BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF020N05

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080934.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    322   3e-108   Sesamum indicum [beniseed]
ref|XP_011072993.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       320   2e-107   Sesamum indicum [beniseed]
gb|KDP25412.1|  hypothetical protein JCGZ_20568                         318   6e-107   Jatropha curcas
ref|XP_010089080.1|  Ubiquitin-conjugating enzyme E2 5                  318   9e-107   Morus notabilis
gb|EYU38331.1|  hypothetical protein MIMGU_mgv1a014569mg                318   2e-106   Erythranthe guttata [common monkey flower]
ref|XP_002509830.1|  ubiquitin-conjugating enzyme h, putative           317   2e-106   Ricinus communis
emb|CDP12044.1|  unnamed protein product                                315   2e-105   Coffea canephora [robusta coffee]
ref|XP_009790425.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    315   2e-105   Nicotiana sylvestris
ref|XP_006343959.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    314   4e-105   Solanum tuberosum [potatoes]
ref|XP_009592682.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    314   4e-105   Nicotiana tomentosiformis
ref|XP_010670105.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    313   5e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007135093.1|  hypothetical protein PHAVU_010G100200g             313   6e-105   Phaseolus vulgaris [French bean]
ref|XP_009375015.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    313   7e-105   Pyrus x bretschneideri [bai li]
ref|XP_010055667.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    313   7e-105   Eucalyptus grandis [rose gum]
ref|XP_011029312.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    314   1e-104   Populus euphratica
ref|XP_007218489.1|  hypothetical protein PRUPE_ppa012120mg             313   1e-104   Prunus persica
ref|XP_007040285.1|  Ubiquitin-conjugating enzyme 5                     313   1e-104   Theobroma cacao [chocolate]
ref|XP_004245589.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5       312   1e-104   Solanum lycopersicum
ref|XP_002276343.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    312   2e-104   Vitis vinifera
ref|NP_001237603.1|  ubiquitin carrier protein 4                        312   2e-104   Glycine max [soybeans]
ref|XP_008233026.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    312   3e-104   Prunus mume [ume]
ref|XP_003548669.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    312   3e-104   Glycine max [soybeans]
ref|XP_007209658.1|  hypothetical protein PRUPE_ppa012080mg             311   5e-104   Prunus persica
ref|XP_011092673.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    311   6e-104   Sesamum indicum [beniseed]
ref|XP_002279927.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    310   9e-104   Vitis vinifera
gb|KHF98807.1|  Ubiquitin-conjugating enzyme E2 5 -like protein         310   1e-103   Gossypium arboreum [tree cotton]
ref|XP_002511883.1|  ubiquitin-conjugating enzyme h, putative           310   2e-103   Ricinus communis
ref|XP_002298025.1|  Ubiquitin-conjugating enzyme E2-21 kDa 3 fam...    309   4e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010275657.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    308   8e-103   Nelumbo nucifera [Indian lotus]
ref|XP_004306758.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    308   8e-103   Fragaria vesca subsp. vesca
ref|XP_011023305.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    308   8e-103   Populus euphratica
ref|XP_003552403.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    308   1e-102   Glycine max [soybeans]
gb|KDP28606.1|  hypothetical protein JCGZ_14377                         308   1e-102   Jatropha curcas
ref|XP_004143895.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    308   1e-102   Cucumis sativus [cucumbers]
ref|XP_009349265.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    307   2e-102   Pyrus x bretschneideri [bai li]
ref|XP_007139813.1|  hypothetical protein PHAVU_008G060900g             307   2e-102   Phaseolus vulgaris [French bean]
ref|XP_002302592.2|  ubiquitin carrier protein 4                        306   3e-102   Populus trichocarpa [western balsam poplar]
ref|XP_009626849.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    306   4e-102   Nicotiana tomentosiformis
ref|XP_006476536.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    306   4e-102   Citrus sinensis [apfelsine]
ref|XP_007051764.1|  Ubiquitin-conjugating enzyme E2 5 isoform 2        306   5e-102   Theobroma cacao [chocolate]
ref|XP_009628118.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    306   6e-102   Nicotiana tomentosiformis
ref|XP_008342748.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    306   6e-102   Malus domestica [apple tree]
ref|XP_004510772.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    306   8e-102   Cicer arietinum [garbanzo]
ref|NP_001242818.1|  uncharacterized protein LOC100805356               305   8e-102   
gb|KJB39652.1|  hypothetical protein B456_007G023700                    305   8e-102   Gossypium raimondii
gb|KDO86231.1|  hypothetical protein CISIN_1g030092mg                   305   8e-102   Citrus sinensis [apfelsine]
ref|XP_002465854.1|  hypothetical protein SORBIDRAFT_01g047040          305   1e-101   Sorghum bicolor [broomcorn]
gb|KEH18844.1|  ubiquitin-conjugating enzyme                            305   1e-101   Medicago truncatula
gb|AFK34026.1|  unknown                                                 305   2e-101   Medicago truncatula
ref|XP_010087938.1|  Ubiquitin-conjugating enzyme E2 5                  305   2e-101   Morus notabilis
ref|XP_010940566.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    304   3e-101   Elaeis guineensis
ref|XP_009783359.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    304   3e-101   Nicotiana sylvestris
ref|XP_006491142.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    304   4e-101   Citrus sinensis [apfelsine]
ref|XP_008779270.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    304   4e-101   Phoenix dactylifera
ref|XP_008801319.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    303   4e-101   Phoenix dactylifera
ref|XP_010255296.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    303   5e-101   Nelumbo nucifera [Indian lotus]
ref|XP_004229945.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    303   5e-101   Solanum lycopersicum
ref|XP_006358673.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    303   5e-101   Solanum tuberosum [potatoes]
ref|XP_004248050.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    303   5e-101   Solanum lycopersicum
ref|XP_006661803.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    303   5e-101   Oryza brachyantha
ref|XP_006827545.1|  hypothetical protein AMTR_s00009p00214490          303   6e-101   
ref|XP_008794268.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    303   9e-101   Phoenix dactylifera
ref|XP_006339599.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    302   1e-100   Solanum tuberosum [potatoes]
ref|XP_004985701.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    302   2e-100   Setaria italica
gb|ABB47726.2|  Ubiquitin-conjugating enzyme E2-23 kDa, putative,...    302   2e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011036629.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       301   3e-100   Populus euphratica
ref|XP_002320806.1|  ubiquitin carrier protein 4                        301   3e-100   Populus trichocarpa [western balsam poplar]
ref|XP_009791637.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    301   3e-100   Nicotiana sylvestris
ref|NP_001132906.1|  uncharacterized protein LOC100194405               301   3e-100   Zea mays [maize]
ref|XP_009400670.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    301   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002467149.1|  hypothetical protein SORBIDRAFT_01g020460          301   4e-100   Sorghum bicolor [broomcorn]
ref|XP_011093127.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    301   5e-100   Sesamum indicum [beniseed]
ref|XP_007051763.1|  Ubiquitin-conjugating enzyme E2 5 isoform 1        301   8e-100   
emb|CDP08792.1|  unnamed protein product                                300   9e-100   Coffea canephora [robusta coffee]
ref|XP_008438028.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    300   1e-99    Cucumis melo [Oriental melon]
ref|XP_008647817.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    300   1e-99    Zea mays [maize]
ref|XP_010234781.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    300   1e-99    Brachypodium distachyon [annual false brome]
ref|XP_010676458.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5       300   1e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001759393.1|  predicted protein                                  300   1e-99    
ref|XP_009367807.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    300   1e-99    
ref|XP_008787422.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    300   1e-99    Phoenix dactylifera
ref|XP_004298815.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    300   1e-99    Fragaria vesca subsp. vesca
gb|KHN46724.1|  Ubiquitin-conjugating enzyme E2 5                       300   2e-99    Glycine soja [wild soybean]
ref|XP_002304506.1|  Ubiquitin-conjugating enzyme E2-21 kDa 3 fam...    300   2e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010933128.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    300   2e-99    Elaeis guineensis
gb|KJB20631.1|  hypothetical protein B456_003G157300                    301   2e-99    Gossypium raimondii
ref|XP_009397539.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    299   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004133859.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    299   2e-99    Cucumis sativus [cucumbers]
tpg|DAA49812.1|  TPA: putative ubiquitin-conjugating enzyme family      299   2e-99    
ref|NP_001132171.1|  uncharacterized protein LOC100193596               299   2e-99    Zea mays [maize]
ref|XP_011022652.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    299   3e-99    Populus euphratica
ref|XP_010234779.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    299   3e-99    Brachypodium distachyon [annual false brome]
ref|XP_010935786.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    299   4e-99    Elaeis guineensis
gb|KJB52144.1|  hypothetical protein B456_008G248000                    298   5e-99    Gossypium raimondii
gb|ACG24376.1|  ubiquitin-conjugating enzyme E2-21 kDa 1                298   6e-99    Zea mays [maize]
gb|EMT01071.1|  Ubiquitin-conjugating enzyme E2 5                       297   2e-98    
ref|XP_010275656.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    298   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_003525387.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    296   2e-98    Glycine max [soybeans]
gb|EMS63342.1|  Ubiquitin-conjugating enzyme E2 5                       297   2e-98    Triticum urartu
gb|AFK43668.1|  unknown                                                 295   1e-97    Lotus japonicus
ref|NP_001266400.1|  putative ubiquitin-conjugating enzyme family       301   3e-97    Zea mays [maize]
ref|XP_008647901.1|  PREDICTED: putative ubiquitin-conjugating en...    300   4e-97    
ref|XP_004503694.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    293   5e-97    Cicer arietinum [garbanzo]
ref|NP_001236928.1|  uncharacterized protein LOC100527756               292   1e-96    Glycine max [soybeans]
gb|ACN39971.1|  unknown                                                 292   2e-96    Picea sitchensis
ref|XP_009389296.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    292   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010533643.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    292   3e-96    Tarenaya hassleriana [spider flower]
ref|XP_006302819.1|  hypothetical protein CARUB_v10020943mg             292   4e-96    
gb|ABK23779.1|  unknown                                                 291   5e-96    Picea sitchensis
ref|XP_003558810.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    290   8e-96    Brachypodium distachyon [annual false brome]
ref|XP_002886384.1|  ubiquitin-conjugating enzyme 37                    290   8e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_010658145.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    290   9e-96    Vitis vinifera
ref|XP_003557690.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    290   2e-95    Brachypodium distachyon [annual false brome]
ref|XP_010940563.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    290   2e-95    Elaeis guineensis
ref|XP_010430489.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5       289   3e-95    Camelina sativa [gold-of-pleasure]
ref|NP_564817.2|  ubiquitin-conjugating enzyme E2 5                     289   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418415.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    289   3e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010559097.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    288   5e-95    Tarenaya hassleriana [spider flower]
ref|XP_002964045.1|  ubiquitin-conjugating enzyme 5, E2                 288   5e-95    Selaginella moellendorffii
ref|XP_010436081.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       288   8e-95    Camelina sativa [gold-of-pleasure]
ref|NP_568589.1|  ubiquitin-conjugating enzyme E2 4                     288   8e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447359.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    288   8e-95    Camelina sativa [gold-of-pleasure]
ref|XP_002868603.1|  hypothetical protein ARALYDRAFT_493844             288   8e-95    
ref|XP_006286283.1|  hypothetical protein CARUB_v10007860mg             288   1e-94    Capsella rubella
ref|XP_009397721.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    287   1e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS69444.1|  ubiquitin carrier protein                               287   2e-94    Genlisea aurea
ref|XP_006405362.1|  hypothetical protein EUTSA_v10027948mg             286   2e-94    Eutrema salsugineum [saltwater cress]
ref|XP_010441297.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    286   3e-94    Camelina sativa [gold-of-pleasure]
gb|KFK33016.1|  hypothetical protein AALP_AA6G319600                    286   3e-94    Arabis alpina [alpine rockcress]
dbj|BAK02014.1|  predicted protein                                      286   3e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAA32900.1|  ubiquitin conjugating enzyme                            286   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051766.1|  Ubiquitin-conjugating enzyme E2 5 isoform 4        285   9e-94    
ref|XP_010553532.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    285   9e-94    Tarenaya hassleriana [spider flower]
gb|KJB52143.1|  hypothetical protein B456_008G248000                    283   2e-93    Gossypium raimondii
ref|XP_006465385.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    283   3e-93    Citrus sinensis [apfelsine]
ref|XP_006598954.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    282   5e-93    Glycine max [soybeans]
emb|CDY58954.1|  BnaCnng33990D                                          283   5e-93    Brassica napus [oilseed rape]
ref|XP_003627554.1|  Ubiquitin carrier protein                          283   6e-93    
ref|XP_010940567.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    282   8e-93    
gb|ABK21140.1|  unknown                                                 283   8e-93    Picea sitchensis
sp|P16577.1|UBC4_WHEAT  RecName: Full=Ubiquitin-conjugating enzym...    282   9e-93    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006586692.1|  PREDICTED: uncharacterized protein LOC100805...    281   2e-92    
ref|XP_010933129.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    280   4e-92    
ref|XP_009140085.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       280   6e-92    Brassica rapa
ref|XP_010918820.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4       278   1e-91    
gb|KDO86232.1|  hypothetical protein CISIN_1g030092mg                   278   1e-91    Citrus sinensis [apfelsine]
gb|KHN29339.1|  Ubiquitin-conjugating enzyme E2 5                       279   2e-91    Glycine soja [wild soybean]
ref|XP_009125181.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    279   2e-91    Brassica rapa
ref|XP_008393051.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    279   2e-91    Malus domestica [apple tree]
ref|XP_004298926.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    279   3e-91    Fragaria vesca subsp. vesca
emb|CDY62172.1|  BnaC06g42330D                                          279   3e-91    Brassica napus [oilseed rape]
ref|XP_008787423.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    277   4e-91    Phoenix dactylifera
gb|KGN56505.1|  hypothetical protein Csa_3G121800                       277   5e-91    Cucumis sativus [cucumbers]
ref|NP_001064719.1|  Os10g0447100                                       276   5e-91    
ref|XP_006853122.1|  hypothetical protein AMTR_s00038p00146240          278   5e-91    
ref|XP_010037586.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    278   6e-91    Eucalyptus grandis [rose gum]
ref|XP_011098510.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    278   7e-91    Sesamum indicum [beniseed]
ref|XP_007036155.1|  Ubiquitin-conjugating enzyme E2 5 isoform 1        277   9e-91    Theobroma cacao [chocolate]
ref|XP_010935785.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    278   2e-90    Elaeis guineensis
ref|XP_007209657.1|  hypothetical protein PRUPE_ppa012074mg             276   3e-90    Prunus persica
gb|EPS57624.1|  ubiquitin carrier protein                               275   3e-90    Genlisea aurea
ref|XP_009628119.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    275   3e-90    Nicotiana tomentosiformis
gb|KJB39653.1|  hypothetical protein B456_007G023700                    275   4e-90    Gossypium raimondii
ref|XP_004251221.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    276   4e-90    Solanum lycopersicum
ref|XP_007051765.1|  Ubiquitin-conjugating enzyme E2 5 isoform 3        276   4e-90    
ref|XP_007160084.1|  hypothetical protein PHAVU_002G291200g             275   5e-90    Phaseolus vulgaris [French bean]
gb|KDP31131.1|  hypothetical protein JCGZ_11507                         275   7e-90    Jatropha curcas
ref|XP_009783360.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    274   1e-89    Nicotiana sylvestris
gb|KHG06323.1|  Ubiquitin-conjugating enzyme E2 4 -like protein         275   1e-89    Gossypium arboreum [tree cotton]
ref|XP_002985720.1|  ubiquitin-conjugating enzyme 5, E2                 275   1e-89    Selaginella moellendorffii
ref|XP_010935784.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    276   1e-89    Elaeis guineensis
gb|AFK44595.1|  unknown                                                 275   1e-89    Medicago truncatula
ref|XP_002974421.1|  ubiquitin-conjugating enzyme 5, E2                 274   2e-89    Selaginella moellendorffii
gb|EYU42972.1|  hypothetical protein MIMGU_mgv1a0146272mg               273   2e-89    Erythranthe guttata [common monkey flower]
ref|XP_004508848.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    274   2e-89    Cicer arietinum [garbanzo]
gb|KGN64295.1|  hypothetical protein Csa_1G045930                       276   2e-89    Cucumis sativus [cucumbers]
ref|XP_008647825.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    273   2e-89    Zea mays [maize]
ref|XP_006439774.1|  hypothetical protein CICLE_v10022463mg             274   2e-89    Citrus clementina [clementine]
ref|XP_003608946.1|  Ubiquitin carrier protein                          274   3e-89    Medicago truncatula
ref|XP_006470379.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    273   4e-89    Citrus sinensis [apfelsine]
ref|XP_010913550.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    273   4e-89    Elaeis guineensis
emb|CDP20894.1|  unnamed protein product                                273   5e-89    Coffea canephora [robusta coffee]
ref|XP_006340324.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    273   5e-89    Solanum tuberosum [potatoes]
ref|XP_010532272.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    273   5e-89    Tarenaya hassleriana [spider flower]
ref|XP_009592505.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    273   5e-89    Nicotiana tomentosiformis
ref|XP_004152466.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    273   7e-89    Cucumis sativus [cucumbers]
ref|XP_007155401.1|  hypothetical protein PHAVU_003G198300g             273   8e-89    Phaseolus vulgaris [French bean]
ref|XP_011028598.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    272   9e-89    Populus euphratica
ref|XP_006405361.1|  hypothetical protein EUTSA_v10027948mg             270   2e-88    
ref|XP_006600652.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    271   3e-88    Glycine max [soybeans]
gb|KJB37063.1|  hypothetical protein B456_006G188200                    273   3e-88    Gossypium raimondii
ref|XP_002321579.1|  hypothetical protein POPTR_0015s08470g             271   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_010254946.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    271   4e-88    Nelumbo nucifera [Indian lotus]
ref|NP_001241807.1|  ubiquitin-conjugating enzyme E2-21 kDa 1           270   5e-88    Zea mays [maize]
ref|XP_010107447.1|  Ubiquitin-conjugating enzyme E2 5                  270   6e-88    Morus notabilis
gb|AFK44151.1|  unknown                                                 270   6e-88    Lotus japonicus
ref|XP_009381635.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    270   7e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008780946.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    272   7e-88    Phoenix dactylifera
ref|XP_002280126.2|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    270   9e-88    Vitis vinifera
ref|XP_004138119.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    270   1e-87    Cucumis sativus [cucumbers]
ref|XP_004155833.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    269   1e-87    
gb|ACG24713.1|  ubiquitin-conjugating enzyme E2-21 kDa 1                269   1e-87    Zea mays [maize]
ref|XP_008453110.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    269   2e-87    Cucumis melo [Oriental melon]
ref|XP_006579381.1|  PREDICTED: uncharacterized protein LOC100527...    269   2e-87    Glycine max [soybeans]
ref|XP_006397787.1|  hypothetical protein EUTSA_v10001650mg             269   2e-87    Eutrema salsugineum [saltwater cress]
gb|EYU44716.1|  hypothetical protein MIMGU_mgv1a014494mg                269   2e-87    Erythranthe guttata [common monkey flower]
gb|KDP45387.1|  hypothetical protein JCGZ_09636                         270   3e-87    Jatropha curcas
ref|XP_008360712.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    268   4e-87    
ref|XP_006580568.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    267   4e-87    Glycine max [soybeans]
ref|XP_010940565.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    268   6e-87    
ref|NP_566062.1|  ubiquitin-conjugating enzyme E2 6                     268   6e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511435.1|  ubiquitin-conjugating enzyme h, putative           268   6e-87    Ricinus communis
ref|NP_001237311.1|  uncharacterized protein LOC100527526               268   7e-87    
ref|XP_010506595.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    267   8e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010271991.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    267   8e-87    Nelumbo nucifera [Indian lotus]
ref|XP_002882046.1|  ubiquitin-conjugating enzyme 6                     267   1e-86    Arabidopsis lyrata subsp. lyrata
ref|XP_009142401.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    267   1e-86    Brassica rapa
ref|XP_010254271.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    266   2e-86    Nelumbo nucifera [Indian lotus]
gb|AFK33447.1|  unknown                                                 265   5e-86    Lotus japonicus
emb|CDY27337.1|  BnaC04g50680D                                          265   5e-86    Brassica napus [oilseed rape]
ref|NP_001148188.1|  ubiquitin-conjugating enzyme E2-21 kDa 1           265   6e-86    
ref|XP_010508073.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6       265   6e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010518259.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    265   7e-86    Camelina sativa [gold-of-pleasure]
ref|XP_009133760.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6       265   7e-86    Brassica rapa
ref|XP_006295060.1|  hypothetical protein CARUB_v10024128mg             265   1e-85    Capsella rubella
