1| ribulose-1,5-bisphosphate carboxylase, partial [Nicotiana sylvestris]
 prf||0905192A carboxylase,RBP
Length=86

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  46   VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  84



>ref|XP_004962302.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Setaria italica]
Length=168

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V AE EECKK YP  ++RI G DN  QVQC+MFIAY P
Sbjct  127  VYAEFEECKKAYPDCYIRIIGFDNIKQVQCVMFIAYKP  164



>gb|AAG40356.1|AF325004_1 At1g67090 [Arabidopsis thaliana]
Length=180

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|NP_176880.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
 sp|P10795.2|RBS1A_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic; Short=RuBisCO small subunit 1A; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG40363.1|AF325011_1 000C10C11 [Arabidopsis thaliana]
 gb|AAK95277.1|AF410291_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAD10655.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAK96772.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL06849.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24219.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24422.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32690.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32789.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL38277.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13379.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13387.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM19882.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAN15681.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAN72087.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 dbj|BAE98610.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98685.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98695.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98874.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 gb|AEE34594.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
Length=180

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>sp|Q39748.1|RBS6_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67850.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL+ECKK YP  W+RI G DN  QVQCI FIA  PD
Sbjct  133  VMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>sp|Q39747.1|RBS5_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67849.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL+ECKK YP  W+RI G DN  QVQCI FIA  PD
Sbjct  133  VMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>ref|XP_010916368.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V  ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VAKELEECKKEYPDAFIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_006391132.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
 gb|ESQ28418.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
Length=182

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  142  VLKEVEECKKEYPNAFIRIIGFDNSRQVQCISFIAYKP  179



>pdb|3RUB|S Chain S, Crystal Structure Of The Unactivated Form Of Ribulose-1,5-Bisphosphate 
Carboxylase(Slash)oxygenase From Tobacco 
Refined At 2.0-Angstroms Resolution
 pdb|1RLC|S Chain S, Crystal Structure Of The Unactivated Ribulose 1, 5-Bisphosphate 
Carboxylase(Slash)oxygenase Complexed With A Transition 
State Analog, 2-Carboxy-D-Arabinitol 1,5-Bisphosphate
 pdb|1RLD|S Chain S, Solid-State Phase Transition In The Crystal Structure 
Of Ribulose 1,5- Biphosphate Carboxylase(Slash)oxygenase
 pdb|1RLD|T Chain T, Solid-State Phase Transition In The Crystal Structure 
Of Ribulose 1,5- Biphosphate Carboxylase(Slash)oxygenase
 pdb|1EJ7|S Chain S, Crystal Structure Of Unactivated Tobacco Rubisco With 
Bound Phosphate Ions
Length=123

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  83   VLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  121



>sp|Q39744.1|RBS2_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67846.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL+ECKK YP  W+RI G DN  QVQCI FIA  P+
Sbjct  138  VMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPE  176



>ref|XP_010435745.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_010435743.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010435744.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=181

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>sp|P04715.1|RBS2_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU11A, 
chloroplastic; Short=RuBisCO small subunit SSU11A; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS1 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu11A) precursor - garden petunia
 emb|CAA27445.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+E KK YP  W+RI G DN  QVQCI FIAY P
Sbjct  140  VLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKP  177



>emb|CAL07985.1| ribulose-bisphosphate carboxylase [Platanus x acerifolia]
Length=71

 Score = 55.8 bits (133),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  31   VLRELEECKKTYPNAFIRIIGFDNKRQVQCISFIAYKP  68



>gb|AAW31667.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ammopiptanthus mongolicus]
Length=174

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  +VRI G DN  QVQCI FIAY P
Sbjct  132  VMKELEECKKEYPTAFVRIIGFDNKRQVQCISFIAYKP  169



>emb|CAD21856.1| putative ribulose 1,5 biphosphate carboxylase small subunit percursor 
[Rumex obtusifolius]
Length=181

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VVAELEE KK YP  +VRI G DN  QVQC+ FIAY P
Sbjct  137  VVAELEEAKKAYPHAFVRIIGFDNVRQVQCVSFIAYKP  174



>gb|AAA34191.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=181

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++E KK YP  WVRI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_006285820.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
 gb|EOA18718.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
Length=181

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_006285696.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
 gb|EOA18594.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
Length=181

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_004233493.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Solanum lycopersicum]
 sp|P08706.2|RBS1_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; AltName: Full=LESS 
17; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34188.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
 emb|CAA29400.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=181

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++E KK YP  WVRI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  179



