BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF020M04

Length=691
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO36650.1|  hypothetical protein CISIN_1g028965mg                   239   1e-75   Citrus sinensis [apfelsine]
ref|XP_009354238.1|  PREDICTED: probable serine incorporator            243   3e-74   Pyrus x bretschneideri [bai li]
ref|XP_011073234.1|  PREDICTED: probable serine incorporator            240   2e-73   Sesamum indicum [beniseed]
ref|XP_007215456.1|  hypothetical protein PRUPE_ppa006404mg             239   2e-73   
ref|XP_006493450.1|  PREDICTED: probable serine incorporator-like       240   3e-73   Citrus sinensis [apfelsine]
ref|XP_008228861.1|  PREDICTED: probable serine incorporator            239   4e-73   Prunus mume [ume]
ref|XP_007215457.1|  hypothetical protein PRUPE_ppa006404mg             239   4e-73   Prunus persica
ref|XP_006427689.1|  hypothetical protein CICLE_v10025720mg             239   4e-73   Citrus clementina [clementine]
gb|KJB67006.1|  hypothetical protein B456_010G170100                    239   6e-73   Gossypium raimondii
gb|KHG09631.1|  Serine incorporator 3                                   239   8e-73   Gossypium arboreum [tree cotton]
gb|KJB68285.1|  hypothetical protein B456_010G236500                    238   1e-72   Gossypium raimondii
gb|KJB68287.1|  hypothetical protein B456_010G236500                    238   1e-72   Gossypium raimondii
ref|XP_008342757.1|  PREDICTED: probable serine incorporator            238   1e-72   
ref|XP_004158797.1|  PREDICTED: probable serine incorporator-like       238   2e-72   
ref|XP_008381162.1|  PREDICTED: probable serine incorporator            237   3e-72   
ref|XP_009365247.1|  PREDICTED: probable serine incorporator            236   9e-72   Pyrus x bretschneideri [bai li]
ref|XP_007024820.1|  Serinc-domain containing serine and sphingol...    235   2e-71   
ref|XP_011466994.1|  PREDICTED: serine incorporator 3                   232   3e-70   Fragaria vesca subsp. vesca
ref|XP_009759114.1|  PREDICTED: probable serine incorporator isof...    232   3e-70   Nicotiana sylvestris
ref|XP_010318692.1|  PREDICTED: probable serine incorporator            231   6e-70   Solanum lycopersicum
ref|XP_009615680.1|  PREDICTED: serine incorporator 3 isoform X2        231   6e-70   
gb|KJB68286.1|  hypothetical protein B456_010G236500                    231   8e-70   Gossypium raimondii
ref|XP_009615679.1|  PREDICTED: probable serine incorporator isof...    230   2e-69   Nicotiana tomentosiformis
ref|XP_006341429.1|  PREDICTED: probable serine incorporator-like...    229   4e-69   Solanum tuberosum [potatoes]
gb|KDO36651.1|  hypothetical protein CISIN_1g028965mg                   219   1e-68   Citrus sinensis [apfelsine]
ref|XP_004135884.1|  PREDICTED: probable serine incorporator-like       227   2e-68   
gb|AFK43836.1|  unknown                                                 220   2e-68   Medicago truncatula
ref|XP_002270610.1|  PREDICTED: probable serine incorporator            225   2e-67   Vitis vinifera
ref|XP_009759116.1|  PREDICTED: probable serine incorporator isof...    224   3e-67   Nicotiana sylvestris
gb|EYU21792.1|  hypothetical protein MIMGU_mgv1a007183mg                224   4e-67   Erythranthe guttata [common monkey flower]
ref|XP_011020548.1|  PREDICTED: probable serine incorporator            224   6e-67   Populus euphratica
gb|EMS53525.1|  putative serine incorporator                            220   8e-67   Triticum urartu
ref|XP_009615681.1|  PREDICTED: probable serine incorporator isof...    223   1e-66   Nicotiana tomentosiformis
gb|ABR25551.1|  serine incorporator 3                                   216   2e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_011082649.1|  PREDICTED: probable serine incorporator            222   2e-66   Sesamum indicum [beniseed]
ref|XP_006341430.1|  PREDICTED: probable serine incorporator-like...    222   2e-66   Solanum tuberosum [potatoes]
ref|XP_008461193.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    222   2e-66   Cucumis melo [Oriental melon]
ref|XP_007140603.1|  hypothetical protein PHAVU_008G126100g             222   3e-66   Phaseolus vulgaris [French bean]
ref|XP_009399576.1|  PREDICTED: probable serine incorporator            221   4e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP41926.1|  hypothetical protein JCGZ_26944                         221   7e-66   Jatropha curcas
ref|XP_010268463.1|  PREDICTED: serine incorporator 3-like              221   8e-66   Nelumbo nucifera [Indian lotus]
gb|EMT13726.1|  Putative serine incorporator                            220   1e-65   
ref|XP_004492298.1|  PREDICTED: probable serine incorporator-like       219   4e-65   Cicer arietinum [garbanzo]
ref|XP_010687311.1|  PREDICTED: probable serine incorporator            218   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003570284.1|  PREDICTED: probable serine incorporator            217   2e-64   Brachypodium distachyon [annual false brome]