emb|CDX95674.1|  BnaC03g25550D                                          264   2e-85    
gb|AFK45061.1|  unknown                                                 264   2e-85    Lotus japonicus
ref|XP_006584539.1|  PREDICTED: uncharacterized protein LOC100527...    263   3e-85    Glycine max [soybeans]
ref|XP_008360711.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    263   3e-85    
ref|XP_010678729.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    263   4e-85    Beta vulgaris subsp. vulgaris [field beet]
gb|KFK37384.1|  hypothetical protein AALP_AA4G250300                    261   2e-84    Arabis alpina [alpine rockcress]
ref|XP_006374516.1|  hypothetical protein POPTR_0015s08470g             261   2e-84    
gb|KEH21089.1|  ubiquitin-conjugating enzyme                            260   3e-84    Medicago truncatula
ref|XP_009397799.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    260   3e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008351691.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    258   8e-84    
gb|AAG52444.1|AC010852_1  putative ubiquitin-conjugating enzyme; ...    259   8e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010559098.1|  PREDICTED: ubiquitin-conjugating enzyme E2 6...    258   1e-83    Tarenaya hassleriana [spider flower]
ref|XP_010037581.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    259   2e-83    Eucalyptus grandis [rose gum]
ref|XP_010913549.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    259   2e-83    
ref|XP_010913548.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    259   4e-83    Elaeis guineensis
ref|XP_005650676.1|  ubiquitin conjugating enzyme                       257   1e-82    Coccomyxa subellipsoidea C-169
ref|XP_002517368.1|  ubiquitin-conjugating enzyme h, putative           256   2e-82    Ricinus communis
ref|XP_006600654.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    255   3e-82    
gb|EMT26310.1|  Ubiquitin-conjugating enzyme E2-23 kDa                  256   8e-82    
ref|XP_008453111.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    254   9e-82    
ref|XP_006374515.1|  hypothetical protein POPTR_0015s08470g             253   2e-81    
gb|KJB08192.1|  hypothetical protein B456_001G070300                    254   2e-81    Gossypium raimondii
ref|XP_008438167.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    253   3e-81    
ref|XP_010255297.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    252   5e-81    Nelumbo nucifera [Indian lotus]
ref|XP_005849389.1|  hypothetical protein CHLNCDRAFT_57433              253   8e-81    Chlorella variabilis
ref|XP_008780947.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    252   1e-80    
ref|XP_008780945.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    253   3e-80    
emb|CCG82921.1|  Ubiquitin-conjugating enzyme E2 8                      251   3e-80    Taphrina deformans PYCC 5710
ref|XP_006679982.1|  hypothetical protein BATDEDRAFT_35380              250   3e-80    Batrachochytrium dendrobatidis JAM81
emb|CAA50503.1|  ubiquitin carrier protein                              250   4e-80    Arabidopsis thaliana [mouse-ear cress]
gb|ADE77794.1|  unknown                                                 250   5e-80    Picea sitchensis
ref|XP_007036157.1|  Ubiquitin-conjugating enzyme E2 5 isoform 3        249   8e-80    
ref|XP_008438029.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    248   1e-79    Cucumis melo [Oriental melon]
ref|XP_006295061.1|  hypothetical protein CARUB_v10024128mg             248   1e-79    
ref|XP_002955388.1|  hypothetical protein VOLCADRAFT_65865              250   1e-79    Volvox carteri f. nagariensis
gb|KIZ01797.1|  ubiquitin-conjugating enzyme E2 H                       249   1e-79    Monoraphidium neglectum
gb|KFH71855.1|  ubiquitin-conjugating enzyme E2 8                       248   2e-79    Mortierella verticillata NRRL 6337
gb|ESA07486.1|  hypothetical protein GLOINDRAFT_349458                  248   2e-79    
emb|CDH55830.1|  ubiquitin-conjugating enzyme e2 8                      248   2e-79    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007382143.1|  hypothetical protein PUNSTDRAFT_119552             248   3e-79    Punctularia strigosozonata HHB-11173 SS5
ref|XP_007880708.1|  hypothetical protein PFL1_04988                    248   4e-79    Anthracocystis flocculosa PF-1
ref|XP_006446454.1|  hypothetical protein CICLE_v10018163mg             247   5e-79    Citrus clementina [clementine]
gb|KJB52142.1|  hypothetical protein B456_008G248000                    246   8e-79    Gossypium raimondii
ref|XP_006470380.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    247   8e-79    Citrus sinensis [apfelsine]
ref|XP_011389494.1|  putative E2 ubiquitin-conjugating protein          247   9e-79    Ustilago maydis 521
emb|CBQ73369.1|  probable ubiquitin-conjugating enzyme e2-23 kda        247   1e-78    Sporisorium reilianum SRZ2
gb|KDN40970.1|  putative ubiquitin-conjugating enzyme e2-23 kda         246   1e-78    Tilletiaria anomala UBC 951
emb|CDI53810.1|  probable ubiquitin-conjugating enzyme e2-23 kda        246   1e-78    Melanopsichium pennsylvanicum 4
ref|XP_010913552.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    246   2e-78    Elaeis guineensis
emb|CCF52557.1|  probable ubiquitin-conjugating enzyme e2-23 kda        246   2e-78    Ustilago hordei
emb|CDS09344.1|  Putative Ubiquitin-conjugating enzyme E2 8             246   2e-78    Lichtheimia ramosa
ref|XP_001906091.1|  hypothetical protein                               246   2e-78    Podospora anserina S mat+
gb|KDE04596.1|  ubiquitin-conjugating enzyme E2 8                       245   4e-78    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_011396851.1|  Ubiquitin-conjugating enzyme E2 5                  246   4e-78    Auxenochlorella protothecoides
gb|EMS19964.1|  ubiquitin-conjugating enzyme E2 H                       245   4e-78    
gb|EST05256.1|  ubiquitin-protein ligase                                246   5e-78    
ref|XP_009854632.1|  hypothetical protein NEUTE1DRAFT_96207             245   6e-78    
emb|CDX95675.1|  BnaC03g25560D                                          244   9e-78    
dbj|GAC97554.1|  ubiquitin-conjugating enzyme                           244   9e-78    
ref|XP_010913547.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    245   1e-77    
ref|XP_009381639.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    243   2e-77    
dbj|GAK65778.1|  ubiquitin-conjugating enzyme E2 8                      243   2e-77    
dbj|GAM89738.1|  hypothetical protein ANO11243_077770                   243   2e-77    
ref|XP_001690015.1|  ubiquitin conjugating enzyme E2                    243   3e-77    
dbj|GAA95767.1|  hypothetical protein E5Q_02424                         243   3e-77    
ref|XP_010913546.1|  PREDICTED: ubiquitin-conjugating enzyme E2 5...    244   3e-77    
ref|XP_007268439.1|  hypothetical protein FOMMEDRAFT_125850             243   4e-77    
ref|XP_005716365.1|  Ubiquitin-conjugating enzyme, E2                   243   4e-77    
ref|XP_007405457.1|  hypothetical protein MELLADRAFT_41986              243   4e-77    
dbj|GAC76043.1|  ubiquitin-protein ligase                               247   4e-77    
ref|XP_002493011.1|  Ubiquitin-conjugating enzyme that negatively...    243   5e-77    
ref|XP_503847.2|  YALI0E12081p                                          242   5e-77    
ref|XP_005536164.1|  probable ubiquitin conjugating enzyme E2           244   5e-77    
ref|XP_003650501.1|  hypothetical protein THITE_164359                  243   5e-77    
gb|KDQ21024.1|  hypothetical protein BOTBODRAFT_27040                   242   5e-77    
dbj|GAN04128.1|  ubiquitin carrier protein                              242   8e-77    
gb|EPB85018.1|  ubiquitin-conjugating enzyme E2 8                       242   8e-77    
ref|XP_010663198.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    241   8e-77    
gb|EGU78302.1|  hypothetical protein FOXB_11163                         242   9e-77    
ref|XP_007786132.1|  Ubiquitin-conjugating enzyme E2 8                  242   1e-76    
emb|CEP12098.1|  hypothetical protein                                   241   1e-76    
ref|XP_004347903.1|  ubiquitin-protein ligase                           241   2e-76    
ref|XP_007672937.1|  hypothetical protein BAUCODRAFT_30071              241   2e-76    
gb|EXX79120.1|  E2 ubiquitin-conjugating protein UBC8                   240   2e-76    
gb|KEQ87270.1|  hypothetical protein M438DRAFT_343637                   241   2e-76    
ref|XP_008034846.1|  hypothetical protein TRAVEDRAFT_27362              241   2e-76    
ref|XP_005707261.1|  ubiquitin-conjugating enzyme E2                    241   2e-76    
emb|CAA73327.1|  ubiquitin-conjugating enzyme type E2                   241   3e-76    
ref|NP_596617.1|  ubiquitin conjugating enzyme Ubc8 (predicted)         241   3e-76    
gb|EIE82645.1|  ubiquitin-conjugating enzyme E2 8                       240   3e-76    
ref|XP_003664159.1|  hypothetical protein MYCTH_2111167                 241   3e-76    
gb|EME49711.1|  hypothetical protein DOTSEDRAFT_40871                   240   5e-76    
gb|KDR83726.1|  hypothetical protein GALMADRAFT_236073                  239   5e-76    
gb|KIP10616.1|  hypothetical protein PHLGIDRAFT_84895                   239   7e-76    
ref|XP_001876684.1|  predicted protein                                  239   8e-76    
gb|KIK06689.1|  hypothetical protein K443DRAFT_247023                   239   8e-76    
ref|XP_004366442.1|  Putative E2                                        239   9e-76    
gb|KIV91990.1|  ubiquitin-conjugating enzyme E2 8                       239   1e-75    
ref|XP_007366093.1|  hypothetical protein DICSQDRAFT_86817              239   1e-75    
gb|KEF51743.1|  ubiquitin-conjugating enzyme E2 8                       239   1e-75    
ref|XP_007391644.1|  hypothetical protein PHACADRAFT_249257             239   1e-75    
emb|CEG73548.1|  Putative Ubiquitin-conjugating enzyme E2 8             238   2e-75    
gb|KDQ28956.1|  hypothetical protein PLEOSDRAFT_61374                   238   2e-75    
gb|ETS00385.1|  ubiquitin-conjugating enzyme h                          238   2e-75    
ref|XP_007875589.1|  hypothetical protein PNEG_03497                    238   2e-75    
ref|XP_007920494.1|  hypothetical protein MYCFIDRAFT_76860              238   2e-75    
gb|KIM46172.1|  hypothetical protein M413DRAFT_441240                   238   2e-75    
gb|KIW45588.1|  ubiquitin-conjugating enzyme E2 8                       238   3e-75    
ref|XP_006694468.1|  putative ubiquitin carrier protein                 238   3e-75    
gb|KIW49095.1|  ubiquitin-conjugating enzyme E2 8                       238   3e-75    
ref|XP_007730641.1|  ubiquitin-conjugating enzyme E2 8                  238   3e-75    
ref|XP_009158176.1|  ubiquitin-conjugating enzyme E2 8                  238   3e-75    
gb|KII95190.1|  hypothetical protein PLICRDRAFT_205760                  238   4e-75    
gb|KIW16224.1|  ubiquitin-conjugating enzyme E2 8                       238   4e-75    
gb|KIX05777.1|  ubiquitin-conjugating enzyme E2 8                       238   4e-75    
gb|KIV80147.1|  ubiquitin-conjugating enzyme E2 8                       238   5e-75    
ref|XP_007742766.1|  ubiquitin-conjugating enzyme E2 8                  237   5e-75    
gb|KIW96198.1|  ubiquitin-conjugating enzyme E2 8                       237   6e-75    
gb|KIY00429.1|  ubiquitin-conjugating enzyme E2 8                       237   6e-75    
gb|EJU06180.1|  hypothetical protein DACRYDRAFT_19458                   237   7e-75    
ref|XP_007719409.1|  ubiquitin-conjugating enzyme E2 8                  237   7e-75    
ref|XP_010252951.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    236   8e-75    
gb|EFX01184.1|  ubiquitin-conjugating enzyme h                          236   1e-74    
gb|EPS95351.1|  hypothetical protein FOMPIDRAFT_1032934                 236   1e-74    
gb|EFA81552.1|  hypothetical protein PPL_05541                          236   1e-74    
gb|KIM90816.1|  hypothetical protein PILCRDRAFT_811304                  236   1e-74    
ref|XP_008718299.1|  ubiquitin-conjugating enzyme E2 8                  236   1e-74    
ref|XP_009267919.1|  Ubiquitin-conjugating enzyme E2 8                  243   2e-74    
gb|EPX71182.1|  ubiquitin conjugating enzyme Ubc8                       236   2e-74    
gb|KIY71413.1|  hypothetical protein CYLTODRAFT_418803                  235   3e-74    
ref|XP_007752403.1|  ubiquitin-conjugating enzyme E2 8                  235   4e-74    
gb|EMF16740.1|  ubiquitin-conjugating enzyme E2-21 kDa 2                235   5e-74    
ref|XP_005706624.1|  ubiquitin-conjugating enzyme E2                    235   6e-74    
ref|XP_008721807.1|  ubiquitin-conjugating enzyme E2 8                  234   7e-74    
gb|EPY53623.1|  ubiquitin conjugating enzyme Ubc8                       234   7e-74    
gb|KIJ56675.1|  hypothetical protein M422DRAFT_22830                    234   8e-74    
gb|KIY49232.1|  ubiquitin-conjugating enzyme E2 8                       234   1e-73    
ref|XP_001394668.2|  ubiquitin-conjugating enzyme E2 8                  234   1e-73    
emb|CAK96987.1|  unnamed protein product                                234   1e-73    
gb|KIL70043.1|  hypothetical protein M378DRAFT_599232                   233   1e-73    
ref|XP_002557642.1|  Pc12g08100                                         234   1e-73    
ref|XP_007862289.1|  ubiquitin--protein ligase                          233   2e-73    
gb|EXV05682.1|  ubiquitin-activating enzyme E2 family protein           233   2e-73    
ref|XP_001268055.1|  ubiquitin-conjugating enzyme h                     234   2e-73    
ref|XP_010252952.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    231   2e-73    
ref|XP_641236.1|  hypothetical protein DDB_G0280091                     233   2e-73    
gb|KIZ07239.1|  ubiquitin-conjugating enzyme E2 H                       233   2e-73    
gb|KIK68144.1|  hypothetical protein GYMLUDRAFT_36982                   232   4e-73    
gb|KIO30272.1|  hypothetical protein M407DRAFT_242293                   233   4e-73    
gb|KIK30702.1|  hypothetical protein PISMIDRAFT_306973                  232   4e-73    
ref|XP_010913551.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    232   6e-73    
dbj|GAM19728.1|  hypothetical protein SAMD00019534_029030               232   7e-73    
ref|XP_001837183.2|  ubiquitin-conjugating enzyme                       232   9e-73    
gb|KIK48892.1|  hypothetical protein CY34DRAFT_797682                   231   1e-72    
ref|XP_007773392.1|  ubiquitin-conjugating enzyme                       231   1e-72    
gb|KDQ64512.1|  hypothetical protein JAAARDRAFT_166836                  231   1e-72    
emb|CAA63316.1|  ubiquitin--protein ligase                              231   1e-72    
gb|AFR97603.1|  ubiquitin-conjugating enzyme E2 H                       233   2e-72    
gb|KIJ20034.1|  hypothetical protein PAXINDRAFT_67754                   231   2e-72    
gb|KIW49096.1|  ubiquitin-conjugating enzyme E2 8, variant              229   2e-72    
gb|KIK97150.1|  hypothetical protein PAXRUDRAFT_136890                  230   2e-72    
ref|XP_007338063.1|  hypothetical protein AURDEDRAFT_110494             231   2e-72    
emb|CDM35301.1|  Ubiquitin-conjugating enzyme E2 8                      230   2e-72    
gb|KIM67981.1|  hypothetical protein SCLCIDRAFT_1210133                 230   2e-72    
ref|XP_003065972.1|  Ubiquitin-conjugating enzyme E2-21 kDa 2 , p...    230   3e-72    
ref|XP_002172123.1|  ubiquitin conjugating enzyme Ubc8                  230   3e-72    
ref|XP_007002480.1|  hypothetical protein TREMEDRAFT_37661              232   3e-72    
ref|XP_003298790.1|  hypothetical protein PTT_09607                     231   3e-72    
gb|KIO12969.1|  hypothetical protein M404DRAFT_703782                   230   3e-72    
ref|XP_007303039.1|  ubiquitin-conjugating enzyme                       230   4e-72    
ref|XP_007844616.1|  ubiquitin-conjugating enzyme h                     236   4e-72    
gb|KGO72464.1|  Ubiquitin-conjugating enzyme, E2                        231   4e-72    
ref|XP_010247939.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    229   4e-72    
gb|KDP25854.1|  hypothetical protein JCGZ_22884                         229   7e-72    
gb|ESX01162.1|  Ubiquitin-conjugating enzyme E2 8                       229   7e-72    
gb|KEQ61405.1|  hypothetical protein M437DRAFT_85856                    229   8e-72    
ref|XP_001773359.1|  predicted protein                                  228   8e-72    
gb|EMT17761.1|  Ubiquitin-conjugating enzyme E2 5                       231   1e-71    
gb|EHK48290.1|  hypothetical protein TRIATDRAFT_146505                  229   1e-71    
ref|XP_002797359.1|  ubiquitin-conjugating enzyme                       228   2e-71    
ref|XP_003324644.2|  ubiquitin-conjugating enzyme E2 8                  228   2e-71    
gb|KIW78814.1|  hypothetical protein Z517_08653                         229   2e-71    
gb|KIJ70547.1|  hypothetical protein HYDPIDRAFT_78736                   228   2e-71    
gb|KIH90221.1|  ubiquitin-conjugating enzyme E2 H                       228   2e-71    
ref|XP_003852932.1|  hypothetical protein MYCGRDRAFT_70925              228   3e-71    
gb|EXX79122.1|  E2 ubiquitin-conjugating protein UBC8                   226   5e-71    
ref|XP_008599556.1|  ubiquitin-conjugating enzyme                       227   7e-71    
ref|XP_009543669.1|  hypothetical protein HETIRDRAFT_425501             226   7e-71    
ref|XP_006669273.1|  Ubiquitin-conjugating enzyme                       227   1e-70    
gb|KFY77199.1|  hypothetical protein V499_03362                         227   1e-70    
gb|EMS49462.1|  Ubiquitin-conjugating enzyme E2 5                       225   1e-70    
emb|CEJ91747.1|  Putative Ubiquitin-conjugating enzyme                  226   2e-70    
ref|XP_009649614.1|  ubiquitin-conjugating enzyme                       226   2e-70    
ref|XP_007684347.1|  hypothetical protein COCMIDRAFT_85460              225   2e-70    
gb|EUN27589.1|  hypothetical protein COCVIDRAFT_37296                   225   2e-70    
emb|CCO26476.1|  ubiquitin-conjugating enzyme E2 H                      225   3e-70    
ref|XP_006955762.1|  hypothetical protein WALSEDRAFT_59010              225   3e-70    
ref|XP_003036455.1|  ubiquitin-conjugating-protein                      225   3e-70    
gb|KHE87499.1|  hypothetical protein GE21DRAFT_1305975                  224   3e-70    
gb|KEP50321.1|  ubiquitin-conjugating enzyme E2                         224   3e-70    
ref|XP_001383392.1|  hypothetical protein PICST_57900                   225   3e-70    
ref|XP_005824619.1|  hypothetical protein GUITHDRAFT_158581             225   4e-70    
gb|ETS62102.1|  hypothetical protein PaG_03662                          229   5e-70    
ref|XP_004341551.1|  ubiquitinprotein ligase                            224   6e-70    
gb|KEH18845.1|  ubiquitin-conjugating enzyme                            223   8e-70    
gb|EJT52901.1|  ubiquitin-conjugating enzyme                            226   8e-70    
gb|KDO66251.1|  hypothetical protein CISIN_1g030996mg                   223   1e-69    
ref|XP_003001904.1|  ubiquitin-conjugating enzyme                       224   1e-69    
ref|XP_010940569.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    221   2e-69    
ref|XP_010940568.1|  PREDICTED: ubiquitin-conjugating enzyme E2 4...    221   4e-69    
ref|XP_007315619.1|  hypothetical protein SERLADRAFT_367087             222   4e-69    
gb|KEQ74345.1|  ubiquitin-conjugating enzyme                            223   4e-69    
ref|XP_003867944.1|  Ubc8 protein                                       222   6e-69    
ref|XP_001931954.1|  ubiquitin-conjugating enzyme E2 H                  221   6e-69    
ref|XP_457242.2|  DEHA2B06512p                                          222   7e-69    
ref|XP_008681159.1|  PREDICTED: uncharacterized protein LOC100193...    222   8e-69    
emb|CCE40645.1|  hypothetical protein CPAR2_106800                      221   1e-68    
emb|CCK71601.1|  hypothetical protein KNAG_0H01870                      222   1e-68    
ref|XP_008438030.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...    220   2e-68    
ref|XP_007783473.1|  ubiquitin-conjugating enzyme E2 H                  222   2e-68    
ref|XP_002550291.1|  ubiquitin-conjugating enzyme E2-21 kDa 2           221   2e-68    
emb|CEP62236.1|  LALA0S05e00914g1_1                                     223   2e-68    
ref|XP_712965.1|  hypothetical protein CaO19.4540                       221   2e-68    
ref|XP_003349160.1|  hypothetical protein SMAC_06996                    220   2e-68    
ref|XP_002416842.1|  ubiquitin carrier protein, putative; ubiquit...    220   2e-68    
gb|EMG46831.1|  Ubiquitin carrier protein                               220   4e-68    
ref|XP_003294949.1|  hypothetical protein DICPUDRAFT_44157              219   4e-68    
gb|KDD74288.1|  ubiquitin-conjugating enzyme                            220   5e-68    
ref|XP_006684658.1|  hypothetical protein CANTEDRAFT_112946             219   5e-68    
ref|XP_009494520.1|  ubiquitin-conjugating enzyme E2 H, variant         221   5e-68    
gb|EUC57754.1|  ubiquitin-conjugating enzyme E2                         219   5e-68    
ref|XP_004194772.1|  Piso0_005288                                       219   7e-68    
ref|XP_008901421.1|  hypothetical protein, variant 1                    218   8e-68    
gb|EMR85631.1|  putative ubiquitin-conjugating enzyme protein           219   9e-68    
ref|XP_002909127.1|  ubiquitin-conjugating enzyme E2, putative          218   1e-67    
emb|CCM02495.1|  predicted protein                                      218   1e-67    
ref|XP_009529493.1|  hypothetical protein PHYSODRAFT_354813             218   1e-67    
ref|XP_001744316.1|  hypothetical protein                               218   1e-67    
ref|XP_009261095.1|  hypothetical protein FPSE_09703                    219   1e-67    
gb|EJY82170.1|  Ubiquitin-conjugating enzyme E2, putative               219   2e-67    
ref|XP_007372314.1|  hypothetical protein SPAPADRAFT_58026              218   2e-67    
ref|WP_028830608.1|  hypothetical protein                               219   2e-67    
gb|KFY79713.1|  hypothetical protein V498_08924                         218   3e-67    
ref|XP_750804.2|  ubiquitin conjugating enzyme Ubc8                     218   3e-67    
gb|EAS35834.3|  ubiquitin-conjugating enzyme E2 8                       217   3e-67    
ref|XP_567303.1|  hypothetical protein CNJ00500                         219   3e-67    
ref|XP_003958840.1|  hypothetical protein KAFR_0H02960                  218   3e-67    
emb|CCD49367.1|  similar to ubiquitin-conjugating enzyme                218   5e-67    
dbj|GAA22813.1|  K7_Ubc8p                                               218   6e-67    
gb|KFY45963.1|  hypothetical protein V494_00683                         216   1e-66    
ref|XP_004195863.1|  Piso0_005288                                       216   1e-66    
ref|XP_003688495.1|  hypothetical protein TPHA_0O00920                  217   1e-66    
gb|KGO41002.1|  Ubiquitin-conjugating enzyme, E2                        216   1e-66    
ref|XP_001526758.1|  ubiquitin-conjugating enzyme E2-21 kDa 2           216   2e-66    
emb|CBJ32978.1|  ubiquitin-conjugating enzyme type E2                   219   2e-66    
gb|EGE03752.1|  ubiquitin-conjugating enzyme h                          215   2e-66    
gb|EER41594.1|  ubiquitin-conjugating enzyme E2                         214   3e-66    
ref|NP_010904.2|  E2 ubiquitin-conjugating protein UBC8                 216   3e-66    
gb|EGE77566.1|  ubiquitin carrier protein                               215   3e-66    
gb|EHN02811.1|  Ubc8p                                                   217   3e-66    
ref|XP_001644268.1|  hypothetical protein Kpol_1030p18                  216   4e-66    
emb|CDI81712.1|  ubiquitin-conjugating enzyme e2, putative              215   4e-66    
ref|XP_451487.1|  hypothetical protein                                  215   4e-66    
gb|KDB24337.1|  hypothetical protein H109_03782                         214   5e-66    
gb|EYE92129.1|  hypothetical protein EURHEDRAFT_415841                  214   8e-66    
gb|KID93058.1|  ubiquitin-conjugating enzyme h                          214   8e-66    
ref|XP_001258033.1|  ubiquitin-conjugating enzyme h                     213   9e-66    
ref|XP_002499103.1|  ZYRO0E03806p                                       214   9e-66    
ref|XP_001487396.1|  hypothetical protein PGUG_00773                    214   1e-65    
gb|KFZ23369.1|  hypothetical protein V502_02145                         214   1e-65    
ref|XP_007913483.1|  putative ubiquitin-conjugating enzyme protein      213   1e-65    
gb|EFQ33524.1|  ubiquitin-conjugating enzyme                            213   1e-65    
ref|XP_449495.1|  hypothetical protein                                  214   1e-65    
gb|EKV12518.1|  Ubiquitin carrier protein                               213   2e-65    
ref|XP_002541614.1|  ubiquitin-conjugating enzyme E2-23 kDa             213   2e-65    