>sp|P04714.1|RBS1_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU8, 
chloroplastic; Short=RuBisCO small subunit SSU8; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS8 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu8) precursor - garden petunia
 emb|CAA27444.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+E KK YP  W+RI G DN  QVQCI FIAY P
Sbjct  140  VLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_006284616.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
 gb|EOA17514.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
Length=181

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>sp|Q08186.1|RBS6_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03698.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=186

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VVAELEE KK YP  ++RI G DN  QVQC+ FIAY P
Sbjct  144  VVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP  181



>ref|XP_010440948.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_010440945.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440946.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440947.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_004962301.1| PREDICTED: ribulose bisphosphate carboxylase small chain A, chloroplastic-like 
[Setaria italica]
Length=168

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V AELEECKK YP  ++R+ G DN  QVQC++FIAY P
Sbjct  127  VYAELEECKKAYPDCYIRVIGFDNLRQVQCVLFIAYKP  164



>ref|XP_010511625.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic [Camelina sativa]
 ref|XP_010415258.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic [Camelina sativa]
 ref|XP_010470602.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic isoform X1 [Camelina sativa]
Length=181

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPEAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_004962610.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Setaria italica]
 ref|XP_004962615.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Setaria italica]
Length=169

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V AE EECKK YP  ++RI G DN  QVQC+MFIAY P
Sbjct  128  VYAEFEECKKAYPDCYIRIIGFDNIKQVQCVMFIAYKP  165



>emb|CAA31948.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=182

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI F+AY P
Sbjct  140  VLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFVAYKP  177



>gb|AAK16228.1|AF044396_1 ribulose-1,5-bisphosphate carboxylase small subunit R2 [Flaveria 
ramosissima]
Length=131

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL+ECKK YP  W+RI G DN  QVQCI FIA  PD
Sbjct  91   VMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  129



>gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VVAELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  175



>sp|P16032.2|RBS1_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 prf||1802403A RuBisCO:SUBUNIT=small
Length=182

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VVAELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_010263795.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=184

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  144  VLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKP  181



>ref|XP_010032637.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Eucalyptus grandis]
Length=181

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  +VRI G DN  QVQCI FIA+ P
Sbjct  141  VLKELEECKKAYPTAFVRIIGFDNKRQVQCISFIAFKP  178



>gb|KCW52065.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=180

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  +VRI G DN  QVQCI FIA+ P
Sbjct  140  VLKELEECKKAYPTAFVRIIGFDNKRQVQCISFIAFKP  177



>ref|XP_010265138.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  142  VLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKP  179



>ref|XP_008807113.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Phoenix dactylifera]
Length=180

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V  ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VAKELEECKKEYPDAFIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_002888576.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64835.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
Length=180

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVEECKKEYPEAFIRIIGFDNSRQVQCISFIAYKP  175



>ref|XP_008797838.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Phoenix dactylifera]
Length=182

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V  ELEECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VAKELEECKKEYPDAFIRIIGFDNVRQVQCISFIAYKP  177



>gb|ACO35888.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ageratina adenophora]
Length=178

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ E+ ECKK YP  W+RI G DN  QVQCI FIA  PD
Sbjct  138  VLKEVGECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  176



>sp|Q08183.1|RBS3_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03695.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VVAELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  141  VVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  178



>gb|AFS41727.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41734.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41742.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ ELE CKK YP  ++RI G DN  QVQCI FIAY P+
Sbjct  142  VLEELENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE  180



>gb|AAA33037.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VVAELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  141  VVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  178



>dbj|BAI53118.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  +VRI G DN  QVQCI FIA+ P
Sbjct  141  VLKELEECKKAYPTAFVRIIGFDNKRQVQCISFIAFKP  178



>ref|XP_010263805.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  142  VLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKP  179



>ref|NP_001275244.1| ribulose bisphosphate carboxylase small chain C, chloroplastic 
[Solanum tuberosum]
 sp|P10647.1|RBS0_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain C, 
chloroplastic; Short=RuBisCO small subunit C; Flags: Precursor 
[Solanum tuberosum]
 gb|AAA33838.1| ribulose bisphosphate carboxylase (EC 4.1.1.39) [Solanum tuberosum]
Length=181

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE++E K  YP  W+RI G DN  QVQCI FIAY P+
Sbjct  141  VLAEVQEAKNAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>gb|AFS41729.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41736.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41751.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=182

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELE CKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  142  VLKELENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>sp|O65349.1|RBS_CAPAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Capsicum annuum]
 gb|AAC17126.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=187

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ E++E KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  140  VLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>sp|Q08185.1|RBS5_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03697.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial [Mesembryanthemum crystallinum]
Length=182