>ref|XP_011080934.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Sesamum indicum]
Length=183

 Score =   322 bits (824),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPK+SPYQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKDSPYQGGVWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAA+MMRDR AYEQRVKE+CEKYAK  DAG AP+EKSSD+E+SEDEY SSD+E+AGK
Sbjct  121  NGEAAAMMMRDRNAYEQRVKEYCEKYAKPEDAGAAPDEKSSDEELSEDEYGSSDDEVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_011072993.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Sesamum indicum]
Length=183

 Score =   320 bits (819),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/183 (93%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMM+DYKVE INDGMQEFYVEFHGPKESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVETINDGMQEFYVEFHGPKESPYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR+AYEQRVKE+CEKYAK  DAGVA EEKSSD+E++EDEYASSD+EIAGK
Sbjct  121  NGEAAALMMRDRSAYEQRVKEYCEKYAKPEDAGVAGEEKSSDEELTEDEYASSDDEIAGK  180

Query  140  ADP  132
             DP
Sbjct  181  VDP  183



>gb|KDP25412.1| hypothetical protein JCGZ_20568 [Jatropha curcas]
Length=183

 Score =   318 bits (816),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYVEF+GPK+SPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVEFNGPKDSPYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR+AYEQRVKE+CEKYAKA D G  PEEKSSD+E+S+D+YAS D+++AGK
Sbjct  121  NGEAAALMMRDRSAYEQRVKEYCEKYAKAEDIGAKPEEKSSDEELSDDDYASEDDQVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_010089080.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
 gb|EXB37327.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
Length=183

 Score =   318 bits (815),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 168/183 (92%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKESPY+GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESPYEGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRT YEQRVKE+CEKYAK+ D G A EEKSSD+E+SEDEYASSDE +AGK
Sbjct  121  NGEAAALMMRDRTTYEQRVKEYCEKYAKSEDIGAAEEEKSSDEELSEDEYASSDEGMAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>gb|EYU38331.1| hypothetical protein MIMGU_mgv1a014569mg [Erythranthe guttata]
Length=185

 Score =   318 bits (814),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 177/185 (96%), Gaps = 2/185 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMM+DYKVEMINDGMQEF+VEFHGPKESPYQ GVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVEMINDGMQEFFVEFHGPKESPYQEGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsede--yassdeEIA  147
            NG+AAALMMRDRTAY+Q+VKE+CEKYAKA DAGVAPEEKSSD+E   ++   ASSDEE+A
Sbjct  121  NGDAAALMMRDRTAYDQKVKEYCEKYAKAEDAGVAPEEKSSDEEELTEDEYAASSDEEVA  180

Query  146  GKADP  132
            GKADP
Sbjct  181  GKADP  185



>ref|XP_002509830.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF51217.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=183

 Score =   317 bits (812),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYVEF+GPK+SPYQGG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVEFNGPKDSPYQGGLWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRTAYEQRVKE+CEKYAK  D GV PEEKSSD+E+S+D+Y S DE++AGK
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCEKYAKPEDVGVKPEEKSSDEELSDDDYGSEDEQVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>emb|CDP12044.1| unnamed protein product [Coffea canephora]
Length=184

 Score =   315 bits (807),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 175/184 (95%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPK+SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKDSPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedey-assdeEIAG  144
            NGEAAALMMRDR  YEQRVKE+CEKYAK  DAG AP EKSSD+E+SEDEY +S DEE+AG
Sbjct  121  NGEAAALMMRDRNTYEQRVKEYCEKYAKPEDAGAAPAEKSSDEELSEDEYPSSDDEEVAG  180

Query  143  KADP  132
            KADP
Sbjct  181  KADP  184



>ref|XP_009790425.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Nicotiana 
sylvestris]
Length=183

 Score =   315 bits (806),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMM+DYKVEMINDGMQEFYVEFHGPKESPYQGGVW+VRVELPD YP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVEMINDGMQEFYVEFHGPKESPYQGGVWKVRVELPDVYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+N+IYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINRIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRT Y+QRVKE+CEKYAK+ DAG  PEEKSSD+EVSE+EYASSDEE+AGK
Sbjct  121  NGEAAALMMRDRTTYDQRVKEYCEKYAKSEDAGAVPEEKSSDEEVSEEEYASSDEEVAGK  180

Query  140  AD  135
            AD
Sbjct  181  AD  182



>ref|XP_006343959.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Solanum tuberosum]
Length=183

 Score =   314 bits (804),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEFHGPKESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFHGPKESPYLGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRT Y+QRVKE+CEKYAK  DAG  PEEKSSD+E+SE+E  SSD+E+AGK
Sbjct  121  NGEAAALMMRDRTTYDQRVKEYCEKYAKKEDAGAPPEEKSSDEELSEEENVSSDDEVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_009592682.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Nicotiana 
tomentosiformis]
Length=183

 Score =   314 bits (804),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMM+DYKVEMINDGMQEFYVEFHGPKESPYQGGVW+VRV LPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMTDYKVEMINDGMQEFYVEFHGPKESPYQGGVWKVRVGLPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVN+IYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNRIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRT Y+QRVKE+CEKYAK+ DAG  PEEKSSD+E SE+EYASSDEE+AGK
Sbjct  121  NGEAAALMMRDRTTYDQRVKEYCEKYAKSEDAGAVPEEKSSDEEGSEEEYASSDEEVAGK  180

Query  140  AD  135
            AD
Sbjct  181  AD  182



>ref|XP_010670105.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Beta 
vulgaris subsp. vulgaris]
Length=183

 Score =   313 bits (803),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPSESPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NK+YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQRVKE+CEKYAK  DAG  PEE +S++E+S+DEYASSDE + G+
Sbjct  121  NGEAAALMMRDRAAYEQRVKEYCEKYAKPEDAGAVPEENTSEEELSDDEYASSDEAMVGE  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_007135093.1| hypothetical protein PHAVU_010G100200g [Phaseolus vulgaris]
 gb|ESW07087.1| hypothetical protein PHAVU_010G100200g [Phaseolus vulgaris]
Length=183

 Score =   313 bits (803),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAAL+MRDRT+YEQRVKE+CEKYAK  D G A EE+SSD+E+SEDEY SSDE++AGK
Sbjct  121  NGEAAALLMRDRTSYEQRVKEYCEKYAKPEDIGAATEEQSSDEELSEDEYDSSDEQVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_009375015.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Pyrus 
x bretschneideri]
Length=183

 Score =   313 bits (803),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+F GPKESPYQ GVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFKGPKESPYQEGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRTAY+QRVKE+CEKYAK  D G APEE+SSD+E+SEDEY S D+ +AG+
Sbjct  121  NGEAAALMMRDRTAYDQRVKEYCEKYAKEEDVGGAPEEQSSDEELSEDEYDSGDDAVAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_010055667.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Eucalyptus 
grandis]
Length=183

 Score =   313 bits (802),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPK+SPYQGG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKDSPYQGGLWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPADPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAA+MMRDR AYEQRVKE+CEKYAK  D G A E+KSSD+E+SED+Y SSD+E+AGK
Sbjct  121  NGEAAAIMMRDRGAYEQRVKEYCEKYAKPEDVGAAGEDKSSDEELSEDDYGSSDDEVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_011029312.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Populus euphratica]
Length=212

 Score =   314 bits (804),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -3

Query  725  IQEFEGERTRK*KVIMSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQ  546
             Q+   +R +K    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQ
Sbjct  15   FQQSARKRQKKEGAKMSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESLYQ  74

Query  545  GGVWRVRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEV  366
            GGVWR+RVELPDAYPYKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEV
Sbjct  75   GGVWRIRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEV  134

Query  365  FLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddev  186
            FLPQLLLYPN SDPLNGEAAALMMRD T Y+QRVKE+CEKYAK  D G  PEEKSSD+E+
Sbjct  135  FLPQLLLYPNASDPLNGEAAALMMRDHTGYDQRVKEYCEKYAKPEDIGAKPEEKSSDEEM  194

Query  185  sedeyassdeEIAGKADP  132
            S D+Y S D+++AGKADP
Sbjct  195  SADDYNSDDDQVAGKADP  212



>ref|XP_007218489.1| hypothetical protein PRUPE_ppa012120mg [Prunus persica]
 gb|EMJ19688.1| hypothetical protein PRUPE_ppa012120mg [Prunus persica]
Length=183

 Score =   313 bits (801),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV+FHGP ESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFYVDFHGPSESPYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQRVKEFC+KYAK  D G  PE+KSSD+E+SEDE  S D+++AG+
Sbjct  121  NGEAAALMMRDRAAYEQRVKEFCQKYAKPEDIGAVPEDKSSDEELSEDESDSCDDQVAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_007040285.1| Ubiquitin-conjugating enzyme 5 [Theobroma cacao]
 gb|EOY24786.1| Ubiquitin-conjugating enzyme 5 [Theobroma cacao]
Length=184

 Score =   313 bits (801),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/184 (92%), Positives = 175/184 (95%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKESPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESPYHGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsede-yassdeEIAG  144
            NGEAAALMMRDRTAYEQRVKE+CEKYAK  D G APEEKSSD+E+SEDE  AS DEEIAG
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCEKYAKPEDVGAAPEEKSSDEELSEDEYAASDDEEIAG  180

Query  143  KADP  132
            K DP
Sbjct  181  KPDP  184



>ref|XP_004245589.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Solanum lycopersicum]
Length=183

 Score =   312 bits (800),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEFHGPKESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFHGPKESPYLGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRT Y+Q+VKE+CEKYAK  DAG  PEEKSSD+E+SE+E  SSD+E+AGK
Sbjct  121  NGEAAALMMRDRTTYDQKVKEYCEKYAKKEDAGAPPEEKSSDEELSEEENVSSDDELAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Vitis vinifera]
 ref|XP_010661801.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Vitis vinifera]
 emb|CAN74060.1| hypothetical protein VITISV_024680 [Vitis vinifera]
 emb|CBI40397.3| unnamed protein product [Vitis vinifera]
Length=184

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 170/184 (92%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSDSPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedey-assdeEIAG  144
            NGEAAALMMRDRTAYEQRVKE+CEKYAK  D G APEEKSSD+E   ++   SSDE +AG
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCEKYAKPEDVGAAPEEKSSDEEELSEDDYDSSDEAVAG  180

Query  143  KADP  132
            +ADP
Sbjct  181  QADP  184



>ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max]
 gb|AAF03236.1|AF180143_1 ubiquitin carrier protein 4 [Glycine max]
 gb|KHN26954.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   312 bits (799),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR  YEQRVKE+CEKYAK  D G A EE SSD+E++EDEY SSDE++AGK
Sbjct  121  NGEAAALMMRDRATYEQRVKEYCEKYAKPEDIGAATEENSSDEELTEDEYDSSDEQVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_008233026.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Prunus mume]
Length=183

 Score =   312 bits (799),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV+FHGP ESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFYVDFHGPSESPYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAA+MMRDR AYEQRVKEFC+KYAK  D G  PE+KSSD+E+SEDE  S D+++AG+
Sbjct  121  NGEAAAMMMRDRAAYEQRVKEFCQKYAKPEDIGAVPEDKSSDEELSEDESDSCDDQVAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Glycine max]
Length=183

 Score =   312 bits (799),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR  YEQRVKE+CEKYAK  D G A EE SSD+E+SEDEY SSDE++AGK
Sbjct  121  NGEAAALMMRDRATYEQRVKEYCEKYAKPEDIGAATEENSSDEELSEDEYDSSDEQVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_007209658.1| hypothetical protein PRUPE_ppa012080mg [Prunus persica]
 ref|XP_008238927.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Prunus mume]
 gb|EMJ10857.1| hypothetical protein PRUPE_ppa012080mg [Prunus persica]
Length=184

 Score =   311 bits (797),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 173/184 (94%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+F+GPKESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPKESPYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedey-assdeEIAG  144
            NGEAAALMMRDR+AYEQRVKE+CEKYAK  D G APEEKSSDDE   ++   SSD+ +AG
Sbjct  121  NGEAAALMMRDRSAYEQRVKEYCEKYAKPEDIGGAPEEKSSDDEDLSEDEYDSSDDAVAG  180

Query  143  KADP  132
            +ADP
Sbjct  181  QADP  184



>ref|XP_011092673.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Sesamum indicum]
Length=183

 Score =   311 bits (796),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP +SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTDSPYHGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYE RV+E+CEKYAKA DAG APEEKSSD+E+SEDEY SSDE + GK
Sbjct  121  NGEAAALMMRDRGAYEHRVREYCEKYAKAEDAGAAPEEKSSDEELSEDEYDSSDEAVVGK  180

Query  140  ADP  132
             DP
Sbjct  181  VDP  183



>ref|XP_002279927.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 isoform X1 [Vitis 
vinifera]
 emb|CAN60588.1| hypothetical protein VITISV_023123 [Vitis vinifera]
 emb|CBI34362.3| unnamed protein product [Vitis vinifera]
Length=183

 Score =   310 bits (795),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV+FHGP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPGDSPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQRVKE+CEKYAK  + G APEEKSSD+E+SED Y SSDE +AG+
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPENIGAAPEEKSSDEELSEDNYESSDEAVAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>gb|KHF98807.1| Ubiquitin-conjugating enzyme E2 5 -like protein [Gossypium arboreum]
Length=184

 Score =   310 bits (794),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 175/184 (95%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPK+SPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSPYHGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsede-yassdeEIAG  144
            NGEAAALMMRDRT+YEQRVKE+CEKYAK  D G  PEEKSSD+E+S+DE  AS DEEIAG
Sbjct  121  NGEAAALMMRDRTSYEQRVKEYCEKYAKPEDIGAVPEEKSSDEELSDDEYAASDDEEIAG  180

Query  143  KADP  132
            KADP
Sbjct  181  KADP  184



>ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF50552.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=183

 Score =   310 bits (793),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNDSPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQRVKE+CEKYAK  D G A EEKSSD+EVS+DEY S DEE+AG+
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAKPEDIGAATEEKSSDEEVSDDEYDSQDEEMAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_002298025.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
 gb|ABK95388.1| unknown [Populus trichocarpa]
 gb|EEE82830.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
Length=183

 Score =   309 bits (791),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRD TAY+QRVKE+CEKYAK  D G  PEEKSSD+E+SED+Y S D+++AGK
Sbjct  121  NGEAAALMMRDHTAYDQRVKEYCEKYAKPEDIGAKPEEKSSDEELSEDDYNSDDDQVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_010275657.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Nelumbo nucifera]
Length=183

 Score =   308 bits (789),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+F+GP +SPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPSDSPYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFV KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRTAYEQRVKE+CEKYAK  + G A E++SSD+E+SEDEYASSDE +AG 
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCEKYAKPENVGAAVEDQSSDEELSEDEYASSDEGVAGH  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_004306758.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Fragaria vesca 
subsp. vesca]
Length=183

 Score =   308 bits (789),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV+FHGP ESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFYVDFHGPSESPYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR +YEQRVKE+C KYAK  D G  PE+KSSD+E+SE+E  S D+++AG+
Sbjct  121  NGEAAALMMRDRASYEQRVKEYCLKYAKPEDIGAVPEDKSSDEELSENESDSCDDQVAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_011023305.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Populus euphratica]
 gb|ABK96745.1| unknown [Populus trichocarpa x Populus deltoides]
Length=183

 Score =   308 bits (789),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVE+INDGMQEFYV F+GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRD+ AYEQRVKE+CEKYAK  D G APEEKSSD+E+SEDEY S D+E+AG+
Sbjct  121  NGEAAALMMRDKPAYEQRVKEYCEKYAKPEDIGAAPEEKSSDEELSEDEYESLDDEMAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Glycine max]
 gb|KHM99359.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   308 bits (788),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGP +SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR +YEQRVKE+CEKYAK  D G A EEKSSD+E+SEDEY SSDE++ GK
Sbjct  121  NGEAAALMMRDRPSYEQRVKEYCEKYAKPEDIGEATEEKSSDEEMSEDEYDSSDEQVVGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>gb|KDP28606.1| hypothetical protein JCGZ_14377 [Jatropha curcas]
Length=183

 Score =   308 bits (788),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKV++IND MQEFYV FHGP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDIINDDMQEFYVHFHGPNESPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRTAYEQRVKE+CEKYAK  D G A EEK SD+E++EDEY S DEE+AG+
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCEKYAKPEDIGAAEEEKCSDEELTEDEYESHDEEMAGE  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_004143895.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 ref|XP_004169019.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 ref|XP_008437307.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Cucumis melo]
 gb|KGN50082.1| hypothetical protein Csa_5G152970 [Cucumis sativus]
Length=183

 Score =   308 bits (788),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVE IND MQEFYV+FHGPK+S YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETINDSMQEFYVDFHGPKDSLYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAA+MMRDRTAYEQRVKE+CEKYAK  D G  PEEKSSD+E+SED+Y+S DE +AG+
Sbjct  121  NGEAAAVMMRDRTAYEQRVKEYCEKYAKPEDIGAVPEEKSSDEELSEDDYSSGDEAMAGQ  180

Query  140  AD  135
            AD
Sbjct  181  AD  182



>ref|XP_009349265.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Pyrus 
x bretschneideri]
Length=183

 Score =   307 bits (787),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGM EFYV+FHGP +S YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNK+YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQRVKEFC KYAKA D G APEE+SSD+E+S+ E  S D+++AG+
Sbjct  121  NGEAAALMMRDRPAYEQRVKEFCLKYAKAEDIGAAPEEESSDEEMSDAESDSCDDQVAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_007139813.1| hypothetical protein PHAVU_008G060900g [Phaseolus vulgaris]
 gb|ESW11807.1| hypothetical protein PHAVU_008G060900g [Phaseolus vulgaris]
Length=183

 Score =   307 bits (786),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPK+SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPKDSPYLGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR+AYE RVKE+CEKYAK  D G   EEKSSD+E+SEDEY SSDE++ GK
Sbjct  121  NGEAAALMMRDRSAYELRVKEYCEKYAKPEDIGEVTEEKSSDEEMSEDEYDSSDEQVVGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_002302592.2| ubiquitin carrier protein 4 [Populus trichocarpa]
 gb|EEE81865.2| ubiquitin carrier protein 4 [Populus trichocarpa]
Length=183

 Score =   306 bits (785),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVE+INDGMQEFYV F+GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRD+ AYEQRV+E+CEKYAK  D G APEEKSSD+E+SEDEY S D+E+AG+
Sbjct  121  NGEAAALMMRDKPAYEQRVEEYCEKYAKPEDIGAAPEEKSSDEELSEDEYESLDDEMAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_009626849.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
tomentosiformis]
Length=183

 Score =   306 bits (784),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKMKVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDL N+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLTNMFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRTAYEQRVKE+C+KYAK  D G APEEKSSD+E+SE EY S DEE+AG 
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCQKYAKPEDVGAAPEEKSSDEELSEAEYDSDDEEMAGP  180

Query  140  ADP  132
             DP
Sbjct  181  VDP  183



>ref|XP_006476536.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Citrus sinensis]
 gb|KDO76260.1| hypothetical protein CISIN_1g029962mg [Citrus sinensis]
Length=184

 Score =   306 bits (784),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESSYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVA  216
            NGEAAALMMRDRTAY+QRVKEFCEKYAK  D G A
Sbjct  121  NGEAAALMMRDRTAYDQRVKEFCEKYAKPEDIGGA  155



>ref|XP_007051764.1| Ubiquitin-conjugating enzyme E2 5 isoform 2 [Theobroma cacao]
 gb|EOX95921.1| Ubiquitin-conjugating enzyme E2 5 isoform 2 [Theobroma cacao]
Length=183