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VVAELEE KK YP  ++RI G DN  QVQC+ FIAY P
Sbjct  140  VVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP  177



>ref|WP_026003795.1| hypothetical protein, partial [Pseudomonas luteola]
Length=120

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AE++E KK YP  WVRI G DN  QVQCI FIAY P
Sbjct  83   VLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKP  120



>ref|XP_009380302.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=180

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VV E+EECKK YP  ++RI G DN  QVQCI FIA+ P
Sbjct  140  VVKEVEECKKEYPKAFIRIIGFDNNRQVQCISFIAFKP  177



>emb|CAA37517.1| NySS42 protein [Nicotiana sylvestris]
Length=39

 Score = 53.9 bits (128),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  161  AELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            AE+EE KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  1    AEVEEVKKAYPQAWIRIIGFDNMCQVQCISFIAYKPE  37



>sp|Q08184.1|RBS4_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33038.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 gb|AAA03696.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VVAELEE KK YP  ++RI G DN  QVQC+ FIAY P
Sbjct  141  VVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP  178



>gb|AAR83879.1| Cristal-Glass1 protein [Capsicum annuum]
Length=180

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ E++E KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  140  VLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>emb|CDY67657.1| BnaCnng55860D [Brassica napus]
Length=181

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_002868775.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45034.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
Length=181

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VVAELEE KK YP  + RI G DN  QVQCI FIAY P
Sbjct  138  VVAELEEAKKAYPEAFTRIIGFDNVRQVQCISFIAYKP  175



>ref|XP_010926041.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V  EL+ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VAKELDECKKEYPDVFIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_010450913.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AHI85721.1| stress-induced protein 16 [Capsicum annuum]
Length=180

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ E++E KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  140  VLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Panax ginseng]
Length=183

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIA+ P
Sbjct  141  VLKEVEECKKEYPNAYIRIIGFDNVRQVQCISFIAFKP  178



>sp|P31333.2|RBS_GOSHI RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Gossypium hirsutum]
 emb|CAA38026.1| ribulose bisphosphate carboxylase [Gossypium hirsutum]
 gb|AEX60834.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41721.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41726.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41741.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41749.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41755.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG14838.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELE CKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  142  VLEELENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>ref|XP_010450912.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic [Camelina sativa]
Length=181

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_010450911.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>sp|P19311.1|RBS5_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5A, 
chloroplastic; Short=RuBisCO small subunit SSU5A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35099.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AE+EE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  139  VIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>ref|XP_002868776.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45035.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75283.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75284.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  126  VLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  163



>gb|ABA46900.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Musa acuminata AAA Group]
Length=180

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VV E+EECKK YP  ++RI G DN  QVQCI FIA+ P
Sbjct  140  VVKEVEECKKEYPKAFIRIIGFDNNRQVQCISFIAFKP  177



>gb|AIF75342.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75343.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  134  VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|AGT97045.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=180

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ E++E KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  140  VLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_004299075.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=180

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AELEE KK YP  ++RI G DN  QVQC+ FIAY P
Sbjct  140  VIAELEEAKKTYPEAFIRIIGFDNIRQVQCVSFIAYKP  177



>gb|AAK16229.1|AF044397_1 ribulose-1,5-bisphosphate carboxylase small subunit R3 [Flaveria 
ramosissima]
Length=133

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL ECKK YP  W+RI G DN  QVQCI FIA  PD
Sbjct  93   VMKELGECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  131



>gb|AIF75344.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75345.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  134  VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|AAB81105.1| ribulose 1,5-bisphosphate carboxylase small subunit [Spinacia 
oleracea]
Length=180

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G D+  QVQC+ FIAY P
Sbjct  140  VLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKP  177



>sp|Q43832.1|RBS2_SPIOL RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA66201.1| ribulose-bisphosphate carboxylase [Spinacia oleracea]
Length=180

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G D+  QVQC+ FIAY P
Sbjct  140  VLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKP  177



>sp|P19312.1|RBS6_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5B, 
chloroplastic; Short=RuBisCO small subunit SSU5B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35100.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score = 55.1 bits (131),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AE+EE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  139  VIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>sp|P19308.1|RBS2_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU26, 
chloroplastic; Short=RuBisCO small subunit SSU26; Flags: 
Precursor [Lemna gibba]
 emb|CAA35101.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score = 55.1 bits (131),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AE+EE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  139  VIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>gb|AAK16227.1|AF044395_1 ribulose-1,5-bisphosphate carboxylase small subunit R1 [Flaveria 
ramosissima]
Length=131

 Score = 55.1 bits (131),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ EL ECKK YP  W+RI G DN  QVQCI FIA  PD
Sbjct  91   VMKELGECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  129



>ref|XP_006405770.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
 gb|ESQ47223.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
Length=181

 Score = 55.1 bits (131),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKKEYPQAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_006391472.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
 gb|ESQ28758.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
Length=181

 Score = 55.1 bits (131),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKKEYPQAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AEJ33935.1| chloroplast putative ribulose-1,5-bisphosphate carboxylase/oxygenase 
small subunit [Wolffia australiana]
Length=177

 Score = 55.1 bits (131),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AE+EE KK YP  +VRI G DN  QVQC+ FIAY P
Sbjct  139  VIAEVEEAKKAYPDYFVRIIGFDNKRQVQCVSFIAYKP  176



>ref|XP_009595081.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009609566.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 gb|AAP03874.1| putative ribulose bisphosphate carboxylase small subunit protein 
precursor [Nicotiana tabacum]
Length=180

 Score = 55.1 bits (131),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+ E KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  140  VLAEVGEAKKAYPEAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AFI60243.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Panicum virgatum]
Length=148

 Score = 54.7 bits (130),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAY  60
            V AELEECKK YP  ++RI G DN  QVQC+ FIAY
Sbjct  113  VYAELEECKKAYPDNYIRILGFDNARQVQCVSFIAY  148



>ref|XP_008381263.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Malus domestica]
Length=183

 Score = 55.1 bits (131),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  143  VLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  180



>gb|ABA46901.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Musa acuminata AAA Group]
Length=181

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V  ELEECKK YP  +V I G DN  QVQCI FIA+ PD
Sbjct  141  VAKELEECKKEYPRAFVGIIGFDNNRQVQCISFIAHKPD  179



>gb|ABS72189.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
1A [Corchorus olitorius]
Length=183

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VLKELEEAKKAYPDAFIRIIGFDNRRQVQCISFIAYKP  177



>gb|AAK49590.1|AF372874_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
Length=125

 Score = 54.3 bits (129),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  83   VLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  120



>ref|XP_010693054.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=179

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPDD  48
            VV E+EE KK YP  +VRI G DN  QVQCI FIAY P D
Sbjct  139  VVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKPKD  178



>ref|XP_009357812.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=183

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  143  VLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  180



>gb|AAL82195.1|AF396697_1 s/s2 [Nicotiana benthamiana]
Length=113

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  WVRI G DN  QVQCI FIA  P+
Sbjct  42   VLAEVEEAKKAYPQAWVRIIGFDNVRQVQCISFIASKPE  80



>sp|Q39743.1|RBS1_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67845.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+ECKK YP  W+RI G DN  QVQCI FIA  P
Sbjct  133  VMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKP  170



>sp|P08135.1|RBS_RAPSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Raphanus sativus]
 emb|CAA29801.1| carboxylase [Raphanus sativus]
 prf||1405335A ribulose bisphosphate carboxylase S
Length=181

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP   +RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKKEYPNALIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_009140170.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI+FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCIIFIAYKP  175



>gb|ABQ42552.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Musa acuminata AAA Group]
 gb|ACR56377.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Musa acuminata AAA Group]
Length=180

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V  E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VAKEVEECKKEYPHAFIRIIGFDNNRQVQCISFIAYKP  177



>ref|XP_006302885.1| hypothetical protein CARUB_v10021016mg [Capsella rubella]
 gb|EOA35783.1| hypothetical protein CARUB_v10021016mg [Capsella rubella]
Length=181

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+ ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVNECKKEYPEAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|KHN07520.1| Ribulose bisphosphate carboxylase small chain 4, chloroplastic 
[Glycine soja]
Length=120

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPDD  48
            V+ EL+E K  YP  ++RI G DN  QVQCI FIAY P D
Sbjct  80   VLKELQEAKTTYPNSFIRIIGFDNIRQVQCISFIAYKPPD  119



>ref|XP_009390221.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=180

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V  E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VAKEVEECKKEYPHAFIRIIGFDNNRQVQCISFIAYKP  177



>gb|AAA33035.1| ribulose-1-5-bisphosphate carboxylase [Mesembryanthemum crystallinum]
Length=182

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VVAEL E KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VVAELREAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_006663954.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  129  VLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAYKP  166



>ref|XP_002531624.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30752.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=180

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VLKELEEAKKAYPNSFIRIIGFDNKRQVQCISFIAYKP  177



>sp|Q02980.1|RBS_MALSP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Malus sp.]
 emb|CAA46475.1| ribulose bisphosphate carboxylase [Malus sp.]
Length=183

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  143  VLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  180



>ref|XP_009342656.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Pyrus x bretschneideri]
Length=183