 Score =   306 bits (784),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMIND MQEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQRVKE+CEKYAK  D G APEEK+SD+E+S ++Y SSD+ +AG+
Sbjct  121  NGEAAALMMRDRGAYEQRVKEYCEKYAKPEDIGAAPEEKTSDEELSGEDYDSSDDAVAGQ  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>ref|XP_009628118.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Nicotiana tomentosiformis]
Length=183

 Score =   306 bits (783),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTESPYHGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAA+LMMRDR AYE RVKE+C+KYAK  D G APEEKSSD+E+SE EY S+D+ +AG 
Sbjct  121  NGEAASLMMRDRAAYELRVKEYCQKYAKPEDVGAAPEEKSSDEELSEAEYDSADDAVAGP  180

Query  140  ADP  132
             DP
Sbjct  181  VDP  183



>ref|XP_008342748.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
 ref|XP_008338824.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
Length=183

 Score =   306 bits (783),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGM EFYV+FHGP +S YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQRVKEFC KYAK  D G APEE+SSD+E+S+ E  S D+++AG+
Sbjct  121  NGEAAALMMRDRPAYEQRVKEFCLKYAKPEDIGAAPEEESSDEEMSDAESDSCDDQVAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_004510772.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Cicer 
arietinum]
Length=184

 Score =   306 bits (783),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP +SPYQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVIFHGPNDSPYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedey-assdeEIAG  144
            NGEAAALMMRDR  Y+QRVKE+CEKYAK  D G A EEKSSD+E   ++   SSDE++AG
Sbjct  121  NGEAAALMMRDRATYDQRVKEYCEKYAKPEDIGAATEEKSSDEEELTEDEYDSSDEQVAG  180

Query  143  KADP  132
            KADP
Sbjct  181  KADP  184



>ref|NP_001242818.1| uncharacterized protein LOC100805356 [Glycine max]
 gb|ACU13261.1| unknown [Glycine max]
Length=183

 Score =   305 bits (782),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGP +SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NK YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKFYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR +YEQRVKE+CEKYAK  D G A EEKSSD+E+SEDEY SSDE++ GK
Sbjct  121  NGEAAALMMRDRPSYEQRVKEYCEKYAKPEDIGEATEEKSSDEEMSEDEYDSSDEQVVGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>gb|KJB39652.1| hypothetical protein B456_007G023700 [Gossypium raimondii]
Length=184

 Score =   305 bits (782),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 167/184 (91%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPK+SPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSPYHGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGV-APeekssddevsedeyassdeEIAG  144
            NGEAAALMMRDR AYEQRVKE+CEKYAK  D G  A E+ S ++   ++  AS DEEIAG
Sbjct  121  NGEAAALMMRDRAAYEQRVKEYCEKYAKPEDIGAKAEEKSSDEELSEDEYAASDDEEIAG  180

Query  143  KADP  132
            K DP
Sbjct  181  KPDP  184



>gb|KDO86231.1| hypothetical protein CISIN_1g030092mg [Citrus sinensis]
Length=183

 Score =   305 bits (782),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFQGPNESPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPN+DEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNIDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAAL+MRDR AYEQRVKE+ EKYAKA D   AP+E SSD+E+SEDEY SSD+ +AGK
Sbjct  121  NGEAAALLMRDRAAYEQRVKEYREKYAKAEDIEAAPDENSSDEEMSEDEYNSSDDAMAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_002465854.1| hypothetical protein SORBIDRAFT_01g047040 [Sorghum bicolor]
 gb|EER92852.1| hypothetical protein SORBIDRAFT_01g047040 [Sorghum bicolor]
Length=183

 Score =   305 bits (782),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPNESIYQGGVWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NG+AAALMMRDR AYEQ+VKE+CEKYAK  DAGV PE+KSSD+E+SEDE  S DEEI GK
Sbjct  121  NGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVIPEDKSSDEELSEDENDSGDEEIMGK  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>gb|KEH18844.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=185

 Score =   305 bits (781),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 164/185 (89%), Gaps = 2/185 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPYQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSESPYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassde--EIA  147
            NGEAAALMMRDR  YEQRVKE+CEKYAK  D G A EEKSSD++    E        ++A
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAKPEDIGAATEEKSSDEDEELTEDEYDSSDEQVA  180

Query  146  GKADP  132
            GKADP
Sbjct  181  GKADP  185



>gb|AFK34026.1| unknown [Medicago truncatula]
Length=185

 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 164/185 (89%), Gaps = 2/185 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPYQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSESPYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassde--EIA  147
            NGEAAALMMRDR  YEQRVKE+CEKYAK  D G A EEKSSD++    E        ++A
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAKPEDLGAATEEKSSDEDEELTEDEYDSSDEQVA  180

Query  146  GKADP  132
            GKADP
Sbjct  181  GKADP  185



>ref|XP_010087938.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
 gb|EXB30860.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
Length=183

 Score =   305 bits (780),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPSDSPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQRVKE+ EKYAK  D G   ++KSSD+E+SEDE  S DE++ G+
Sbjct  121  NGEAAALMMRDRAAYEQRVKEYREKYAKPEDIGATAKDKSSDEELSEDESDSGDEQVVGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_010940566.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X3 
[Elaeis guineensis]
Length=184

 Score =   304 bits (779),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG  P
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGAPP  156



>ref|XP_009783359.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Nicotiana sylvestris]
Length=183

 Score =   304 bits (778),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+V+VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKVKVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDL NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLTNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRTAYEQ VKE+C+KYAK  D G A EEKSSD+E+SE EY S DEE+AG 
Sbjct  121  NGEAAALMMRDRTAYEQSVKEYCQKYAKPEDVGAAAEEKSSDEELSEAEYDSDDEEMAGP  180

Query  140  ADP  132
             DP
Sbjct  181  VDP  183



>ref|XP_006491142.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Citrus sinensis]
Length=183

 Score =   304 bits (778),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFQGPNESPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPN+DEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNIDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NG+AAAL+MRDR AYEQRVKE+ EKYAKA D   AP+E SSD+E+SEDEY SSD+ +AGK
Sbjct  121  NGDAAALLMRDRAAYEQRVKEYREKYAKAEDIEAAPDENSSDEEMSEDEYNSSDDAMAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_008779270.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Phoenix dactylifera]
Length=184

 Score =   304 bits (778),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKES YQGGVW++RVELP AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPGAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLINVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG +P
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPDDAGASP  156



>ref|XP_008801319.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Phoenix dactylifera]
Length=183

 Score =   303 bits (777),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV FHGP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVYFHGPNESLYQGGVWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVF+PQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFIPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG  PE+KSSD+E+SEDEY SSDE + G 
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGAPPEDKSSDEELSEDEYDSSDEAVVGN  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>ref|XP_010255296.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Nelumbo nucifera]
Length=183

 Score =   303 bits (777),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+V+F+GP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFHVDFNGPSDSPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NG+AAALMMRDR AYEQ+VKE+CEKYAK  D G A EEKSSD+E+SEDEYASSD+ +AG 
Sbjct  121  NGDAAALMMRDRAAYEQKVKEYCEKYAKPEDIGAAMEEKSSDEELSEDEYASSDDAVAGH  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_004229945.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Solanum lycopersicum]
Length=184

 Score =   303 bits (777),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAG-VAPeekssddevsedeyassdeEIAG  144
            NGEAAALMMRDR AYE RVKEFC+KYAK  D G  APEEKSSD+E+SE EY S+D+ +AG
Sbjct  121  NGEAAALMMRDRAAYELRVKEFCQKYAKPEDVGAAAPEEKSSDEELSEAEYDSADDAVAG  180

Query  143  KADP  132
              DP
Sbjct  181  PVDP  184



>ref|XP_006358673.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
tuberosum]
Length=183

 Score =   303 bits (777),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKIKVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NK+YHPNVDE+SGSVCLDVINQTWSPMFDL NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDEISGSVCLDVINQTWSPMFDLTNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRTAYEQRVKE+C+KYAK  D G  PEEKSSDDE+SE EY S DE +AG 
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCQKYAKPEDVGAVPEEKSSDDELSEAEYDSDDEAMAGP  180

Query  140  ADP  132
             DP
Sbjct  181  VDP  183



>ref|XP_004248050.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
lycopersicum]
Length=183

 Score =   303 bits (777),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKIKVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NK+YHPNVDE+SGSVCLDVINQTWSPMFDL NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDEISGSVCLDVINQTWSPMFDLTNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRTAYEQRVKE+C+KYAK  D G  PE+KSSD+E+SE EY S DE +AG 
Sbjct  121  NGEAAALMMRDRTAYEQRVKEYCQKYAKPEDVGAVPEDKSSDEELSEAEYDSDDEAMAGP  180

Query  140  ADP  132
             DP
Sbjct  181  VDP  183



>ref|XP_006661803.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Oryza brachyantha]
Length=183

 Score =   303 bits (777),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQ+VKE+CEKYAK  DAGV PE+KSSD+E+SEDE  S D+ I G 
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVTPEDKSSDEELSEDEDDSGDDAILGN  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>ref|XP_006827545.1| hypothetical protein AMTR_s00009p00214490 [Amborella trichopoda]
 gb|ERM94961.1| hypothetical protein AMTR_s00009p00214490 [Amborella trichopoda]
Length=183

 Score =   303 bits (776),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MDLMKLMMSDYKV+MINDGMQEFYV+FHGP ESPYQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVDMINDGMQEFYVDFHGPNESPYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF+LVNVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFELVNVFEVFLPQLLLYPNPTDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDRTAYEQRV+E+ EKYAK    GV P+EKSSD+E+S++EYASSDE  AG+
Sbjct  121  NGEAAALMMRDRTAYEQRVQEYKEKYAKPEHVGVNPDEKSSDEELSDEEYASSDEGFAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_008794268.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Phoenix dactylifera]
Length=183

 Score =   303 bits (775),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV+FHGP ES YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPNESLYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQ+VKE+CE+YAK  D G  PE+KSSD+E++EDEY SSDE + G 
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCERYAKPEDIGAPPEDKSSDEELTEDEYDSSDEAVVGN  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>ref|XP_006339599.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
tuberosum]
Length=184

 Score =   302 bits (774),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTESPYHGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAG-VAPeekssddevsedeyassdeEIAG  144
            NGEAAALMMRDR AY+ RVKEFC+KYAK  D G  APEEKSSD+E+SE EY S+D+ +AG
Sbjct  121  NGEAAALMMRDRAAYDLRVKEFCQKYAKPEDVGAAAPEEKSSDEELSEAEYDSADDAVAG  180

Query  143  KADP  132
              DP
Sbjct  181  PVDP  184



>ref|XP_004985701.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Setaria italica]
Length=183

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPNESIYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NG+AAALMMRDR AYEQ+VKE+CEKYAK  DAGV PE+KSSD+E+SE+E  S DEEI GK
Sbjct  121  NGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVVPEDKSSDEELSEEEDDSGDEEILGK  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>gb|ABB47726.2| Ubiquitin-conjugating enzyme E2-23 kDa, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EEC67067.1| hypothetical protein OsI_33825 [Oryza sativa Indica Group]
 gb|EEE51050.1| hypothetical protein OsJ_31710 [Oryza sativa Japonica Group]
Length=183

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQ+VKE+CEKYAK  DAGV PE+KSSD+E+SEDE  S D+ I G 
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVTPEDKSSDEELSEDEDDSGDDAILGN  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>ref|XP_011036629.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Populus euphratica]
Length=183

 Score =   301 bits (772),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVE+INDGMQEFYV F+GP ESPY GGVWR++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIKVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            Y+SPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVF+PQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFIPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRD+ AYE RVKE+CEKYAK  D G APEEKSSD+E+SEDEY S D+E+AG+
Sbjct  121  NGEAAALMMRDKPAYELRVKEYCEKYAKPEDIGAAPEEKSSDEELSEDEYESLDDEMAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_002320806.1| ubiquitin carrier protein 4 [Populus trichocarpa]
 gb|EEE99121.1| ubiquitin carrier protein 4 [Populus trichocarpa]
Length=183

 Score =   301 bits (772),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVE+INDGMQEFYV F+GP ESPY GGVWR++VELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVHFNGPNESPYHGGVWRIKVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            Y+SPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVF+PQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFIPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRD+ AYE RVKE+CEKYAK  D G APEE SSD+E+SEDEY S D+E+AG+
Sbjct  121  NGEAAALMMRDKPAYELRVKEYCEKYAKPEDIGAAPEENSSDEELSEDEYESLDDEMAGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_009791637.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Nicotiana 
sylvestris]
Length=183

 Score =   301 bits (772),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV F GP ESPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFLGPTESPYHGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAA+LMMRDR AYE RVKE+C+KYAK  D G APEEKSSD+E+SE EY S+D+ +AG 
Sbjct  121  NGEAASLMMRDRAAYELRVKEYCQKYAKPEDVGAAPEEKSSDEELSEAEYDSADDAVAGP  180

Query  140  ADP  132
             DP
Sbjct  181  VDP  183



>ref|NP_001132906.1| uncharacterized protein LOC100194405 [Zea mays]
 gb|ACF81944.1| unknown [Zea mays]
 gb|AFW89659.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=183

 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPNESIYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NG+AAALMMRDR AYEQ+VKE+CEKYAK  DAGV PEE+SSD+E+SEDE  S DEEI GK
Sbjct  121  NGDAAALMMRDRPAYEQKVKEYCEKYAKPGDAGVTPEEQSSDEELSEDEDDSGDEEIMGK  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>ref|XP_009400670.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   301 bits (771),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+V+FHGP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVDFHGPNESLYQGGVWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NK+YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYE++VKE+C+KYAK  D G +PE+K SD+E+SEDEY SSDE++ GK
Sbjct  121  NGEAAALMMRDRPAYEEKVKEYCQKYAKPEDIGASPEDKLSDEELSEDEYDSSDEQVVGK  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>ref|XP_002467149.1| hypothetical protein SORBIDRAFT_01g020460 [Sorghum bicolor]
 ref|XP_004982987.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Setaria italica]
 gb|EER94147.1| hypothetical protein SORBIDRAFT_01g020460 [Sorghum bicolor]
Length=183

 Score =   301 bits (771),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPTESIYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG+ P
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGITP  156



>ref|XP_011093127.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Sesamum 
indicum]
Length=183

 Score =   301 bits (770),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP +SPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSDSPYHGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NK+YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQ+VKE+C++YAK  D G  PEEKSSD+E+SEDEY SSDE + G 
Sbjct  121  NGEAAALMMRDRAAYEQKVKEYCQRYAKPEDVGAEPEEKSSDEEMSEDEYDSSDEAVVGP  180

Query  140  ADP  132
             DP
Sbjct  181  VDP  183



>ref|XP_007051763.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 gb|EOX95920.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
Length=187

 Score =   301 bits (770),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 169/187 (90%), Gaps = 4/187 (2%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMIND MQEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK----EFCEKYAKATDAGVAPeekssddevsedeyassdeE  153
            NGEAAALMMRDR AYEQRVK    E+CEKYAK  D G APEEK+SD+E+S ++Y SSD+ 
Sbjct  121  NGEAAALMMRDRGAYEQRVKVHHLEYCEKYAKPEDIGAAPEEKTSDEELSGEDYDSSDDA  180

Query  152  IAGKADP  132
            +AG+ DP
Sbjct  181  VAGQPDP  187



>emb|CDP08792.1| unnamed protein product [Coffea canephora]
Length=183

 Score =   300 bits (769),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKV++INDGMQEFYV FHGP +SPY GGVW++RVELPD+YP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDIINDGMQEFYVHFHGPNDSPYHGGVWKIRVELPDSYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRD+TAYEQRVKE+C+KYAK  D G   EEKSSD+E+SEDEY SSD+ +AG 
Sbjct  121  NGEAAALMMRDQTAYEQRVKEYCQKYAKPEDVGAVSEEKSSDEELSEDEYDSSDDAVAGP  180

Query  140  ADP  132
             DP
Sbjct  181  VDP  183



>ref|XP_008438028.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Cucumis melo]
Length=183

 Score =   300 bits (769),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV+FHGP ESPY GG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR AYEQ+VKE+CE+YAK  D   AP
Sbjct  121  NGEAAALMMRDRVAYEQKVKEYCERYAKPEDIVAAP  156



>ref|XP_008647817.1| PREDICTED: ubiquitin-conjugating enzyme E2-21 kDa 1 isoform X1 
[Zea mays]
 tpg|DAA43379.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=183

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKV+M+NDGMQEF+VEF GP ES YQGG+WRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMVNDGMQEFFVEFRGPNESIYQGGIWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NG+AAALMMRDR AYEQ+VKE+CEKYAK  DAGV+P
Sbjct  121  NGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVSP  156



>ref|XP_010234781.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brachypodium 
distachyon]
Length=184

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR AYEQ+VKE+C+KYAK  DAG+ P
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCQKYAKPEDAGITP  156



>ref|XP_010676458.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Beta vulgaris subsp. 
vulgaris]
Length=186

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGP +SPYQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPSDSPYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEAFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGV  219
            NGEAAAL+MRD+  YEQRVKE+CEKYAK  D G 
Sbjct  121  NGEAAALLMRDKATYEQRVKEYCEKYAKPEDIGA  154



>ref|XP_001759393.1| predicted protein [Physcomitrella patens]
 gb|EDQ75695.1| predicted protein [Physcomitrella patens]
Length=183

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVEM+NDGM EFYVEFHGP+ESPYQ G W++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYKVEMVNDGMSEFYVEFHGPRESPYQEGTWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVN+I+HPNVDEMSGSVCLDVINQTWSPMFDL+NVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLINVFEVFLPQLLLYPNPTDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR  YEQ+VKE+CE+YAKA D G  PE+ S D+   E++  SSDEE+AG 
Sbjct  121  NGEAAALMMRDREHYEQKVKEYCERYAKAEDIGRHPEDSSDDELSEEEDCMSSDEEMAGH  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_009367807.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Pyrus x bretschneideri]
Length=190

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGM EFYV+FHGP +S YQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMHEFYVDFHGPTDSIYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR AYEQRVKEFC KYAK  D G AP
Sbjct  121  NGEAAALMMRDRPAYEQRVKEFCLKYAKPEDIGGAP  156



>ref|XP_008787422.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Phoenix dactylifera]
Length=184

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            Y+SPSIGFV KI HPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVTKICHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG  P
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGAPP  156



>ref|XP_004298815.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   300 bits (767),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 171/184 (93%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVE I+D MQEF+V+F+GPKESPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETIDDDMQEFFVDFNGPKESPYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQ WSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQNWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsede-yassdeEIAG  144
            NGEAAALMMRD+TAYEQRVKEF EKYAK  D G A EEKSSD+E+SEDE  +S DE +AG
Sbjct  121  NGEAAALMMRDKTAYEQRVKEFREKYAKPEDIGAAQEEKSSDEELSEDEYASSDDEAVAG  180

Query  143  KADP  132
            KADP
Sbjct  181  KADP  184



>gb|KHN46724.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=205

 Score =   300 bits (769),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 171/205 (83%), Gaps = 22/205 (11%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK----------------------EFCEKYAKATDAGVAPee  207
            NGEAAALMMRDR  YEQRVK                      E+CEKYAK  D G A EE
Sbjct  121  NGEAAALMMRDRATYEQRVKVENSMSVIHMYQLFTQVHTLSIEYCEKYAKPEDIGAATEE  180

Query  206  kssddevsedeyassdeEIAGKADP  132
             SSD+E+SEDEY SSDE++AGKADP
Sbjct  181  NSSDEELSEDEYDSSDEQVAGKADP  205



>ref|XP_002304506.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
 gb|EEE79485.1| Ubiquitin-conjugating enzyme E2-21 kDa 3 family protein [Populus 
trichocarpa]
Length=183

 Score =   300 bits (767),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YK PSIGF+NKIYHPNVDEMSGSVCLDVINQ WSPMFDLVNVFEVFLPQLLLYPN  DPL
Sbjct  61   YKPPSIGFINKIYHPNVDEMSGSVCLDVINQNWSPMFDLVNVFEVFLPQLLLYPNALDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRD TAY+QRVKE+CEKYAK  D G  PEEKSSD+E+SED+Y S D+++AGK
Sbjct  121  NGEAAALMMRDGTAYDQRVKEYCEKYAKPEDIGARPEEKSSDEELSEDDYNSDDDQVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_010933128.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Elaeis guineensis]
Length=183

 Score =   300 bits (767),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV+FHGP +S YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPNDSLYQGGVWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNK+YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQ+VKE+C++YAK  D G  PE+KSSD+E++EDEY SSDE + G 
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCQRYAKPEDIGAPPEDKSSDEELTEDEYDSSDEAVVGN  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>gb|KJB20631.1| hypothetical protein B456_003G157300 [Gossypium raimondii]
Length=224

 Score =   301 bits (770),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 1/178 (1%)
 Frame = -3

Query  662  RREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSI  483
            RREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPK+SPY GGVW++RVELPDAYPYKSPSI
Sbjct  47   RREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSPYHGGVWKIRVELPDAYPYKSPSI  106

Query  482  GFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAA  303
            GF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAA
Sbjct  107  GFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAA  166

Query  302  LMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsede-yassdeEIAGKADP  132
            LMMRDRT+YEQRVKE+CEKYAK  D G APEEKSSD+E+S+DE  AS DEEIAGKADP
Sbjct  167  LMMRDRTSYEQRVKEYCEKYAKLEDIGAAPEEKSSDEELSDDEYAASDDEEIAGKADP  224



>ref|XP_009397539.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVE +NDG+QEF+V+FHGP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETVNDGIQEFFVDFHGPSESLYQGGVWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQ+VKE+C+KYAK  D G +PE++SS++E+SEDEY SSDE++ GK
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCKKYAKPEDIGASPEDESSEEELSEDEYDSSDEQVVGK  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>ref|XP_004133859.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
Length=183

 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV+FHGP ESPY GG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFLNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQ+VKE+CE+YAK  D   AP++ S ++E+SEDE  SSDE++ G+
Sbjct  121  NGEAAALMMRDRVAYEQKVKEYCERYAKPEDIVAAPDKSSDEEELSEDESDSSDEQVVGQ  180