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  143  VLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  180



>sp|O24045.1|RBS_MUSAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Musa acuminata]
 gb|AAB63287.1| ribulose-1,5-bisphosphate carboxylase small subunit [Musa acuminata]
Length=180

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V  E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  140  VAKEVEECKKEYPHAFIRIIGFDNNRQVQCISFIAYKP  177



>pdb|4RUB|S Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|T Chain T, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|U Chain U, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
 pdb|4RUB|V Chain V, A Crystal Form Of Ribulose-1,5-Bisphosphate Carboxylase(Slash) 
Oxygenase From Nicotiana Tabacum In The Activated 
State
Length=123

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+ E KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  83   VLAEVGEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  121



>gb|AIF75321.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
Length=177

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI+FIAY P
Sbjct  134  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCIIFIAYKP  171



>gb|AIF75296.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75297.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  126  VLKEVEECKKEYPEAFIRIIGFDNNRQVQCISFIAYKP  163



>sp|P13951.1|RBS_SINAL RecName: Full=Ribulose bisphosphate carboxylase small chain; 
Short=RuBisCO small subunit, partial [Sinapis alba]
 emb|CAA34458.1| unnamed protein product [Sinapis alba]
Length=82

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  39   VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  76



>gb|AAA33717.1| ribulose 1,5-bisphosphate carboxylase, partial [Petunia x hybrida]
Length=68

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+E KK YP  W+ I G DN  QVQCI FIAY P
Sbjct  28   VLGELQEAKKAYPNAWISIIGFDNVRQVQCISFIAYKP  65



>sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta]
Length=183

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  143  VLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  180



>sp|P19310.1|RBS4_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU40B, 
chloroplastic; Short=RuBisCO small subunit SSU40B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35103.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AE+EE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  139  VIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>ref|XP_008446602.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Cucumis melo]
Length=185

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VV E+EE KK YP  ++R+ G DN  QVQCI FIAY P
Sbjct  141  VVNEIEEAKKEYPDAYIRVIGFDNVRQVQCISFIAYKP  178



>ref|XP_009618419.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like, 
partial [Nicotiana tomentosiformis]
Length=70

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+EE KK YP  W+ I G DN  QVQCI FIAY P+
Sbjct  30   VLAEVEEAKKAYPQAWMGIIGFDNVRQVQCISFIAYKPE  68



>ref|XP_010044264.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic-like [Eucalyptus grandis]
 dbj|BAI53120.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
 gb|KCW86324.1| hypothetical protein EUGRSUZ_B03013 [Eucalyptus grandis]
Length=179

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLKELEEAKKAYPTAFIRIIGFDNKRQVQCISFIAYKP  176



>gb|AAP31053.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Flaveria bidentis]
Length=173

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+ECKK YP  W+RI G DN  QVQC+ FIA  P
Sbjct  133  VMKELQECKKEYPQAWIRIIGFDNVRQVQCVSFIASKP  170



>gb|AAP31054.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Flaveria bidentis]
Length=173

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+ECKK YP  W+RI G DN  QVQC+ FIA  P
Sbjct  133  VMKELQECKKEYPQAWIRIIGFDNVRQVQCVSFIASKP  170



>sp|P07089.1|RBS_FLATR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Flaveria trinervia]
 emb|CAA28711.1| unnamed protein product [Flaveria trinervia]
Length=173

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+ECKK YP  W+RI G DN  QVQC+ FIA  P
Sbjct  133  VMKELQECKKEYPQAWIRIIGFDNVRQVQCVSFIASKP  170



>sp|P00872.2|RBS1_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU1, 
chloroplastic; Short=RuBisCO small subunit SSU1; Flags: 
Precursor [Lemna gibba]
 emb|CAA35104.1| unnamed protein product [Lemna gibba]
Length=173

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AE+EE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  135  VIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  172



>ref|XP_008368660.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Malus domestica]
Length=179

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AAA33866.1| ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica 
x Pyrus communis]
Length=179

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  176



>prf||0902172A carboxylase/oxygenase,RBP
Length=123

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+AE+ E KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  83   VLAEVGEAKKAYPEAWIRIIGFDNVRQVQCISFIAYKPE  121



>ref|XP_006663961.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=182

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  129  VLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAYKP  166



>ref|XP_004303137.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  142  VLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>gb|ABA46899.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Musa acuminata AAA Group]
Length=180

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V  E+EECKK YP  ++RI G DN  QVQC+ FIAY P
Sbjct  140  VAKEVEECKKEYPHAFIRIIGFDNNRQVQCVSFIAYKP  177



>gb|AIF75291.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75293.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
Length=163

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  126  VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  163



>sp|Q96542.1|RBS_BETPN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Betula pendula]
 emb|CAA69102.1| ribulose-bisphosphate carboxylase [Betula pendula]
Length=182

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G DN  QVQ I FIAY P
Sbjct  142  VLKELEECKKAYPSAFIRIIGFDNKRQVQIISFIAYKP  179



>emb|CAA24969.1| unnamed protein product [Lemna gibba]
Length=120

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AE+EE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  82   VIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  119



>sp|P19309.1|RBS3_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU40A, 
chloroplastic; Short=RuBisCO small subunit SSU40A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35102.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+AE+EE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  139  VIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>gb|AIF75294.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  QVQCI FIAY P
Sbjct  126  VLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  163



>ref|WP_037767734.1| hypothetical protein [Streptomyces olindensis]
 gb|KDN74154.1| hypothetical protein DF19_37695 [Streptomyces olindensis]
Length=123

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ E++E KK YP  W+RI G DN  QVQCI FIAY P+
Sbjct  83   VLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  121



>gb|AAK16232.1|AF044400_1 ribulose-1,5-bisphosphate carboxylase small subunit P2A [Flaveria 
palmeri]
Length=131

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+ECKK YP  W+RI G DN  QVQC+ FIA  P
Sbjct  91   VMKELQECKKEYPQAWIRIIGFDNVRQVQCVSFIASKP  128



>gb|AAK16231.1|AF044399_1 ribulose-1,5-bisphosphate carboxylase small subunit P1B [Flaveria 
palmeri]
 gb|AAK16233.1|AF044401_1 ribulose-1,5-bisphosphate carboxylase small subunit P2B [Flaveria 
palmeri]
Length=131

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+ECKK YP  W+RI G DN  QVQC+ FIA  P
Sbjct  91   VMKELQECKKEYPQAWIRIIGFDNVRQVQCVSFIASKP  128



>emb|CAA53083.1| ribulose-1,5-bisphosphate carboxylase /oxygenase, small subunit 
[Brassica napus]
Length=181

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AFK36660.1| unknown [Lotus japonicus]
 gb|AFK45650.1| unknown [Lotus japonicus]
Length=177

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ ELEE KK YP  ++RI G DN  QVQCI FIA+ P+
Sbjct  137  VLKELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAHRPE  175



>ref|XP_009127523.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic-like [Brassica rapa]
Length=181

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  Q QCI FIAY P
Sbjct  138  VLKEVQECKKEYPNAFIRIIGFDNNRQAQCISFIAYKP  175



>emb|CDY52468.1| BnaA04g27920D [Brassica napus]
Length=181

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>emb|CDY12616.1| BnaA02g12840D [Brassica napus]
Length=181

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  Q QCI FIAY P
Sbjct  138  VLKEVQECKKEYPNAFIRIIGFDNNRQAQCISFIAYKP  175



>gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Aralia elata]
Length=183

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FIA+ P
Sbjct  141  VLNEVEECKKEYPNAFIRIIGFDNVRQVQCISFIAFKP  178



>ref|XP_006664952.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  129  VLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAYKP  166



>gb|AFS41765.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium armourianum]
 gb|AFS41767.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium davidsonii]
Length=168

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIA  63
            V+ ELEECKK YP  ++RI G DN  QVQCI FIA
Sbjct  134  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIA  168



>ref|XP_006663955.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Oryza brachyantha]
Length=170

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  129  VLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAYKP  166



>gb|AIF75322.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  134  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>sp|Q41351.1|RBS_STELP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Stellaria longipes]
 gb|AAA69018.1| ribulose 1,5-bisphosphate carboxylase small subunit [Stellaria 
longipes]
Length=180

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V AE++E KK YP   +RI G DN  QVQCI FIAY P+
Sbjct  140  VAAEVQEAKKAYPDAHIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AFS41770.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium gossypioides]
Length=168

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIA  63
            V+ ELEECKK YP  ++RI G DN  QVQCI FIA
Sbjct  134  VLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIA  168



>gb|AIF75311.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75312.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  Q QCI FIAY P
Sbjct  134  VLKEVQECKKEYPNAFIRIIGFDNNRQAQCISFIAYKP  171



>ref|XP_010693073.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=180

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VV E+EE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  140  VVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKP  177



>emb|CDX99682.1| BnaC04g34390D [Brassica napus]
Length=189

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>emb|CDX67402.1| BnaA07g14420D [Brassica napus]
Length=181

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_010693099.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VV E+EE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  141  VVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKP  178