Query  140  AD  135
            AD
Sbjct  181  AD  182



>tpg|DAA49812.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
 tpg|DAA49815.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=183

 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ P
Sbjct  121  NGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGITP  156



>ref|NP_001132171.1| uncharacterized protein LOC100193596 [Zea mays]
 gb|ACF80907.1| unknown [Zea mays]
 gb|AFW68671.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=186

 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ P
Sbjct  121  NGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGITP  156



>ref|XP_011022652.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Populus euphratica]
Length=183

 Score =   299 bits (766),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVE+INDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEIINDGMQEFYVEFNGPKESLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQ WSPMFDLVNVFEVFLPQLLLYPN  DPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQNWSPMFDLVNVFEVFLPQLLLYPNALDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRD TAY+Q+VKE+CEKYAK  D G  PEEKSSD+E+SED+Y S D+E+AGK
Sbjct  121  NGEAAALMMRDGTAYDQKVKEYCEKYAKPEDIGARPEEKSSDEELSEDDYHSDDDEVAGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_010234779.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brachypodium 
distachyon]
Length=184

 Score =   299 bits (765),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR +YEQ+VKE+C+KYAK  DAG+ P
Sbjct  121  NGEAAALMMRDRPSYEQKVKEYCQKYAKPEDAGITP  156



>ref|XP_010935786.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X3 
[Elaeis guineensis]
Length=184

 Score =   299 bits (765),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGPKES YQ GVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVVFHGPKESLYQAGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVN+I+HPNVDEMSGSVCLDVINQTWSPMFDL+N+FE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLINIFEAFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR AYEQRVKE+CE+YAK  DAG  P
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCERYAKPEDAGAPP  156



>gb|KJB52144.1| hypothetical protein B456_008G248000 [Gossypium raimondii]
Length=184

 Score =   298 bits (764),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 165/183 (90%), Gaps = 1/183 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYVEF+GPK+SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMMNDGMQEFYVEFNGPKDSPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD-AGVAPeekssddevsedeyassdeEIAG  144
            NGEAAALMMRDRTAYE++VKE+ EKYAK  D AG    + S ++   ++  AS DEEIAG
Sbjct  121  NGEAAALMMRDRTAYEEKVKEYREKYAKPEDVAGAEEVKSSDEELSEDEYAASDDEEIAG  180

Query  143  KAD  135
            K D
Sbjct  181  KPD  183



>gb|ACG24376.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
Length=183

 Score =   298 bits (763),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKV+M+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVQMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ P
Sbjct  121  NGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGITP  156



>gb|EMT01071.1| Ubiquitin-conjugating enzyme E2 5 [Aegilops tauschii]
Length=185

 Score =   297 bits (760),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVE +NDGMQEF VEF GP+ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETVNDGMQEFLVEFRGPQESLYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            Y+SPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAAL+MRDR AYEQ+VKEFCEKYAK  DAG+ P
Sbjct  121  NGEAAALLMRDRPAYEQKVKEFCEKYAKPEDAGITP  156



>ref|XP_010275656.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Nelumbo nucifera]
Length=201

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 174/201 (87%), Gaps = 18/201 (9%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+F+GP +SPYQGGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPSDSPYQGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFV KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK------------------EFCEKYAKATDAGVAPeekssd  195
            NGEAAALMMRDRTAYEQRVK                  E+CEKYAK  + G A E++SSD
Sbjct  121  NGEAAALMMRDRTAYEQRVKVAVLSIDARCFQLLDDNQEYCEKYAKPENVGAAVEDQSSD  180

Query  194  devsedeyassdeEIAGKADP  132
            +E+SEDEYASSDE +AG ADP
Sbjct  181  EELSEDEYASSDEGVAGHADP  201



>ref|XP_003525387.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Glycine max]
 gb|KHM99960.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   296 bits (759),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MDLMKLMMSDYKVE INDGMQEF+VEFHGPK+SPYQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVETINDGMQEFFVEFHGPKDSPYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDEVSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NG+AAALM+RD   YEQRVKE+CEKYAK  D G A EE SSDDE+SED+YASSD+ I G+
Sbjct  121  NGDAAALMIRDHATYEQRVKEYCEKYAKPEDVGAAQEESSSDDELSEDDYASSDDAIVGQ  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>gb|EMS63342.1| Ubiquitin-conjugating enzyme E2 5 [Triticum urartu]
Length=185

 Score =   297 bits (760),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVE +NDGMQEF VEF GP+ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVETVNDGMQEFLVEFRGPEESLYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            Y+SPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAAL+MRDR AYEQ+VKEFCEKYAK  DAG+ P
Sbjct  121  NGEAAALLMRDRPAYEQKVKEFCEKYAKPEDAGITP  156



>gb|AFK43668.1| unknown [Lotus japonicus]
Length=184

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDY VEMINDGMQEFYV FHGPKESPY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYTVEMINDGMQEFYVHFHGPKESPYEGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVD+MSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDDMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVA  216
            NGEAAALMMRDR  Y+QRVKE+ EK+AK    G A
Sbjct  121  NGEAAALMMRDRATYDQRVKEYIEKFAKPEHIGAA  155



>ref|NP_001266400.1| putative ubiquitin-conjugating enzyme family [Zea mays]
 gb|ACR38079.1| unknown [Zea mays]
 tpg|DAA49816.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=370

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  188  MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  247

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  248  YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  307

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ P
Sbjct  308  NGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGITP  343


 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAALMMRDR  YEQ+ K
Sbjct  121  NGEAAALMMRDRPVYEQKGK  140



>ref|XP_008647901.1| PREDICTED: putative ubiquitin-conjugating enzyme family isoform 
X1 [Zea mays]
Length=361

 Score =   300 bits (768),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  179  MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYP  238

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  239  YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  298

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAALMMRDR  YEQ+VKE+CEKYAK  DAG+ P
Sbjct  299  NGEAAALMMRDRPVYEQKVKEYCEKYAKPEDAGITP  334


 Score =   243 bits (619),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/128 (89%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -3

Query  644  MKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKI  465
            +  MMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYPYKSPSIGF+NKI
Sbjct  4    LSWMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYPYKSPSIGFINKI  63

Query  464  YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  285
            YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR
Sbjct  64   YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  123

Query  284  TAYEQRVK  261
              YEQ+ K
Sbjct  124  PVYEQKGK  131



>ref|XP_004503694.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Cicer 
arietinum]
Length=183

 Score =   293 bits (751),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MDLMKLMM+DYKVEMINDGMQEF+VEFHGPK+SPYQ GVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMTDYKVEMINDGMQEFFVEFHGPKDSPYQEGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLL YPN SDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLNYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NG+AAALMMRD  AYEQ+VKE+CE+YAK  D G   EE SSD+E SED+ ASSD+ IAG+
Sbjct  121  NGDAAALMMRDCAAYEQKVKEYCERYAKPEDIGATHEENSSDEEQSEDDCASSDDAIAGE  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>ref|NP_001236928.1| uncharacterized protein LOC100527756 [Glycine max]
 gb|ACU16916.1| unknown [Glycine max]
 gb|KHN16806.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=183

 Score =   292 bits (748),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MDLMKLMMSDYKVE +NDGMQEF+VEFHGPK+SPYQGGVW+VRV+LPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVETVNDGMQEFFVEFHGPKDSPYQGGVWKVRVDLPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDEMSGSVCLDVI+QTWSPMFDLVNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDEMSGSVCLDVISQTWSPMFDLVNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NG+AAALM+RD   YEQRVKE+CEKYAK  D G   EE SSDDE SED+YASSD+ I G+
Sbjct  121  NGDAAALMIRDHATYEQRVKEYCEKYAKPEDVGAVQEESSSDDEPSEDDYASSDDAIVGQ  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>gb|ACN39971.1| unknown [Picea sitchensis]
Length=183

 Score =   292 bits (747),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMM DYKVEMINDGM EFYVEF+GP++SPYQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMGDYKVEMINDGMNEFYVEFNGPRDSPYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNKIFHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPTDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR  YEQ+VKE+C +YAK  D G   EE+SSD+EVSEDEY SSDEE+AG 
Sbjct  121  NGEAAALMMRDRQVYEQKVKEYCARYAKPEDVGKQEEEESSDEEVSEDEYGSSDEEVAGH  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_009389296.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   292 bits (747),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLM+SDYKVEM+NDGMQEF+V+FHGP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMISDYKVEMVNDGMQEFFVDFHGPNESLYQGGVWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD  228
            NGEAAALMMRDR AYEQ+VKE+C+KYA   D
Sbjct  121  NGEAAALMMRDRPAYEQKVKEYCQKYATPED  151



>ref|XP_010533643.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Tarenaya hassleriana]
Length=192

 Score =   292 bits (747),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPK+SPY+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSPYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFV KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPN SDPL
Sbjct  61   YKSPSVGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAG  222
            NGEAAAL MRDR AYEQRVKE+ EKYAK   AG
Sbjct  121  NGEAAALQMRDRAAYEQRVKEYTEKYAKPEKAG  153



>ref|XP_006302819.1| hypothetical protein CARUB_v10020943mg, partial [Capsella rubella]
 gb|EOA35717.1| hypothetical protein CARUB_v10020943mg, partial [Capsella rubella]
Length=214

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  30   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFNGPKDSIYEGGVWKIRVELPDAYP  89

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+ KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  90   YKSPSIGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  149

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR  YEQRVKE+CEKYAK
Sbjct  150  NGEAAALMMRDRPTYEQRVKEYCEKYAK  177



>gb|ABK23779.1| unknown [Picea sitchensis]
Length=183

 Score =   291 bits (744),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD++KLMM DYKVEMINDGM EFYVEF+GP++SPYQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVIKLMMGDYKVEMINDGMNEFYVEFNGPRDSPYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNKIFHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPTDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR  YEQ+VKE+C +YAK  D G   EE+SSD+EVSEDEY SSDEE+AG 
Sbjct  121  NGEAAALMMRDRQVYEQKVKEYCARYAKPKDVGKQEEEESSDEEVSEDEYGSSDEEVAGH  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_003558810.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brachypodium 
distachyon]
Length=185

 Score =   290 bits (743),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMM DYKVEM+NDGMQEF++EF GP ES YQGGVW+VRVE PDAYP
Sbjct  1    MSSPSKRREMDLMKLMMRDYKVEMVNDGMQEFFIEFRGPNESLYQGGVWKVRVEFPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            Y+SPS+GF NKIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YRSPSVGFCNKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAAAL+MRDR AYEQ+VKE CEKYAK  DAG+ P
Sbjct  121  NGEAAALLMRDRAAYEQKVKECCEKYAKPEDAGITP  156



>ref|XP_002886384.1| ubiquitin-conjugating enzyme 37 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62643.1| ubiquitin-conjugating enzyme 37 [Arabidopsis lyrata subsp. lyrata]
Length=185

 Score =   290 bits (743),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKDSIYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR  YEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAK  148



>ref|XP_010658145.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 isoform X2 [Vitis 
vinifera]
Length=176

 Score =   290 bits (742),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 166/183 (91%), Gaps = 7/183 (4%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV+FHGP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPGDSPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF       VFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF-------VFLPQLLLYPNPSDPL  113

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQRVKE+CEKYAK  + G APEEKSSD+E+SED Y SSDE +AG+
Sbjct  114  NGEAAALMMRDRPAYEQRVKEYCEKYAKPENIGAAPEEKSSDEELSEDNYESSDEAVAGQ  173

Query  140  ADP  132
            ADP
Sbjct  174  ADP  176



>ref|XP_003557690.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa [Brachypodium 
distachyon]
Length=186

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV FHGP +S YQGGVW+VRVEL +AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVHFHGPNDSIYQGGVWKVRVELTEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGV  219
            NG+AAALMMRD++AY+Q+V+E+C++YAK  DAGV
Sbjct  121  NGDAAALMMRDQSAYDQKVREYCQRYAKPEDAGV  154



>ref|XP_010940563.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Elaeis guineensis]
Length=206

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 148/178 (83%), Gaps = 22/178 (12%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKE-------------------  558
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKE                   
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKEITLEAGRGMHQSLPLLTNF  60

Query  557  ---SPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFD  387
                 YQGGVW++RVELPDAYPYKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFD
Sbjct  61   RDFGLYQGGVWKIRVELPDAYPYKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFD  120

Query  386  LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VKE+CEKYAK  DAG  P
Sbjct  121  LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGAPP  178



>ref|XP_010430489.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Camelina sativa]
 ref|XP_010473625.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Camelina sativa]
Length=186

 Score =   289 bits (740),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFNGPKDSIYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR  YEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAK  148



>ref|NP_564817.2| ubiquitin-conjugating enzyme E2 5 [Arabidopsis thaliana]
 sp|P42749.2|UBC5_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 5; AltName: Full=Ubiquitin 
carrier protein 5; AltName: Full=Ubiquitin-conjugating 
enzyme E2-21 kDa 2; AltName: Full=Ubiquitin-protein ligase 
5 [Arabidopsis thaliana]
 gb|AAL67043.1| putative E2, ubiquitin-conjugating enzyme UBC5 [Arabidopsis thaliana]
 gb|AAM45109.1| putative E2, ubiquitin-conjugating enzyme UBC5 [Arabidopsis thaliana]
 gb|AAY44846.1| ubiquitinating enzyme [Arabidopsis thaliana]
 dbj|BAF02237.1| putative ubiquitin-conjugating enzyme [Arabidopsis thaliana]
 gb|AEE34149.1| ubiquitin-conjugating enzyme E2 5 [Arabidopsis thaliana]
Length=185

 Score =   289 bits (739),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEF GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR  YEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAK  148



>ref|XP_010418415.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Camelina sativa]
Length=186

 Score =   289 bits (739),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFNGPKDSIYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR  YEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPTYEQRVKEYCEKYAK  148



>ref|XP_010559097.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 isoform X1 [Tarenaya 
hassleriana]
Length=183

 Score =   288 bits (738),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMIND M+ FYV FHGP +S YQGGVWR+RVELPD+YP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDEMRAFYVRFHGPTDSLYQGGVWRIRVELPDSYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAA+LMMRDR AYEQ+VKE+C++YAK  D G A EE SSDDE+SED   S D+E+ G+
Sbjct  121  NGEAASLMMRDRAAYEQKVKEYCKRYAKPVDIGAASEENSSDDEMSEDGSDSDDDEMVGQ  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_002964045.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 ref|XP_002975471.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ23672.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ34378.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
Length=182

 Score =   288 bits (737),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 169/183 (92%), Gaps = 1/183 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVEM+NDGM EF VEFHGP++SPYQ G W+VRVELP+AYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYKVEMVNDGMNEFNVEFHGPRDSPYQTGTWKVRVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVN+I+HPNVDEMSGSVCLDVINQTWSPMFDL+NVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLINVFEVFLPQLLLYPNPTDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR  Y+Q+VKE+CE+YAK+ D    P E+SSD EV++++YASSDEE+AG 
Sbjct  121  NGEAAALMMRDRDRYDQKVKEYCERYAKSEDTAAHP-EESSDAEVTDEDYASSDEEMAGH  179

Query  140  ADP  132
            ADP
Sbjct  180  ADP  182



>ref|XP_010436081.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Camelina sativa]
Length=188

 Score =   288 bits (737),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR AYEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAK  148



>ref|NP_568589.1| ubiquitin-conjugating enzyme E2 4 [Arabidopsis thaliana]
 sp|P42748.2|UBC4_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 4; AltName: Full=Ubiquitin 
carrier protein 4; AltName: Full=Ubiquitin-conjugating 
enzyme E2-21 kDa 1; AltName: Full=Ubiquitin-protein ligase 
4 [Arabidopsis thaliana]
 dbj|BAB08506.1| ubiquitin-conjugating enzyme E2-21 kD 1 (ubiquitin-protein ligase 
4) (ubiquitin carrier protein 4) [Arabidopsis thaliana]
 gb|AAL38801.1| putative E2, ubiquitin-conjugating enzyme UBC4 [Arabidopsis thaliana]
 gb|AAM20237.1| putative ubiquitin-conjugating enzyme E2-21 kD 1 [Arabidopsis 
thaliana]
 gb|AAY44845.1| ubiquitinating enzyme [Arabidopsis thaliana]
 gb|AED94667.1| ubiquitin-conjugating enzyme E2 4 [Arabidopsis thaliana]
Length=187

 Score =   288 bits (736),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR AYEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAK  148



>ref|XP_010447359.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Camelina sativa]
Length=189

 Score =   288 bits (737),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR AYEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAK  148



>ref|XP_002868603.1| hypothetical protein ARALYDRAFT_493844 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44862.1| hypothetical protein ARALYDRAFT_493844 [Arabidopsis lyrata subsp. 
lyrata]
Length=189

 Score =   288 bits (737),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR AYEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAK  148



>ref|XP_006286283.1| hypothetical protein CARUB_v10007860mg [Capsella rubella]
 gb|EOA19181.1| hypothetical protein CARUB_v10007860mg [Capsella rubella]
Length=191

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR AYEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAK  148



>ref|XP_009397721.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=183

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MS PSKRREMDLMKLMMSDYKVEM NDGM EF V+FHGPKESPYQGGVWR+RVELPD YP
Sbjct  1    MSFPSKRREMDLMKLMMSDYKVEMTNDGMHEFLVDFHGPKESPYQGGVWRIRVELPDGYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            Y SPSIGFVNK+YHPNVDEMSGS+CLDVINQTWSPM+DLVNVFEVFLPQLLLYPNP DPL
Sbjct  61   YHSPSIGFVNKMYHPNVDEMSGSICLDVINQTWSPMYDLVNVFEVFLPQLLLYPNPLDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAAL+MRD  AYEQ+VKE+C KYAK  D G +PEEKSSD+E+SE+E  SSDE++ GK
Sbjct  121  NGEAAALLMRDEPAYEQKVKEYCLKYAKPEDIGASPEEKSSDEELSENECDSSDEQMLGK  180

Query  140  ADP  132
             DP
Sbjct  181  PDP  183



>gb|EPS69444.1| ubiquitin carrier protein [Genlisea aurea]
Length=186

 Score =   287 bits (734),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMDLMKLMMSDYKVE INDG+QEF+V FHGP  SPY GGVW++RVELPDAYP
Sbjct  1    MASPSKRREMDLMKLMMSDYKVETINDGVQEFFVHFHGPSGSPYHGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDE+SGSVCLDVINQ WSPMFDLVNVFEVF+PQLLLYPNPSDPL
Sbjct  61   YKSPSIGFMNKIYHPNVDEISGSVCLDVINQKWSPMFDLVNVFEVFMPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD  228
            NGEAAALMMRDR AY+QRVKE+CEKYAKA +
Sbjct  121  NGEAAALMMRDRAAYDQRVKEYCEKYAKAEE  151



>ref|XP_006405362.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
 dbj|BAJ34442.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46815.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
Length=187

 Score =   286 bits (733),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR AYEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAK  148



>ref|XP_010441297.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Camelina sativa]
Length=189

 Score =   286 bits (733),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RV+LPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVQLPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR AYEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAK  148



>gb|KFK33016.1| hypothetical protein AALP_AA6G319600 [Arabis alpina]
Length=187

 Score =   286 bits (733),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR AYEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPAYEQRVKEYCEKYAK  148



>dbj|BAK02014.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02064.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87655.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03350.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=184

 Score =   286 bits (732),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKV+MINDGMQEF+V FHGP +S YQGGVW+VRVEL +AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMQEFFVHFHGPNDSIYQGGVWKVRVELTEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKA  234
            NGEAA+LMMRD+ AYEQ+VKE+CE+YAKA
Sbjct  121  NGEAASLMMRDKNAYEQKVKEYCERYAKA  149



>gb|AAA32900.1| ubiquitin conjugating enzyme [Arabidopsis thaliana]
Length=187

 Score =   286 bits (731),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEFYVEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRD  AYEQRVKE+CEKYAK
Sbjct  121  NGEAAALMMRDHPAYEQRVKEYCEKYAK  148



>ref|XP_007051766.1| Ubiquitin-conjugating enzyme E2 5 isoform 4 [Theobroma cacao]
 gb|EOX95923.1| Ubiquitin-conjugating enzyme E2 5 isoform 4 [Theobroma cacao]
Length=174

 Score =   285 bits (728),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 162/183 (89%), Gaps = 9/183 (5%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMIND MQEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAAALMMRDR AYEQRVKE         D G APEEK+SD+E+S ++Y SSD+ +AG+
Sbjct  121  NGEAAALMMRDRGAYEQRVKE---------DIGAAPEEKTSDEELSGEDYDSSDDAVAGQ  171

Query  140  ADP  132
             DP
Sbjct  172  PDP  174



>ref|XP_010553532.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Tarenaya hassleriana]
Length=189

 Score =   285 bits (730),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+F+GPK+SPY+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFNGPKDSPYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFV KIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPN SDPL
Sbjct  61   YKSPSVGFVTKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAAL MRDR AY+QRVKE+ EKYAK
Sbjct  121  NGEAAALQMRDRAAYDQRVKEYTEKYAK  148



>gb|KJB52143.1| hypothetical protein B456_008G248000 [Gossypium raimondii]
Length=171

 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYVEF+GPK+SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMMNDGMQEFYVEFNGPKDSPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAALMMRDRTAYE++VK
Sbjct  121  NGEAAALMMRDRTAYEEKVK  140



>ref|XP_006465385.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Citrus sinensis]
 gb|KDO76261.1| hypothetical protein CISIN_1g029962mg [Citrus sinensis]
Length=150

 Score =   283 bits (723),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEF+GPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFNGPKESSYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAALMMRDRTAY+QRVK
Sbjct  121  NGEAAALMMRDRTAYDQRVK  140



>ref|XP_006598954.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Glycine max]
Length=155

 Score =   282 bits (722),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAALMMRDR  YEQRVK
Sbjct  121  NGEAAALMMRDRATYEQRVK  140



>emb|CDY58954.1| BnaCnng33990D [Brassica napus]
Length=186

 Score =   283 bits (724),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDA  225
            NGEAAALMMRDR  YE RVKE+CEKYAKA + 
Sbjct  121  NGEAAALMMRDRPTYELRVKEYCEKYAKAGEG  152