>gb|AFK33868.1| unknown [Lotus japonicus]
Length=177

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            V+ ELEE KK YP  ++RI G DN  QVQCI FIA+ P+
Sbjct  137  VLKELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAHRPE  175



>ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52085.1| hypothetical protein Csa_5G609710 [Cucumis sativus]
Length=185

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EE KK YP  ++R+ G DN  QVQCI FIAY P
Sbjct  142  VIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP  179



>sp|Q9XGX5.1|RBS2_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37439.1|AF150666_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=184

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPDD  48
            V+ E+EE KK YP  ++RI G DN  QVQC+ FIAY P D
Sbjct  143  VLNEVEEAKKAYPTAFIRIIGFDNKRQVQCVSFIAYKPAD  182



>ref|XP_009127518.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic-like [Brassica rapa]
Length=181

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  Q QCI FIAY P
Sbjct  138  VLKEVQECKKEYPNAFIRIIGFDNNRQAQCISFIAYKP  175



>ref|XP_009127519.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic-like [Brassica rapa]
 emb|CDY12613.1| BnaA02g12810D [Brassica napus]
Length=181

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  Q QCI FIAY P
Sbjct  138  VLKEVQECKKEYPNAFIRIIGFDNNRQAQCISFIAYKP  175



>ref|XP_010669829.1| PREDICTED: ribulose bisphosphate carboxylase small chain 6, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=183

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPD  51
            VV ELEE KK YP  +VRI G D   QVQCI FIAY P+
Sbjct  143  VVNELEEVKKAYPQAFVRIIGFDKNRQVQCISFIAYKPE  181



>ref|XP_010103758.1| hypothetical protein L484_014647 [Morus notabilis]
 gb|EXB97036.1| hypothetical protein L484_014647 [Morus notabilis]
Length=182

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPDDK  45
            V+AE++E KK YP   VRI G DN  QVQCI FIAY P  K
Sbjct  142  VLAEVQETKKAYPDAHVRIIGFDNNRQVQCISFIAYKPPAK  182



>ref|XP_010693059.1| PREDICTED: ribulose bisphosphate carboxylase small chain [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            VV E+EE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  140  VVNEVEEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKP  177



>ref|XP_003581511.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Brachypodium distachyon]
Length=176

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  130  VLKELEEAKKEYPDAFIRIIGFDNVRQVQCISFIAYKP  167



>pdb|1IR1|S Chain S, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|T Chain T, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|U Chain U, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
 pdb|1IR1|V Chain V, Crystal Structure Of Spinach Ribulose-1,5-Bisphosphate 
CarboxylaseOXYGENASE (RUBISCO) COMPLEXED WITH CO2, MG2+ AND 
2- Carboxyarabinitol-1,5-Bisphosphate
Length=123

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEECKK YP  ++RI G D+  QVQC+ FIAY P
Sbjct  83   VLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKP  120



>gb|AIF75323.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  134  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis 
sativus]
Length=185

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EE KK YP  ++R+ G DN  QVQCI FIAY P
Sbjct  142  VIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP  179



>ref|XP_009125072.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>emb|CAA30290.1| rubisco ssu precursor [Brassica napus]
Length=181

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75340.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75341.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  134  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>ref|XP_009139778.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic isoform X1 [Brassica rapa]
 sp|P27985.1|RBS2_BRANA RecName: Full=Ribulose bisphosphate carboxylase small chain F1, 
chloroplastic; Short=RuBisCO small subunit F1; Flags: Precursor 
[Brassica napus]
 emb|CAA39402.1| ribulose bisphosphate carboxylase /oxygenase small subunit [Brassica 
napus]
 emb|CDY71122.1| BnaAnng36210D [Brassica napus]
Length=181

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>sp|P05346.2|RBS1_BRANA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Brassica napus]
 emb|CAA43410.1| ribulose bisphosphate carboxylase [Brassica napus]
 gb|AHL28802.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Brassica rapa subsp. chinensis]
 emb|CDY01671.1| BnaC04g30810D [Brassica napus]
 emb|CDX74532.1| BnaA04g08570D [Brassica napus]
Length=181

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_003555148.2| PREDICTED: LOW QUALITY PROTEIN: ribulose bisphosphate carboxylase 
small chain 4, chloroplastic-like [Glycine max]
Length=178

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPDD  48
            V+ EL+E K  YP  ++RI G DN  QVQCI FIAY P D
Sbjct  138  VLKELQEAKTTYPNSFIRIIGFDNIRQVQCISFIAYKPPD  177



>gb|ACQ90230.1| virus-resistance protein [Brassica rapa subsp. chinensis]
Length=249

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  206  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  243



>emb|CDY42338.1| BnaC02g17150D [Brassica napus]
Length=181

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECK+ YP  ++RI G DN  Q QCI FIAY P
Sbjct  138  VLKEVEECKQEYPNAFIRIIGFDNNRQAQCISFIAYKP  175



>sp|P08474.1|RBS_CUCSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Cucumis sativus]
 gb|AAA33131.1| ribulose bisphosphate carboxylase/oxygenase precursor peptide 
[Cucumis sativus]
Length=189

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EE KK YP  ++R+ G DN  QVQCI FIAY P
Sbjct  142  VIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP  179



>gb|AIF75324.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75325.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  134  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|ABK15574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia sinensis]
Length=176

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E+EECKK YP  ++RI G DN  QVQCI FI Y P
Sbjct  136  VLKEVEECKKEYPQSFIRIIGFDNKRQVQCISFICYKP  173



>sp|O22077.1|RBS_FAGCR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Fagus crenata]
 dbj|BAA23214.1| small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase 
[Fagus crenata]
Length=182

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXPDDK  45
            V+AEL+E  K YP   +RI G DN  QVQCI FIAY P  K
Sbjct  142  VLAELQEASKTYPTSHIRIIGFDNKRQVQCISFIAYKPPAK  182



>ref|XP_002521232.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF41184.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
Length=181

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ EL+E KK YP  ++RI G DN  QVQCI FIAY P
Sbjct  139  VLKELDEAKKAYPNSFIRIIGFDNRRQVQCISFIAYKP  176



>gb|AIF75332.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75333.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  134  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|ABB51649.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit precursor [Brassica napus]
Length=181

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75317.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75318.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75319.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75320.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75334.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75335.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75336.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  134  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>dbj|BAJ08160.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Brassica rapa 
subsp. chinensis]
 emb|CDX74525.1| BnaA04g08640D [Brassica napus]
Length=181

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>emb|CDY12612.1| BnaA02g12800D [Brassica napus]
Length=121

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  Q QCI FIAY P
Sbjct  78   VLKEVQECKKEYPNAFIRIIGFDNNRQAQCISFIAYKP  115



>ref|XP_003577109.1| PREDICTED: ribulose bisphosphate carboxylase small chain PWS4.3, 
chloroplastic [Brachypodium distachyon]
Length=174

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  +VRI G DN  QVQCI FIA+ P
Sbjct  128  VLKELEEVKKEYPDAYVRIIGFDNTRQVQCISFIAFKP  165



>gb|ABL97962.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Brassica rapa]
Length=181

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>emb|CDY42341.1| BnaC02g17180D [Brassica napus]
Length=186

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECKK YP  ++RI G DN  Q QCI FIA+ P
Sbjct  143  VLKEVQECKKEYPNAFIRIIGFDNNRQAQCISFIAFKP  180



>gb|AIF75313.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75314.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75315.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75316.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
 gb|AIF75339.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  134  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>emb|CDY01665.1| BnaC04g30870D [Brassica napus]
Length=181

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  138  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>pdb|3AXK|S Chain S, Structure Of Rice Rubisco In Complex With Nadp(h)
 pdb|3AXK|T Chain T, Structure Of Rice Rubisco In Complex With Nadp(h)
Length=129

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  +VRI G DN  QVQCI FIAY P
Sbjct  83   VLKELEEAKKAYPDAFVRIIGFDNVRQVQCISFIAYKP  120



>gb|AIF75337.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75338.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ E++ECK  YP  ++RI G DN  QVQCI FIAY P
Sbjct  134  VLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>ref|XP_010528479.1| PREDICTED: LOW QUALITY PROTEIN: ribulose bisphosphate carboxylase 
small chain, chloroplastic-like [Tarenaya hassleriana]
Length=208

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE K+ +P  ++RI G DN  QVQCI FIAY P
Sbjct  168  VIKELEEAKREHPDAFIRIIGFDNVRQVQCISFIAYKP  205



>gb|AFS41772.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypioides kirkii]
 gb|AFS41773.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypioides kirkii]
Length=168

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIA  63
            V+ EL+ECKK YP  ++RI G DN  QVQCI FIA
Sbjct  134  VLKELDECKKAYPNAFIRIIGFDNVRQVQCISFIA  168



>ref|XP_003576920.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Brachypodium distachyon]
Length=175

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  167  VVAELEECKKXYPGXWVRIXGLDNXXQVQCIMFIAYXP  54
            V+ ELEE KK YP  +VRI G DN  QVQCI FIA+ P
Sbjct  129  VLKELEEVKKEYPDAYVRIIGFDNTRQVQCISFIAFKP  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560236672665