>ref|XP_003627554.1| Ubiquitin carrier protein [Medicago truncatula]
Length=191

 Score =   283 bits (725),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 160/191 (84%), Gaps = 8/191 (4%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESP---YQGGVWRVRVELPD  510
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGP E     YQGGVW+VRVELPD
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSEIDSVLYQGGVWKVRVELPD  60

Query  509  AYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSP---MFDLVNVFEVFLPQLLLYP  339
            AYPYKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSP   M  LVNVFEVFLPQLLLYP
Sbjct  61   AYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPCLVMIYLVNVFEVFLPQLLLYP  120

Query  338  NPSDPLNGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassd  159
            NPSDPLNGEAAALMMRDR  YEQRVKE+CEKYAK  D G A EEKSSD++    E     
Sbjct  121  NPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYAKPEDIGAATEEKSSDEDEELTEDEYDS  180

Query  158  e--EIAGKADP  132
               ++AGKADP
Sbjct  181  SDEQVAGKADP  191



>ref|XP_010940567.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X4 
[Elaeis guineensis]
Length=164

 Score =   282 bits (721),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFC  252
            NGEAAALMMRDR AYEQ+VK   
Sbjct  121  NGEAAALMMRDRPAYEQKVKNIA  143



>gb|ABK21140.1| unknown [Picea sitchensis]
Length=183

 Score =   283 bits (723),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKVEM+NDGM EF VEFHGP++SPY+GGVW++RVELPDAYP
Sbjct  1    MASPSKRREMDVMKLMMSDYKVEMLNDGMHEFNVEFHGPQDSPYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQTWSPMFDLVNVFESFLPQLLLYPNPTDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NG+AA+LMMRDR  YEQ+VKE+CE+YA+  +    PEE S D+EVS+D+  SSD+E+AG 
Sbjct  121  NGDAASLMMRDREQYEQKVKEYCERYARGENGSNCPEESSDDEEVSDDDSESSDDEVAGH  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>sp|P16577.1|UBC4_WHEAT RecName: Full=Ubiquitin-conjugating enzyme E2-23 kDa; AltName: 
Full=Ubiquitin carrier protein; AltName: Full=Ubiquitin-protein 
ligase [Triticum aestivum]
 gb|AAA34309.1| ubiquitin carrier protein [Triticum aestivum]
Length=184

 Score =   282 bits (722),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKV+MINDGM EF+V FHGPK+S YQGGVW+VRVEL +AYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFFVHFHGPKDSIYQGGVWKVRVELTEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAA+LMMRD+ AYE +VKE+CE+YAK
Sbjct  121  NGEAASLMMRDKNAYENKVKEYCERYAK  148



>ref|XP_006586692.1| PREDICTED: uncharacterized protein LOC100805356 isoform X1 [Glycine 
max]
Length=166

 Score =   281 bits (719),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 143/160 (89%), Gaps = 6/160 (4%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGP +SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK------EFCEKYAKATDAGV  219
            NGEAAALMMRDR +YEQRVK        C+  +K+   G 
Sbjct  121  NGEAAALMMRDRPSYEQRVKVVLFWSSSCQPQSKSKPRGT  160



>ref|XP_010933129.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Elaeis guineensis]
Length=164

 Score =   280 bits (717),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEFYV+FHGP +S YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVDFHGPNDSLYQGGVWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNK+YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKMYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCE  249
            NGEAAALMMRDR AYEQ+VK   +
Sbjct  121  NGEAAALMMRDRPAYEQKVKNIVK  144



>ref|XP_009140085.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Brassica rapa]
 emb|CDY39744.1| BnaA04g11090D [Brassica napus]
Length=186

 Score =   280 bits (717),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR  YE RVKE+CEKYAK
Sbjct  121  NGEAAALMMRDRPTYELRVKEYCEKYAK  148



>ref|XP_010918820.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Elaeis guineensis]
Length=146

 Score =   278 bits (712),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDY+VEM+NDGMQEFYV FHGP ES YQGGVWRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYRVEMVNDGMQEFYVYFHGPNESLYQGGVWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAALMMRDR AYEQ+VK
Sbjct  121  NGEAAALMMRDRPAYEQKVK  140



>gb|KDO86232.1| hypothetical protein CISIN_1g030092mg [Citrus sinensis]
Length=153

 Score =   278 bits (712),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV F GP ESPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFQGPNESPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPN+DEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNIDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAAL+MRDR AYEQRVK
Sbjct  121  NGEAAALLMRDRAAYEQRVK  140



>gb|KHN29339.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=185

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  647  LMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNK  468
            + + MMSDYKVEMINDGMQEFYV+FHGP +SPY GGVW+VRVELPDAYPYKSPSIGF+NK
Sbjct  14   VFRRMMSDYKVEMINDGMQEFYVQFHGPNDSPYHGGVWKVRVELPDAYPYKSPSIGFINK  73

Query  467  IYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRD  288
            IYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRD
Sbjct  74   IYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRD  133

Query  287  RTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            R +YEQRVKE+CEKYAK  D G A EEKSSD+E+SEDEY SSDE++ GKADP
Sbjct  134  RPSYEQRVKEYCEKYAKPEDIGEATEEKSSDEEMSEDEYDSSDEQVVGKADP  185



>ref|XP_009125181.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Brassica rapa]
 emb|CDX67494.1| BnaA07g15340D [Brassica napus]
Length=184

 Score =   279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAAALMMRDR  YE RVKE+C+KYAK
Sbjct  121  NGEAAALMMRDRPTYELRVKEYCDKYAK  148



>ref|XP_008393051.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
 ref|XP_008393052.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
 ref|XP_008393053.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Malus 
domestica]
Length=184

 Score =   279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 164/184 (89%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFMNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD-AGVAPeekssddevsedeyassdeEIAG  144
            NG+AA+LMM+DR  Y+Q+VKE+CE+YAK        P+E+S D+ +S++E  SSD++IAG
Sbjct  121  NGDAASLMMKDRKLYDQKVKEYCERYAKKEHITNTTPDEESDDENISDEESNSSDDDIAG  180

Query  143  KADP  132
             ADP
Sbjct  181  HADP  184



>ref|XP_004298926.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Fragaria 
vesca subsp. vesca]
Length=184

 Score =   279 bits (713),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 164/184 (89%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESIYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFMNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD-AGVAPeekssddevsedeyassdeEIAG  144
            NG+AA+LMM+DR  Y+Q+VKE+CEKYAK    A   PEE+S ++ +S++   SSD++IAG
Sbjct  121  NGDAASLMMKDRKLYDQKVKEYCEKYAKKEHIANTTPEEESGEENISDEGSDSSDDDIAG  180

Query  143  KADP  132
             ADP
Sbjct  181  HADP  184



>emb|CDY62172.1| BnaC06g42330D [Brassica napus]
Length=189

 Score =   279 bits (713),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAG  222
            NGEAAALMMRDR  YE RVKE+C+KYAK  ++ 
Sbjct  121  NGEAAALMMRDRPTYELRVKEYCDKYAKPGESS  153



>ref|XP_008787423.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Phoenix dactylifera]
Length=157

 Score =   277 bits (709),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKES YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKESLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            Y+SPSIGFV KI HPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YRSPSIGFVTKICHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGV  219
            NGEAAALMMRDR AYEQ+VK   ++       G+
Sbjct  121  NGEAAALMMRDRPAYEQKVKGCTDRMTAHLQIGL  154



>gb|KGN56505.1| hypothetical protein Csa_3G121800 [Cucumis sativus]
Length=163

 Score =   277 bits (709),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV+FHGP ESPY GG+WR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFLNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQR  267
            NGEAAALMMRDR AYEQ+
Sbjct  121  NGEAAALMMRDRVAYEQK  138



>ref|NP_001064719.1| Os10g0447100 [Oryza sativa Japonica Group]
 gb|ABG66102.1| Ubiquitin-conjugating enzyme E2-23 kDa, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26633.1| Os10g0447100 [Oryza sativa Japonica Group]
 dbj|BAG90217.1| unnamed protein product [Oryza sativa Japonica Group]
Length=144

 Score =   276 bits (707),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAALMMRDR AYEQ+VK
Sbjct  121  NGEAAALMMRDRPAYEQKVK  140



>ref|XP_006853122.1| hypothetical protein AMTR_s00038p00146240 [Amborella trichopoda]
 gb|ERN14589.1| hypothetical protein AMTR_s00038p00146240 [Amborella trichopoda]
Length=184

 Score =   278 bits (711),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVEMINDGM EF VEF+GP ES Y+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYKVEMINDGMHEFNVEFNGPNESLYEGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQTWSPMFDL+NVFEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQTWSPMFDLLNVFEVFLPQLLLYPNPTDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD-AGVAPeekssddevsedeyassdeEIAG  144
            NG+AA+LMMRDR  YEQ+VKE+CE+YAK  + +  A E    +    +D  +S +EE+AG
Sbjct  121  NGDAASLMMRDRQQYEQKVKEYCERYAKRENISNAAEESSDEEISEGDDGESSEEEEVAG  180

Query  143  KADP  132
             ADP
Sbjct  181  HADP  184



>ref|XP_010037586.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Eucalyptus 
grandis]
 gb|KCW49310.1| hypothetical protein EUGRSUZ_K02866 [Eucalyptus grandis]
Length=185

 Score =   278 bits (711),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 158/185 (85%), Gaps = 2/185 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKA--TDAGVAPeekssddevsedeyassdeEIA  147
            NG+AA+LMM+DR  Y+Q+VKE+CE+YAK        A E+   ++   E   +S D+EIA
Sbjct  121  NGDAASLMMKDRKQYDQKVKEYCERYAKKEHISNSRAEEDSDDEEISVEGSESSDDDEIA  180

Query  146  GKADP  132
            G ADP
Sbjct  181  GHADP  185



>ref|XP_011098510.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Sesamum indicum]
Length=187

 Score =   278 bits (710),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKESPY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVEPINDGINEFNVEFHGPKESPYEGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  YEQ+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKAQYEQKVKEYCERYAK  148



>ref|XP_007036155.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 ref|XP_007036156.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 gb|EOY20656.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
 gb|EOY20657.1| Ubiquitin-conjugating enzyme E2 5 isoform 1 [Theobroma cacao]
Length=184

 Score =   277 bits (709),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 165/184 (90%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDEMSGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFMNKIFHPNVDEMSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD-AGVAPeekssddevsedeyassdeEIAG  144
            NG+AA+LMM+DR  Y+Q+VKE+CE+YAK  +      +E+S +++V+++E  SSD+EIAG
Sbjct  121  NGDAASLMMKDRKQYDQKVKEYCERYAKKENITKSTADEESDEEDVTDEESKSSDDEIAG  180

Query  143  KADP  132
             ADP
Sbjct  181  HADP  184



>ref|XP_010935785.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Elaeis guineensis]
Length=220

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGPKES YQ GVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVVFHGPKESLYQAGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVN+I+HPNVDEMSGSVCLDVINQTWSPMFDL+N+FE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFDLINIFEAFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAALMMRDR AYEQRVK
Sbjct  121  NGEAAALMMRDRPAYEQRVK  140



>ref|XP_007209657.1| hypothetical protein PRUPE_ppa012074mg [Prunus persica]
 ref|XP_008239732.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Prunus 
mume]
 gb|EMJ10856.1| hypothetical protein PRUPE_ppa012074mg [Prunus persica]
Length=184

 Score =   276 bits (706),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 164/184 (89%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD-AGVAPeekssddevsedeyassdeEIAG  144
            NG+AA+LMM+DR  Y+Q+VKE+CE+YAK        P+E+S D+ +S++E  SSD++IAG
Sbjct  121  NGDAASLMMKDRKLYDQKVKEYCERYAKKEHITNSTPDEESGDENISDEESDSSDDDIAG  180

Query  143  KADP  132
             ADP
Sbjct  181  HADP  184



>gb|EPS57624.1| ubiquitin carrier protein, partial [Genlisea aurea]
Length=140

 Score =   275 bits (702),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDG+QEFYV F GP +SPY GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGIQEFYVHFKGPNDSPYHGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVF+PQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFMPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAALMMRDR AYEQ+VK
Sbjct  121  NGEAAALMMRDRAAYEQKVK  140



>ref|XP_009628119.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X2 
[Nicotiana tomentosiformis]
Length=168

 Score =   275 bits (704),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKVEMINDGMQEFYV FHGP ESPY GGVW++RVELPDAYPYKSPSIGF+NKIYHP
Sbjct  1    MMSDYKVEMINDGMQEFYVHFHGPTESPYHGGVWKIRVELPDAYPYKSPSIGFINKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAA+LMMRDR AY
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAASLMMRDRAAY  120

Query  275  EQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            E RVKE+C+KYAK  D G APEEKSSD+E+SE EY S+D+ +AG  DP
Sbjct  121  ELRVKEYCQKYAKPEDVGAAPEEKSSDEELSEAEYDSADDAVAGPVDP  168



>gb|KJB39653.1| hypothetical protein B456_007G023700 [Gossypium raimondii]
Length=169

 Score =   275 bits (704),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKVEMINDGMQEFYVEF+GPK+SPY GGVW++RVELPDAYPYKSPSIGF+NKIYHP
Sbjct  1    MMSDYKVEMINDGMQEFYVEFNGPKDSPYHGGVWKIRVELPDAYPYKSPSIGFINKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AY
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRAAY  120

Query  275  EQRVKEFCEKYAKATDAGV-APeekssddevsedeyassdeEIAGKADP  132
            EQRVKE+CEKYAK  D G  A E+ S ++   ++  AS DEEIAGK DP
Sbjct  121  EQRVKEYCEKYAKPEDIGAKAEEKSSDEELSEDEYAASDDEEIAGKPDP  169



>ref|XP_004251221.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
lycopersicum]
 ref|XP_004251222.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
lycopersicum]
Length=185

 Score =   276 bits (705),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDYKVE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYKVETINDGITEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NG+AA+LMM+D+  YEQ+VKE+CE+YAK  +    P
Sbjct  121  NGDAASLMMKDKNQYEQKVKEYCERYAKKENVVGTP  156



>ref|XP_007051765.1| Ubiquitin-conjugating enzyme E2 5 isoform 3 [Theobroma cacao]
 gb|EOX95922.1| Ubiquitin-conjugating enzyme E2 5 isoform 3 [Theobroma cacao]
Length=194

 Score =   276 bits (706),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKVEMIND MQEFYV F GP ESPY GGVWR+RVELPDAYPYKSPSIGFVNKIYHP
Sbjct  27   MMSDYKVEMINDSMQEFYVHFSGPNESPYHGGVWRIRVELPDAYPYKSPSIGFVNKIYHP  86

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AY
Sbjct  87   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRGAY  146

Query  275  EQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            EQRVKE+CEKYAK  D G APEEK+SD+E+S ++Y SSD+ +AG+ DP
Sbjct  147  EQRVKEYCEKYAKPEDIGAAPEEKTSDEELSGEDYDSSDDAVAGQPDP  194



>ref|XP_007160084.1| hypothetical protein PHAVU_002G291200g [Phaseolus vulgaris]
 gb|ESW32078.1| hypothetical protein PHAVU_002G291200g [Phaseolus vulgaris]
Length=183

 Score =   275 bits (704),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MDLMKLMMSDYKVEMINDGMQEF+VEF GPK+SPY+ GVW+++VELPDAYP
Sbjct  1    MSSPSKRRDMDLMKLMMSDYKVEMINDGMQEFFVEFRGPKDSPYEVGVWKIKVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SG+VCLDVINQTWSPMFDLVNVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGAVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGV  219
            N + AALM+RD   YEQRVKE+CEKYAK  D G 
Sbjct  121  NSD-AALMIRDHATYEQRVKEYCEKYAKPEDIGA  153



>gb|KDP31131.1| hypothetical protein JCGZ_11507 [Jatropha curcas]
Length=184

 Score =   275 bits (704),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LM+RDR  Y+Q+VKE+CE+YA+
Sbjct  121  NGDAASLMIRDREKYDQKVKEYCERYAR  148



>ref|XP_009783360.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Nicotiana sylvestris]
Length=168

 Score =   274 bits (701),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKVEMINDGMQEFYV FHGP ESPY GGVW+V+VELPDAYPYKSPSIGFVNKIYHP
Sbjct  1    MMSDYKVEMINDGMQEFYVHFHGPAESPYHGGVWKVKVELPDAYPYKSPSIGFVNKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVINQTWSPMFDL NVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLTNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  120

Query  275  EQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            EQ VKE+C+KYAK  D G A EEKSSD+E+SE EY S DEE+AG  DP
Sbjct  121  EQSVKEYCQKYAKPEDVGAAAEEKSSDEELSEAEYDSDDEEMAGPVDP  168



>gb|KHG06323.1| Ubiquitin-conjugating enzyme E2 4 -like protein [Gossypium arboreum]
 gb|KJB37061.1| hypothetical protein B456_006G188200 [Gossypium raimondii]
 gb|KJB37062.1| hypothetical protein B456_006G188200 [Gossypium raimondii]
 gb|KJB37064.1| hypothetical protein B456_006G188200 [Gossypium raimondii]
Length=185

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 164/185 (89%), Gaps = 2/185 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF V+FHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVKFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            +KSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPSDPL
Sbjct  61   FKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD--AGVAPeekssddevsedeyassdeEIA  147
            NG+AA+LMM+DR  Y+Q+VKE+CE+YAK  D     A +E   +D++++++  SSD+EIA
Sbjct  121  NGDAASLMMKDRKQYDQKVKEYCERYAKKEDITKSAADKETDDEDDITDEDTGSSDDEIA  180

Query  146  GKADP  132
            G ADP
Sbjct  181  GHADP  185



>ref|XP_002985720.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ13298.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
Length=183

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPS+RREMD+MKLMMSDYKVEM+NDGM EF V+F GP +SPY+ GVW+VRVELPD+YP
Sbjct  1    MSSPSRRREMDVMKLMMSDYKVEMLNDGMNEFIVDFQGPADSPYESGVWKVRVELPDSYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE SGSVCLDVIN TWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDESSGSVCLDVINHTWSPMFDLVNVFESFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVA  216
            NGEA +LMMRD+  YEQ+VKE+CE+YAK  DA  A
Sbjct  121  NGEAGSLMMRDKEKYEQKVKEYCERYAKPKDAQTA  155



>ref|XP_010935784.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Elaeis guineensis]
Length=235

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 147/207 (71%), Gaps = 51/207 (25%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV FHGPKES YQ GVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVVFHGPKESLYQAGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF-----------------------  390
            YKSPSIGFVN+I+HPNVDEMSGSVCLDVINQTWSPMF                       
Sbjct  61   YKSPSIGFVNRIFHPNVDEMSGSVCLDVINQTWSPMFGKELITPILSLCMNFMADVEQGC  120

Query  389  ----------------------------DLVNVFEVFLPQLLLYPNPSDPLNGEAAALMM  294
                                        DL+N+FE FLPQLLLYPNPSDPLNGEAAALMM
Sbjct  121  LLDTEFAAIYLFILDIISAFNMFASVFSDLINIFEAFLPQLLLYPNPSDPLNGEAAALMM  180

Query  293  RDRTAYEQRVKEFCEKYAKATDAGVAP  213
            RDR AYEQRVKE+CE+YAK  DAG  P
Sbjct  181  RDRPAYEQRVKEYCERYAKPEDAGAPP  207



>gb|AFK44595.1| unknown [Medicago truncatula]
Length=185

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLTEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKKLYDQKVKEYCERYAK  148



>ref|XP_002974421.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
 gb|EFJ24643.1| ubiquitin-conjugating enzyme 5, E2 [Selaginella moellendorffii]
Length=183

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPS+RREMD+MKLMMSDYKVEM+NDGM EF V+F GP +SPY+ GVW+VRVELPD+YP
Sbjct  1    MSSPSRRREMDVMKLMMSDYKVEMLNDGMNEFIVDFQGPADSPYESGVWKVRVELPDSYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE SGSVCLDVIN TWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDESSGSVCLDVINHTWSPMFDLVNVFESFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVA  216
            NGEA +LMMRD+  YEQ+VKE+CE+YAK  DA  A
Sbjct  121  NGEAGSLMMRDKERYEQKVKEYCERYAKPKDAQTA  155



>gb|EYU42972.1| hypothetical protein MIMGU_mgv1a0146272mg, partial [Erythranthe 
guttata]
Length=140

 Score =   273 bits (697),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSP+KRREMDLMKLMMSDYKVEMINDGM +FYV FHGP +SPY GGVW+VRVELPDAYP
Sbjct  1    MSSPTKRREMDLMKLMMSDYKVEMINDGMHQFYVHFHGPSDSPYHGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NK+YHPNVDE SGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKMYHPNVDETSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAALMMRD+ AYEQ+VK
Sbjct  121  NGEAAALMMRDKAAYEQKVK  140



>ref|XP_004508848.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Cicer 
arietinum]
Length=185

 Score =   274 bits (701),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  YEQ+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKKLYEQKVKEYCERYAK  148



>gb|KGN64295.1| hypothetical protein Csa_1G045930 [Cucumis sativus]
Length=252

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 147/156 (94%), Gaps = 3/156 (2%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSP+KRR+MD+MKLMMSDYKVEMI+DG+ EF VEF+GPKES Y+GGVW++ VELPDAYP
Sbjct  79   MSSPNKRRDMDVMKLMMSDYKVEMIDDGLSEFNVEFNGPKESVYEGGVWKIHVELPDAYP  138

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  139  YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLLNVFEVFLPQLLLYPNPSDPL  198

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK---ATDAG  222
            NG+AA+LM++DR+ Y+Q+VKE+CE+YAK    T++G
Sbjct  199  NGDAASLMLKDRSQYDQKVKEYCERYAKRENVTNSG  234



>ref|XP_008647825.1| PREDICTED: ubiquitin-conjugating enzyme E2-21 kDa 1 isoform X2 
[Zea mays]
Length=162

 Score =   273 bits (698),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKV+M+NDGMQEF+VEF GP ES YQGG+WRVRVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVDMVNDGMQEFFVEFRGPNESIYQGGIWRVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQR  267
            NG+AAALMMRDR AYEQ+
Sbjct  121  NGDAAALMMRDRPAYEQK  138



>ref|XP_006439774.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 ref|XP_006439775.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 ref|XP_006439776.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 ref|XP_006476744.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476745.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Citrus sinensis]
 gb|ESR53014.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 gb|ESR53015.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 gb|ESR53016.1| hypothetical protein CICLE_v10022463mg [Citrus clementina]
 gb|KDO69726.1| hypothetical protein CISIN_1g030037mg [Citrus sinensis]
 gb|KDO69727.1| hypothetical protein CISIN_1g030037mg [Citrus sinensis]
Length=184

 Score =   274 bits (700),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQ+WSPMFDL+N+FE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQSWSPMFDLLNIFESFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+DR  Y+Q+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDRKQYDQKVKEYCERYAK  148



>ref|XP_003608946.1| Ubiquitin carrier protein [Medicago truncatula]
 gb|AES91143.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=185

 Score =   274 bits (700),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLTEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKKLYDQKVKEYCERYAK  148



>ref|XP_006470379.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Citrus sinensis]
Length=187

 Score =   273 bits (699),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSP KRREMD+MKLMMSDY VE INDG+ E  VEFHGPK+S Y+GG+W++RVELPDAYP
Sbjct  1    MSSPCKRREMDVMKLMMSDYSVEPINDGISELKVEFHGPKDSLYEGGIWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQTWSPMFDL+N+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQTWSPMFDLLNIFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+DR  YEQRVKE+CE+YAK
Sbjct  121  NGDAASLMMKDRKQYEQRVKEYCERYAK  148



>ref|XP_010913550.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X5 [Elaeis guineensis]
Length=184

 Score =   273 bits (698),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKESPY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVETINDGLSEFNVEFHGPKESPYEGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGS+CLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPADPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LM++D+  YEQ+VKE+CE+YAK
Sbjct  121  NGDAASLMLKDQQQYEQKVKEYCERYAK  148



>emb|CDP20894.1| unnamed protein product [Coffea canephora]
Length=184

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDY VE +NDG+ EF V FHGPKES Y+GGVW+V VELPDAYP
Sbjct  1    MTSPSKRREMDVMKLMMSDYSVETVNDGLSEFNVLFHGPKESTYEGGVWKVHVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD  228
            NG+AA+LMM+D+T YEQ+VKE+CE+YAKA +
Sbjct  121  NGDAASLMMKDKTQYEQKVKEYCERYAKAEN  151



>ref|XP_006340324.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum 
tuberosum]
Length=185

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETINDGITEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NG+AA+LMM+D+  YEQ+VKE+CE+YAK  +    P
Sbjct  121  NGDAASLMMKDKNQYEQKVKEYCERYAKKENVVGTP  156



>ref|XP_010532272.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Tarenaya 
hassleriana]
 ref|XP_010532273.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Tarenaya 
hassleriana]
Length=185

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE IND + EF VEFHGPKES Y+GGVW++ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYSVETINDCLNEFNVEFHGPKESLYEGGVWKIHVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMMRDRT Y+Q+V+E+CE+YAK
Sbjct  121  NGDAASLMMRDRTQYDQKVREYCERYAK  148



>ref|XP_009592505.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
tomentosiformis]
 ref|XP_009592506.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
tomentosiformis]
 ref|XP_009794391.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
sylvestris]
 ref|XP_009794393.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nicotiana 
sylvestris]
Length=185

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETINDGITEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NG+AA+LMM+D+  YEQ+VKE+CE+YAK  +   +P
Sbjct  121  NGDAASLMMKDKNQYEQKVKEYCERYAKKENIVGSP  156



>ref|XP_004152466.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 1 [Cucumis 
sativus]
 ref|XP_004152467.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 2 [Cucumis 
sativus]
 ref|XP_004157792.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 1 [Cucumis 
sativus]
 ref|XP_004157793.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform 2 [Cucumis 
sativus]
 ref|XP_008438150.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Cucumis melo]
 ref|XP_008438158.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Cucumis melo]
Length=183

 Score =   273 bits (697),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 147/156 (94%), Gaps = 3/156 (2%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSP+KRR+MD+MKLMMSDYKVEMI+DG+ EF VEF+GPKES Y+GGVW++ VELPDAYP
Sbjct  1    MSSPNKRRDMDVMKLMMSDYKVEMIDDGLSEFNVEFNGPKESVYEGGVWKIHVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK---ATDAG  222
            NG+AA+LM++DR+ Y+Q+VKE+CE+YAK    T++G
Sbjct  121  NGDAASLMLKDRSQYDQKVKEYCERYAKRENVTNSG  156



>ref|XP_007155401.1| hypothetical protein PHAVU_003G198300g [Phaseolus vulgaris]
 gb|ESW27395.1| hypothetical protein PHAVU_003G198300g [Phaseolus vulgaris]
Length=185

 Score =   273 bits (697),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKKLYDQKVKEYCERYAK  148



>ref|XP_011028598.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Populus euphratica]
 ref|XP_011028599.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Populus euphratica]
Length=186

 Score =   272 bits (696),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESIYEGGVWKIHVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLL+YPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLIYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKEQYDQKVKEYCERYAK  148



>ref|XP_006405361.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
 gb|ESQ46814.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum]
Length=148

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDYKVE INDGMQEF+VEF+GPK+S YQGGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDMMKLMMSDYKVETINDGMQEFFVEFNGPKDSLYQGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+ KIYHPNVDE+SGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NGEAAALMMRDR AYEQRVK
Sbjct  121  NGEAAALMMRDRPAYEQRVK  140



>ref|XP_006600652.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 
[Glycine max]
 ref|XP_006600653.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Glycine max]
 gb|KHN18475.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=184

 Score =   271 bits (693),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYAVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKKLYDQKVKEYCERYAK  148



>gb|KJB37063.1| hypothetical protein B456_006G188200 [Gossypium raimondii]
Length=247

 Score =   273 bits (699),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 164/185 (89%), Gaps = 2/185 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF V+FHGPKES Y+GGVW++RVELPDAYP
Sbjct  63   MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVKFHGPKESLYEGGVWKIRVELPDAYP  122

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            +KSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPSDPL
Sbjct  123  FKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSDPL  182

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD--AGVAPeekssddevsedeyassdeEIA  147
            NG+AA+LMM+DR  Y+Q+VKE+CE+YAK  D     A +E   +D++++++  SSD+EIA
Sbjct  183  NGDAASLMMKDRKQYDQKVKEYCERYAKKEDITKSAADKETDDEDDITDEDTGSSDDEIA  242

Query  146  GKADP  132
            G ADP
Sbjct  243  GHADP  247



>ref|XP_002321579.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
 gb|ABK95704.1| unknown [Populus trichocarpa]
 gb|EEF05706.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
Length=186

 Score =   271 bits (693),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ +F VEFHGPKES Y+GGVW++ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNDFNVEFHGPKESLYEGGVWKIHVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLL+YPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLIYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKEQYDQKVKEYCERYAK  148



>ref|XP_010254946.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254947.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254948.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
Length=184

 Score =   271 bits (692),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMM+DYKVE IND + EF+VEF+GP  S Y GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMTDYKVETINDSVSEFFVEFNGPPNSLYSGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVN+IYHPN+DEMSGSVCLDVINQTWSPMFDL+N+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNRIYHPNIDEMSGSVCLDVINQTWSPMFDLINIFEVFLPQLLLYPNPTDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD  228
            NGEAAALMMRDR  YEQ+VKE C +YAK  D
Sbjct  121  NGEAAALMMRDRKVYEQKVKEHCARYAKPED  151



>ref|NP_001241807.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
 gb|ACG48923.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
 tpg|DAA43377.1| TPA: putative ubiquitin-conjugating enzyme family isoform 1 [Zea 
mays]
 tpg|DAA43378.1| TPA: putative ubiquitin-conjugating enzyme family isoform 2 [Zea 
mays]
Length=168

 Score =   270 bits (690),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKV+M+NDGMQEF+VEF GP ES YQGG+WRVRVELPDAYPYKSPSIGF+NKIYHP
Sbjct  1    MMSDYKVDMVNDGMQEFFVEFRGPNESIYQGGIWRVRVELPDAYPYKSPSIGFINKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNG+AAALMMRDR AY
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGDAAALMMRDRPAY  120

Query  275  EQRVKEFCEKYAKATDAGVAP  213
            EQ+VKE+CEKYAK  DAGV+P
Sbjct  121  EQKVKEYCEKYAKPEDAGVSP  141



>ref|XP_010107447.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
 gb|EXC16031.1| Ubiquitin-conjugating enzyme E2 5 [Morus notabilis]
Length=186

 Score =   270 bits (691),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPK+S Y+GG W++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKDSLYEGGFWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SG+VCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGAVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM++R  Y+Q+VKE+CEKYAK
Sbjct  121  NGDAASLMMKNRKLYDQKVKEYCEKYAK  148



>gb|AFK44151.1| unknown [Lotus japonicus]
Length=186

 Score =   270 bits (691),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESLYEGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            +KSPSIGFVNKI+HPNVDE+SGSVCLDVINQ WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   FKSPSIGFVNKIFHPNVDELSGSVCLDVINQNWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKKLYDQKVKEYCERYAK  148



>ref|XP_009381635.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381636.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381637.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009381638.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=182

 Score =   270 bits (690),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE  NDG+ EF VEFHGPK+SPY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVETTNDGLTEFNVEFHGPKQSPYEGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGS+CLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPADPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+L+++D+  YEQ+VKE+CE+YAK
Sbjct  121  NGDAASLLLKDQQQYEQKVKEYCERYAK  148



>ref|XP_008780946.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Phoenix dactylifera]
Length=234

 Score =   272 bits (695),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKESPY+GGVW+V VELPDAYP
Sbjct  51   MSSPSKRRDMDVMKLMMSDYTVETINDGLSEFNVEFHGPKESPYEGGVWKVHVELPDAYP  110

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGS+CLDVINQ+WSPMFDL N+FEVFLPQLLLYPNP+DPL
Sbjct  111  YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLSNIFEVFLPQLLLYPNPADPL  170

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LM++D+  YEQ+VKE+CE+YAK
Sbjct  171  NGDAASLMLKDQQQYEQKVKEYCERYAK  198



>ref|XP_002280126.2| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Vitis vinifera]
 ref|XP_003634294.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Vitis vinifera]
 ref|XP_010663196.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa isoform X1 
[Vitis vinifera]
 emb|CBI15064.3| unnamed protein product [Vitis vinifera]
Length=184

 Score =   270 bits (689),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA++MM+++  YE++VKE+CE+YAK
Sbjct  121  NGDAASMMMKNKDQYEKKVKEYCERYAK  148



>ref|XP_004138119.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 ref|XP_004166497.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
 gb|KGN63598.1| hypothetical protein Csa_1G005590 [Cucumis sativus]
Length=188

 Score =   270 bits (690),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VEMINDG+ EF VEFHGPKES Y+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVEMINDGLSEFNVEFHGPKESLYEAGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D   Y+++VKE+CE+YAK
Sbjct  121  NGDAASLMMKDPKQYDEKVKEYCERYAK  148



>ref|XP_004155833.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Cucumis sativus]
Length=168

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKVEMINDG+QEFYV+FHGP ESPY GG+WR+RVELPDAYPYKSPSIGF+NKIYHP
Sbjct  1    MMSDYKVEMINDGVQEFYVDFHGPSESPYHGGLWRIRVELPDAYPYKSPSIGFLNKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AY
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRVAY  120

Query  275  EQRVKEFCEKYAKATDAGVAP  213
            EQ+VKE+CE+YAK  D   AP
Sbjct  121  EQKVKEYCERYAKPEDIVAAP  141



>gb|ACG24713.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
 tpg|DAA49814.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=174

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -3

Query  644  MKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKI  465
            +  MMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYPYKSPSIGF+NKI
Sbjct  4    LSWMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYPYKSPSIGFINKI  63

Query  464  YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  285
            YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR
Sbjct  64   YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  123

Query  284  TAYEQRVKEFCEKYAKATDAGVAP  213
              YEQ+VKE+CEKYAK  DAG+ P
Sbjct  124  PVYEQKVKEYCEKYAKPEDAGITP  147



>ref|XP_008453110.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 
[Cucumis melo]
Length=187

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VEMINDG+ EF VEFHGPKES Y+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVEMINDGLSEFNVEFHGPKESLYEAGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D   Y+++VKE+CE+YAK
Sbjct  121  NGDAASLMMKDPKQYDEKVKEYCERYAK  148



>ref|XP_006579381.1| PREDICTED: uncharacterized protein LOC100527526 isoform X1 [Glycine 
max]
 gb|KHN48608.1| Ubiquitin-conjugating enzyme E2 5 [Glycine soja]
Length=185

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEAFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKELYDQKVKEYCERYAK  148



>ref|XP_006397787.1| hypothetical protein EUTSA_v10001650mg [Eutrema salsugineum]
 gb|ESQ39240.1| hypothetical protein EUTSA_v10001650mg [Eutrema salsugineum]
Length=189

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 141/156 (90%), Gaps = 2/156 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAP  213
            NGEAA+L+MRDR AYEQ+VKE+C+ YAK  D  +AP
Sbjct  121  NGEAASLLMRDRAAYEQKVKEYCKTYAKPED--IAP  154



>gb|EYU44716.1| hypothetical protein MIMGU_mgv1a014494mg [Erythranthe guttata]
 gb|EYU44717.1| hypothetical protein MIMGU_mgv1a014494mg [Erythranthe guttata]
Length=187

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKESPY+GG W+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVEPINDGINEFNVEFHGPKESPYEGGFWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNP DPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPLDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+T Y+ +VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKTQYDLKVKEYCERYAK  148



>gb|KDP45387.1| hypothetical protein JCGZ_09636 [Jatropha curcas]
Length=217

 Score =   270 bits (690),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++ VELPDAYP
Sbjct  31   MSSPSKRRDMDVMKLMMSDYAVEPINDGISEFNVEFHGPKESLYEGGVWKIHVELPDAYP  90

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDEMSGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  91   YKSPSIGFLNKIFHPNVDEMSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  150

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  YE++VKE+CE YAK
Sbjct  151  NGDAASLMMKDKKQYEEKVKEYCELYAK  178



>ref|XP_008360712.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Malus domestica]
Length=168

 Score =   268 bits (684),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            M SDYKVEMINDGMQEFYV+F+GPKES YQGGVWR+RVEL DAYPYKSPSIGFVNKIYHP
Sbjct  1    MXSDYKVEMINDGMQEFYVDFNGPKESLYQGGVWRIRVELLDAYPYKSPSIGFVNKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAAL MRDRTAY
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALXMRDRTAY  120

Query  275  EQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            +QRVK +CEKYAK  D G A E++SSD+E+SE EY S D+ +AG ADP
Sbjct  121  DQRVKXYCEKYAKPEDIGGAREDQSSDEELSEGEYDSGDDAVAGHADP  168



>ref|XP_006580568.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Glycine max]
Length=168

 Score =   267 bits (683),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKVE INDGMQEF+VEFHGPK+SPYQGGVW+VRVELPDAYPYKSPSIGFVNKI+HP
Sbjct  1    MMSDYKVETINDGMQEFFVEFHGPKDSPYQGGVWKVRVELPDAYPYKSPSIGFVNKIFHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDE+SGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPN SDPLNG+AAALM+RD   Y
Sbjct  61   NVDEVSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNASDPLNGDAAALMIRDHATY  120

Query  275  EQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            EQRVKE+CEKYAK  D G A EE SSDDE+SED+YASSD+ I G+ DP
Sbjct  121  EQRVKEYCEKYAKPEDVGAAQEESSSDDELSEDDYASSDDAIVGQPDP  168



>ref|XP_010940565.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 
[Elaeis guineensis]
Length=186

 Score =   268 bits (685),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 136/165 (82%), Gaps = 22/165 (13%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKE-------------------  558
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYV+FHGPKE                   
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVDFHGPKEITLEAGRGMHQSLPLLTNF  60

Query  557  ---SPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFD  387
                 YQGGVW++RVELPDAYPYKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFD
Sbjct  61   RDFGLYQGGVWKIRVELPDAYPYKSPSIGFANKIYHPNVDEMSGSVCLDVINQTWSPMFD  120

Query  386  LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEFC  252
            LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR AYEQ+VK   
Sbjct  121  LVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKNIA  165



>ref|NP_566062.1| ubiquitin-conjugating enzyme E2 6 [Arabidopsis thaliana]
 sp|P42750.2|UBC6_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 6; AltName: Full=Ubiquitin 
carrier protein 6; AltName: Full=Ubiquitin-conjugating 
enzyme E2-21 kDa 3; AltName: Full=Ubiquitin-protein ligase 
6 [Arabidopsis thaliana]
 gb|AAB32508.1| UBC6=E2-related ubiquitin-conjugating protein [Arabidopsis thaliana, 
Peptide, 183 aa]
 gb|AAC62907.1| E2, ubiquitin-conjugating enzyme 6 (UBC6) [Arabidopsis thaliana]
 gb|AAO63272.1| At2g46030 [Arabidopsis thaliana]
 gb|AAY44847.1| ubiquitinating enzyme [Arabidopsis thaliana]
 dbj|BAF00193.1| putative ubiquitin-conjugating enzyme E2 [Arabidopsis thaliana]
 gb|AEC10634.1| ubiquitin-conjugating enzyme E2 6 [Arabidopsis thaliana]
Length=183

 Score =   268 bits (684),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ +ND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAA+L+MRDR AYE +VKE+CEKYAK  +     ++  S  E   D     D+EI GK
Sbjct  121  NGEAASLLMRDRAAYELKVKEYCEKYAKPEEILSDDDDDDSMSEDGSDSDDDDDDEIVGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_002511435.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF52037.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=184

 Score =   268 bits (684),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPK S Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNEFNVEFHGPKGSLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+DR  Y+++VKE+ +KYAK
Sbjct  121  NGDAASLMMKDREQYDEKVKEYLDKYAK  148



>ref|NP_001237311.1| uncharacterized protein LOC100527526 [Glycine max]
 gb|ACU16622.1| unknown [Glycine max]
Length=185

 Score =   268 bits (684),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY +E INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYTMETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEAFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  121  NGDAASLMMKDKELYDQKVKEYCERYAK  148



>ref|XP_010506595.1| PREDICTED: ubiquitin-conjugating enzyme E2 6-like [Camelina sativa]
Length=183

 Score =   267 bits (683),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 149/183 (81%), Gaps = 0/183 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NGEAA+L+MRDR AYE +VKE+C+KYA+      + ++       +  +      EI GK
Sbjct  121  NGEAASLLMRDRAAYELKVKEYCDKYAQPEKENSSDDDDDDSMSENGSDSDDDANEIVGK  180

Query  140  ADP  132
            ADP
Sbjct  181  ADP  183



>ref|XP_010271991.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
Length=184

 Score =   267 bits (683),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 160/184 (87%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVEPINDGINEFNVEFHGPKESLYEGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLL YPNPSDPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLRYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedey-assdeEIAG  144
            NG+AA+LM++D+  YE +VKE+CE+YAK  +    P E+SSDDE   D    SSD+E+AG
Sbjct  121  NGDAASLMLKDQQQYEHKVKEYCERYAKRENITNVPTEESSDDEDISDGECESSDDEVAG  180

Query  143  KADP  132
             ADP
Sbjct  181  HADP  184



>ref|XP_002882046.1| ubiquitin-conjugating enzyme 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58305.1| ubiquitin-conjugating enzyme 6 [Arabidopsis lyrata subsp. lyrata]
Length=186

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAA+L+MRDR AYE +VKE+CEKYAK
Sbjct  121  NGEAASLLMRDRAAYELKVKEYCEKYAK  148



>ref|XP_009142401.1| PREDICTED: ubiquitin-conjugating enzyme E2 6-like [Brassica rapa]
 emb|CDY37084.1| BnaA04g26620D [Brassica napus]
Length=189

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S Y+GGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGV  219
            NGEAA+L+MRDR AYE++VKE+C+ YAK  D G 
Sbjct  121  NGEAASLLMRDRAAYEKKVKEYCKAYAKPEDIGA  154



>ref|XP_010254271.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254278.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
 ref|XP_010254285.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Nelumbo 
nucifera]
Length=184

 Score =   266 bits (680),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 161/184 (88%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW+V VELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVEPINDGINEFNVEFHGPKESLYEGGVWKVHVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLL YPNPSDPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLRYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsed-eyassdeEIAG  144
            NG+AA+LM++D+  YEQ+VKE+CE YAK  +    P E+SSDDE + D +  +SD+++AG
Sbjct  121  NGDAASLMLKDQQQYEQKVKEYCELYAKRENITNVPTEESSDDEDTSDGQSTTSDDDVAG  180

Query  143  KADP  132
             ADP
Sbjct  181  HADP  184



>gb|AFK33447.1| unknown [Lotus japonicus]
Length=178

 Score =   265 bits (677),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSP+KRR+MD MKLMMSDYKVE IND MQEF+VEFHGPK SPYQ GVW+++VE+PDAYP
Sbjct  1    MSSPTKRRDMDFMKLMMSDYKVETINDDMQEFFVEFHGPKNSPYQDGVWKLKVEIPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            +KSPSIGFVNKIYHPN+DE SG++CLDVINQ WSPM+DL+NVFEVFLPQLLLYPN SDP+
Sbjct  61   FKSPSIGFVNKIYHPNIDEPSGTICLDVINQRWSPMYDLINVFEVFLPQLLLYPNASDPM  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVA  216
            N +AA LM++D  AYEQ+V+E+CEKYAK  D G  
Sbjct  121  NADAADLMLKDPAAYEQKVREYCEKYAKPEDIGAT  155



>emb|CDY27337.1| BnaC04g50680D [Brassica napus]
Length=189

 Score =   265 bits (678),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S Y+GGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKI+HPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIFHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGV  219
            NGEAA+L+MRDR AYE++VKE+C+ YAK  D G 
Sbjct  121  NGEAASLLMRDRAAYEKKVKEYCKAYAKPEDIGA  154



>ref|NP_001148188.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
 gb|ACG30125.1| ubiquitin-conjugating enzyme E2-21 kDa 1 [Zea mays]
Length=174

 Score =   265 bits (677),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  644  MKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKI  465
            +  MMSDYKVEM+NDGMQEF+VEF GP ES YQGGVW+VRVELPDAYPYKSPSIGF+NKI
Sbjct  4    LSWMMSDYKVEMVNDGMQEFFVEFKGPAESIYQGGVWKVRVELPDAYPYKSPSIGFINKI  63

Query  464  YHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  285
            YHPNVDEMSGSV LDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR
Sbjct  64   YHPNVDEMSGSVYLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDR  123

Query  284  TAYEQRVKEFCEKYAKATDAGVAP  213
              YEQ+VKE+CEKYAK  DAG+ P
Sbjct  124  PVYEQKVKEYCEKYAKPEDAGITP  147



>ref|XP_010508073.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 [Camelina sativa]
Length=187

 Score =   265 bits (678),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAA+L+MRDR AYE +VKE+C+KYA+
Sbjct  121  NGEAASLLMRDRAAYELKVKEYCDKYAQ  148



>ref|XP_010518259.1| PREDICTED: ubiquitin-conjugating enzyme E2 6-like [Camelina sativa]
Length=181

 Score =   265 bits (677),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NGEAA+L+MRDR AYE +VKE+C+KYA+
Sbjct  121  NGEAASLLMRDRAAYELKVKEYCDKYAQ  148



>ref|XP_009133760.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 [Brassica rapa]
 emb|CDX83382.1| BnaA03g21240D [Brassica napus]
Length=187

 Score =   265 bits (677),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 154/187 (82%), Gaps = 4/187 (2%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ +ND +  FYV FHGP +S Y+GGVW+++VELPDAYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLHMFYVTFHGPTDSLYEGGVWKIKVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAG----VAPeekssddevsedeyassdeE  153
            NGEAA+L+MRDR AYE +VKE+C++YAK  D G    ++ ++   D        +  ++E
Sbjct  121  NGEAASLLMRDRPAYELKVKEYCKRYAKPEDIGAPEEISSDDDDDDSMSERGSDSDDNDE  180

Query  152  IAGKADP  132
            +AGKADP
Sbjct  181  VAGKADP  187



>ref|XP_006295060.1| hypothetical protein CARUB_v10024128mg [Capsella rubella]
 gb|EOA27958.1| hypothetical protein CARUB_v10024128mg [Capsella rubella]
Length=187

 Score =   265 bits (676),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ +ND +Q FYV FHGP +S Y+GGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVF+ FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFDSFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKA  234
            NGEAA+L+MRDR AYE +VKE+CEKYAKA
Sbjct  121  NGEAASLLMRDRPAYELKVKEYCEKYAKA  149



>emb|CDX95674.1| BnaC03g25550D [Brassica napus]
Length=187

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 154/187 (82%), Gaps = 4/187 (2%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ +ND +  FYV FHGP +S Y+GGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTVNDDLHMFYVTFHGPTDSLYEGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAG----VAPeekssddevsedeyassdeE  153
            NGEAA+L+MRDR AYE +VKE+C++YAK  D G    ++ ++   D        +  ++E
Sbjct  121  NGEAASLLMRDRPAYELKVKEYCKRYAKPEDIGAPEEISSDDDDDDSMSERGSDSDDNDE  180

Query  152  IAGKADP  132
            IAGKADP
Sbjct  181  IAGKADP  187



>gb|AFK45061.1| unknown [Lotus japonicus]
Length=195

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSP+KRR+MD MKLMMSDYKVE IND MQEF+VEFHGPK SPYQ GVW+++VE+PDAYP
Sbjct  1    MSSPTKRRDMDFMKLMMSDYKVETINDDMQEFFVEFHGPKNSPYQDGVWKLKVEIPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            +KSPSIGFVNKIYHPN+DE SG++CLDVINQ WSPM+DL+NVFEVFLPQLLLYPN SDP+
Sbjct  61   FKSPSIGFVNKIYHPNIDEPSGTICLDVINQRWSPMYDLINVFEVFLPQLLLYPNASDPM  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVA  216
            N +AA LM++D  AYEQ+V+E+CEKYAK  D G  
Sbjct  121  NADAADLMLKDPAAYEQKVREYCEKYAKPEDIGAT  155



>ref|XP_006584539.1| PREDICTED: uncharacterized protein LOC100527756 isoform X1 [Glycine 
max]
Length=168

 Score =   263 bits (672),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKVE +NDGMQEF+VEFHGPK+SPYQGGVW+VRV+LPDAYPYKSPSIGFVNKI+HP
Sbjct  1    MMSDYKVETVNDGMQEFFVEFHGPKDSPYQGGVWKVRVDLPDAYPYKSPSIGFVNKIFHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVI+QTWSPMFDLVNVFEVFLPQLLLYPN SDPLNG+AAALM+RD   Y
Sbjct  61   NVDEMSGSVCLDVISQTWSPMFDLVNVFEVFLPQLLLYPNASDPLNGDAAALMIRDHATY  120

Query  275  EQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            EQRVKE+CEKYAK  D G   EE SSDDE SED+YASSD+ I G+ DP
Sbjct  121  EQRVKEYCEKYAKPEDVGAVQEESSSDDEPSEDDYASSDDAIVGQPDP  168



>ref|XP_008360711.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X1 [Malus domestica]
Length=169

 Score =   263 bits (672),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            M SDYKVEMINDGMQEFYV+F+GPKES YQGGVWR+RVEL DAYPYKSPSIGFVNKIYHP
Sbjct  1    MXSDYKVEMINDGMQEFYVDFNGPKESLYQGGVWRIRVELLDAYPYKSPSIGFVNKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAAL MRDRTAY
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALXMRDRTAY  120

Query  275  EQRVK-EFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            +QRVK  +CEKYAK  D G A E++SSD+E+SE EY S D+ +AG ADP
Sbjct  121  DQRVKGXYCEKYAKPEDIGGAREDQSSDEELSEGEYDSGDDAVAGHADP  169



>ref|XP_010678729.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Beta 
vulgaris subsp. vulgaris]
Length=184

 Score =   263 bits (672),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 161/184 (88%), Gaps = 1/184 (1%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF + F+GPK+S Y+GGVW+V VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYSVETINDGLNEFNILFNGPKDSLYEGGVWKVHVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKIYHPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN  DPL
Sbjct  61   YKSPSIGFINKIYHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNALDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGV-APeekssddevsedeyassdeEIAG  144
            NG+AA+LMM+DR  YEQ+VKE+C++YAK  +  +   E++S ++E+S+ +  SSD+EIAG
Sbjct  121  NGDAASLMMKDRQQYEQKVKEYCDRYAKKENFSIQGAEDESDEEEISDGQSESSDDEIAG  180

Query  143  KADP  132
             ADP
Sbjct  181  HADP  184



>gb|KFK37384.1| hypothetical protein AALP_AA4G250300 [Arabis alpina]
Length=188

 Score =   261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSDYKV+ IND +Q FYV FHGP +S YQGGVW+++VELP+AYP
Sbjct  1    MASPSKRREMDMMKLMMSDYKVDTINDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GFVNKIYHPNVDE SG+VCLDVINQTWSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct  61   YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYA  240
            NGEAA+L+MRDR AYE++VKE+C+ YA
Sbjct  121  NGEAASLLMRDRPAYEKKVKEYCKLYA  147



>ref|XP_006374516.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
 gb|ERP52313.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
Length=182

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 137/148 (93%), Gaps = 4/148 (3%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ +F VEFHGPKES    GVW++ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNDFNVEFHGPKES----GVWKIHVELPDAYP  56

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLL+YPNPSDPL
Sbjct  57   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLIYPNPSDPL  116

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+D+  Y+Q+VKE+CE+YAK
Sbjct  117  NGDAASLMMKDKEQYDQKVKEYCERYAK  144



>gb|KEH21089.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=167

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MM+DYKVEMIND MQEF+V+FHGPK+SPYQ GVW++RVELPDAYPYKSPSIGFVNKIYHP
Sbjct  1    MMTDYKVEMINDCMQEFFVQFHGPKDSPYQEGVWKIRVELPDAYPYKSPSIGFVNKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDE+SGSVCLDVINQTWSPMFDLVNVFEVFLPQLL+YPN SDPLN EAA+LMMRDR AY
Sbjct  61   NVDEISGSVCLDVINQTWSPMFDLVNVFEVFLPQLLIYPNASDPLNDEAASLMMRDRAAY  120

Query  275  EQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            EQ+VKE+CEKYAK  D G A  E+SSDDE+SED+YASSD+ IAGK DP
Sbjct  121  EQKVKEYCEKYAKPEDIG-ASHEESSDDELSEDDYASSDDGIAGKPDP  167



>ref|XP_009397799.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=168

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKVEM NDGM EF V+FHGPKESPYQGGVWR+RVELPD YPY SPSIGFVNK+YHP
Sbjct  1    MMSDYKVEMTNDGMHEFLVDFHGPKESPYQGGVWRIRVELPDGYPYHSPSIGFVNKMYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGS+CLDVINQTWSPM+DLVNVFEVFLPQLLLYPNP DPLNGEAAAL+MRD  AY
Sbjct  61   NVDEMSGSICLDVINQTWSPMYDLVNVFEVFLPQLLLYPNPLDPLNGEAAALLMRDEPAY  120

Query  275  EQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            EQ+VKE+C KYAK  D G +PEEKSSD+E+SE+E  SSDE++ GK DP
Sbjct  121  EQKVKEYCLKYAKPEDIGASPEEKSSDEELSENECDSSDEQMLGKPDP  168



>ref|XP_008351691.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like, partial [Malus 
domestica]
Length=149

 Score =   258 bits (660),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 131/141 (93%), Gaps = 1/141 (1%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            M SDYKVEMINDGMQEFYV+F+GPKES YQGGVWR+RVEL DAYPYKSPSIGFVNKIYHP
Sbjct  1    MXSDYKVEMINDGMQEFYVDFNGPKESLYQGGVWRIRVELLDAYPYKSPSIGFVNKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAAL MRDRTAY
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALXMRDRTAY  120

Query  275  EQRVKE-FCEKYAKATDAGVA  216
            +QRVK  +CEKYAK  D G A
Sbjct  121  DQRVKGVYCEKYAKPEDIGGA  141



>gb|AAG52444.1|AC010852_1 putative ubiquitin-conjugating enzyme; 71876-72824 [Arabidopsis 
thaliana]
Length=170

 Score =   259 bits (662),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKVEMINDGMQEF+VEF GPK+S Y+GGVW++RVELPDAYPYKSPS+GF+ KIYHP
Sbjct  1    MMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYPYKSPSVGFITKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDEMSGSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPLNGEAAALMMRDR  Y
Sbjct  61   NVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTY  120

Query  275  EQRVKEFCEKYAK  237
            EQRVKE+CEKYAK
Sbjct  121  EQRVKEYCEKYAK  133



>ref|XP_010559098.1| PREDICTED: ubiquitin-conjugating enzyme E2 6 isoform X2 [Tarenaya 
hassleriana]
Length=168

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 149/168 (89%), Gaps = 0/168 (0%)
 Frame = -3

Query  635  MMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHP  456
            MMSDYKVEMIND M+ FYV FHGP +S YQGGVWR+RVELPD+YPYKSPS+GFVNKIYHP
Sbjct  1    MMSDYKVEMINDEMRAFYVRFHGPTDSLYQGGVWRIRVELPDSYPYKSPSVGFVNKIYHP  60

Query  455  NVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAY  276
            NVDE SGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDP NGEAA+LMMRDR AY
Sbjct  61   NVDESSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPFNGEAASLMMRDRAAY  120

Query  275  EQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGKADP  132
            EQ+VKE+C++YAK  D G A EE SSDDE+SED   S D+E+ G+ADP
Sbjct  121  EQKVKEYCKRYAKPVDIGAASEENSSDDEMSEDGSDSDDDEMVGQADP  168



>ref|XP_010037581.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Eucalyptus 
grandis]
 ref|XP_010037582.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Eucalyptus 
grandis]
 gb|KCW49308.1| hypothetical protein EUGRSUZ_K02864 [Eucalyptus grandis]
Length=184

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRRE D+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++ V+LPDAYP
Sbjct  1    MSSPSKRRERDVMKLMMSDYTVETINDGLNEFNVEFHGPKESLYEGGVWKIWVKLPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSI FVNKIYHPNV+EMSGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPS  L
Sbjct  61   YKSPSIKFVNKIYHPNVNEMSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSSFL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            NG+AA+LMM+DR  Y+Q+VKE+C++YAK
Sbjct  121  NGDAASLMMKDRKQYDQKVKEYCKQYAK  148



>ref|XP_010913549.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X4 
[Elaeis guineensis]
Length=198

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF VEFHGPKESPY+GGVW+VRVELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYIVETINDGLSEFNVEFHGPKESPYEGGVWKVRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGF+NKI+HPNVDE+SGS+CLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPADPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFC  252
            NG+AA+LM++D+  YEQ+VK   
Sbjct  121  NGDAASLMLKDQQQYEQKVKNIV  143



>ref|XP_010913548.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X3 [Elaeis guineensis]
Length=205

 Score =   259 bits (661),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 141/169 (83%), Gaps = 21/169 (12%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLM---------------------MSDYKVEMINDGMQEFYVEFHGP  564
            MSSPSKRR+MD+MK M                     MSDY VE INDG+ EF VEFHGP
Sbjct  1    MSSPSKRRDMDVMKFMERCQGAMQTPQYACSVWQGRMMSDYIVETINDGLSEFNVEFHGP  60

Query  563  KESPYQGGVWRVRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDL  384
            KESPY+GGVW+VRVELPDAYPYKSPSIGF+NKI+HPNVDE+SGS+CLDVINQ+WSPMFDL
Sbjct  61   KESPYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSICLDVINQSWSPMFDL  120

Query  383  VNVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            +N+FEVFLPQLLLYPNP+DPLNG+AA+LM++D+  YEQ+VKE+CE+YAK
Sbjct  121  LNIFEVFLPQLLLYPNPADPLNGDAASLMLKDQQQYEQKVKEYCERYAK  169



>ref|XP_005650676.1| ubiquitin conjugating enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE26132.1| ubiquitin conjugating enzyme [Coccomyxa subellipsoidea C-169]
Length=190

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            M+SPSKRREMD+MKLMMSD+KVE++ND + E YVEF GPK+SPY+GG WRV VELPD YP
Sbjct  1    MTSPSKRREMDVMKLMMSDWKVELVNDSVNELYVEFQGPKDSPYEGGFWRVHVELPDGYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVN+IYHPNVDEM+GSVCLDVINQTWSPMFDL+NVFE FLPQLLLYPNP+DPL
Sbjct  61   YKSPSIGFVNRIYHPNVDEMAGSVCLDVINQTWSPMFDLLNVFETFLPQLLLYPNPTDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAG  222
            NGEAAAL+MR+  AY  +VKE   ++AK  D  
Sbjct  121  NGEAAALLMREPEAYNAKVKECTARFAKKEDVA  153



>ref|XP_002517368.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
 gb|EEF44910.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis]
Length=186

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRR+MD+MKLMMSDY VE INDG+ EF V+FHGPK S Y+GGVW++ VELPDAYP
Sbjct  1    MSSPSKRRDMDVMKLMMSDYTVEPINDGINEFNVKFHGPKRSLYEGGVWKIHVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPS+GF+NKIYHPNVDEMSGSVCLDVINQ+W+PMFDL N+FE FLPQLLLYPNPSDPL
Sbjct  61   YKSPSVGFLNKIYHPNVDEMSGSVCLDVINQSWNPMFDLFNIFEDFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            N +A +LM++D+  YE++VKE+CE+YAK
Sbjct  121  NSDAGSLMIKDKKLYEEKVKEYCERYAK  148



>ref|XP_006600654.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X3 
[Glycine max]
Length=160

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ EF VEFHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYAVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPN SDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNASDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NG+AA+LMM+D+  Y+Q+VK
Sbjct  121  NGDAASLMMKDKKLYDQKVK  140



>gb|EMT26310.1| Ubiquitin-conjugating enzyme E2-23 kDa [Aegilops tauschii]
Length=211

 Score =   256 bits (653),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 137/164 (84%), Gaps = 8/164 (5%)
 Frame = -3

Query  728  SIQEFEGERTRK*KVIMSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPY  549
            SI      RT    +I++  S R        MMSDYKV+MINDGMQEF+V FHGPK+S Y
Sbjct  19   SIHSLSLVRTVDSCLILACFSCR--------MMSDYKVDMINDGMQEFFVHFHGPKDSIY  70

Query  548  QGGVWRVRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFE  369
            QGGVW+VRVEL +AYPYKSPSIGF NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVN+FE
Sbjct  71   QGGVWKVRVELTEAYPYKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFE  130

Query  368  VFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEFCEKYAK  237
            VFLPQLLLYPNPSDPLNGEAA+LMMRD+ AYE +VKE+CE+YAK
Sbjct  131  VFLPQLLLYPNPSDPLNGEAASLMMRDKNAYENKVKEYCERYAK  174



>ref|XP_008453111.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X2 
[Cucumis melo]
Length=171

 Score =   254 bits (649),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VEMINDG+ EF VEFHGPKES Y+ GVW++RVELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVEMINDGLSEFNVEFHGPKESLYEAGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NG+AA+LMM+D   Y+++VK
Sbjct  121  NGDAASLMMKDPKQYDEKVK  140



>ref|XP_006374515.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
 gb|ERP52312.1| hypothetical protein POPTR_0015s08470g [Populus trichocarpa]
Length=159

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMD+MKLMMSDY VE INDG+ +F VEFHGPKES Y+GGVW++ VELPDAYP
Sbjct  1    MSSPSKRREMDVMKLMMSDYNVETINDGLNDFNVEFHGPKESLYEGGVWKIHVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLL+YPNPSDPL
Sbjct  61   YKSPSIGFVNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLIYPNPSDPL  120

Query  320  NGEAAALMMRDRTAYEQRVK  261
            NG+AA+LMM+D+  Y+Q+VK
Sbjct  121  NGDAASLMMKDKEQYDQKVK  140



>gb|KJB08192.1| hypothetical protein B456_001G070300 [Gossypium raimondii]
Length=185

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSS SKRREMD+MKLMM+DY VE IND + EF V FHGPKES Y+GGVW++RVELPDAYP
Sbjct  1    MSSQSKRREMDVMKLMMNDYVVETINDILNEFIVGFHGPKESLYEGGVWKIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSI FVNKI HPNVDE SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPS PL
Sbjct  61   YKSPSIRFVNKILHPNVDETSGSVCLDVINQSWSPMFDLLNIFEVFLPQLLLYPNPSHPL  120

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATD  228
            N +AA+LMM+DR  Y+Q+VKEFCE YAK  D
Sbjct  121  NRDAASLMMKDRKQYDQKVKEFCELYAKKED  151



>ref|XP_008438167.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like isoform 
X2 [Cucumis melo]
Length=176

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 140/157 (89%), Gaps = 10/157 (6%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSP+KRR+MD+MKLMMSDYKVEMI+DG+ EF VEF+GPKES Y+GGVW++ VELPDAYP
Sbjct  1    MSSPNKRRDMDVMKLMMSDYKVEMIDDGLSEFNVEFNGPKESVYEGGVWKIHVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDE+SGSVCLDVINQTWSPMF       VFLPQLLLYPNPSDPL
Sbjct  61   YKSPSIGFVNKIYHPNVDELSGSVCLDVINQTWSPMF-------VFLPQLLLYPNPSDPL  113

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAK---ATDAGV  219
            NG+AA+LM++DR+ Y+Q+VKE+CE+YAK    T++G 
Sbjct  114  NGDAASLMLKDRSQYDQKVKEYCERYAKRENVTNSGA  150



>ref|XP_010255297.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 isoform X2 [Nelumbo 
nucifera]
Length=163

 Score =   252 bits (643),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 153/183 (84%), Gaps = 20/183 (11%)
 Frame = -3

Query  680  MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYP  501
            MSSPSKRREMDLMKLMMSDYKVEMINDGMQEF+V+F+GP +SPY GGVWR+RVELPDAYP
Sbjct  1    MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFHVDFNGPSDSPYHGGVWRIRVELPDAYP  60

Query  500  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL  321
            YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF                    DPL
Sbjct  61   YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMF--------------------DPL  100

Query  320  NGEAAALMMRDRTAYEQRVKEFCEKYAKATDAGVAPeekssddevsedeyassdeEIAGK  141
            NG+AAALMMRDR AYEQ+VKE+CEKYAK  D G A EEKSSD+E+SEDEYASSD+ +AG 
Sbjct  101  NGDAAALMMRDRAAYEQKVKEYCEKYAKPEDIGAAMEEKSSDEELSEDEYASSDDAVAGH  160

Query  140  ADP  132
            ADP
Sbjct  161  ADP  163



>ref|XP_005849389.1| hypothetical protein CHLNCDRAFT_57433 [Chlorella variabilis]
 gb|EFN57287.1| hypothetical protein CHLNCDRAFT_57433 [Chlorella variabilis]
Length=200

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  677  SSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVEFHGPKESPYQGGVWRVRVELPDAYPY  498
            SSPS+RRE D+MKLMMSD++VE++ D + EF+V F GP ESPY+GGVWRV VELP+AYPY
Sbjct  5    SSPSRRREQDVMKLMMSDWQVELVEDNISEFHVVFKGPPESPYEGGVWRVHVELPEAYPY  64

Query  497  KSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPLN  318
            KSPSIGFVNKIYHPN+DE +GSVCLDVINQTWSPMFDLVNVFE FLPQLLLYPNPSDPLN
Sbjct  65   KSPSIGFVNKIYHPNIDEGAGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLN  124

Query  317  GEAAALMMRDRTAYEQRVKEFCEKYAKATDAGV  219
            GEAAAL MRD  AY+++VK++  +YAKA D   
Sbjct  125  GEAAALHMRDPGAYQKKVKDYVVRYAKAEDVAA  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470