gb|AFK46909.1|  unknown                                                 215   2e-64   Lotus japonicus
gb|EYU21795.1|  hypothetical protein MIMGU_mgv1a007183mg                217   2e-64   Erythranthe guttata [common monkey flower]
gb|KEH22798.1|  serinc-domain serine and sphingolipid biosynthesi...    216   3e-64   Medicago truncatula
gb|KEH22799.1|  serinc-domain serine and sphingolipid biosynthesi...    216   4e-64   Medicago truncatula
ref|XP_010107188.1|  putative serine incorporator                       216   5e-64   Morus notabilis
ref|XP_006649122.1|  PREDICTED: probable serine incorporator-like       214   9e-64   
emb|CDO98258.1|  unnamed protein product                                214   2e-63   Coffea canephora [robusta coffee]
gb|EAZ24909.1|  hypothetical protein OsJ_08689                          214   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048364.1|  Os02g0792900                                       214   2e-63   
ref|XP_008790112.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    214   4e-63   Phoenix dactylifera
ref|XP_008794380.1|  PREDICTED: probable serine incorporator            213   1e-62   Phoenix dactylifera
ref|XP_009383181.1|  PREDICTED: probable serine incorporator            212   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK96018.1|  unknown                                                 211   5e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010532058.1|  PREDICTED: serine incorporator 3                   211   6e-62   Tarenaya hassleriana [spider flower]
ref|XP_010914044.1|  PREDICTED: probable serine incorporator            210   1e-61   Elaeis guineensis
ref|XP_010929190.1|  PREDICTED: probable serine incorporator isof...    210   1e-61   Elaeis guineensis
ref|XP_002454688.1|  hypothetical protein SORBIDRAFT_04g035670          209   1e-61   Sorghum bicolor [broomcorn]
ref|XP_010929191.1|  PREDICTED: probable serine incorporator isof...    209   1e-61   Elaeis guineensis
ref|XP_004954190.1|  PREDICTED: probable serine incorporator-like       209   2e-61   Setaria italica
ref|XP_010459155.1|  PREDICTED: probable serine incorporator            209   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006307669.1|  hypothetical protein CARUB_v10009295mg             209   3e-61   Capsella rubella
ref|XP_011034606.1|  PREDICTED: probable serine incorporator            209   3e-61   Populus euphratica
ref|XP_010497691.1|  PREDICTED: probable serine incorporator            208   4e-61   Camelina sativa [gold-of-pleasure]
ref|XP_002297693.2|  TMS membrane family protein                        208   4e-61   
ref|XP_010063622.1|  PREDICTED: probable serine incorporator isof...    208   5e-61   
ref|NP_001130490.1|  hypothetical protein precursor                     208   6e-61   Zea mays [maize]
gb|ACL54492.1|  unknown                                                 208   6e-61   Zea mays [maize]
ref|XP_006845424.1|  hypothetical protein AMTR_s00019p00091080          207   2e-60   Amborella trichopoda
ref|XP_010476724.1|  PREDICTED: serine incorporator 3                   206   4e-60   Camelina sativa [gold-of-pleasure]
gb|KCW70853.1|  hypothetical protein EUGRSUZ_F03990                     202   5e-60   Eucalyptus grandis [rose gum]
emb|CDY52849.1|  BnaA09g56410D                                          205   5e-60   Brassica napus [oilseed rape]
ref|XP_010246591.1|  PREDICTED: serine incorporator 3-like              205   9e-60   
ref|XP_009117776.1|  PREDICTED: serine incorporator 3 isoform X2        205   1e-59   Brassica rapa
emb|CDX81752.1|  BnaC08g38490D                                          204   3e-59   
ref|XP_009110458.1|  PREDICTED: serine incorporator 3-like              203   3e-59   Brassica rapa
emb|CDY70974.1|  BnaAnng35710D                                          203   3e-59   Brassica napus [oilseed rape]
ref|XP_003532291.1|  PREDICTED: probable serine incorporator-like       202   7e-59   Glycine max [soybeans]
ref|XP_010063623.1|  PREDICTED: probable serine incorporator isof...    202   7e-59   Eucalyptus grandis [rose gum]
ref|XP_003552131.1|  PREDICTED: probable serine incorporator-like       202   1e-58   Glycine max [soybeans]
ref|XP_002890152.1|  TMS membrane family protein                        201   4e-58   
ref|XP_002512768.1|  Membrane protein PB1A10.07c, putative              200   8e-58   
ref|NP_173069.1|  Serinc-domain containing serine and sphingolipi...    199   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416842.1|  hypothetical protein EUTSA_v10007762mg             198   2e-57   Eutrema salsugineum [saltwater cress]
gb|ABR17762.1|  unknown                                                 196   2e-56   Picea sitchensis
emb|CDX83957.1|  BnaC08g16880D                                          202   3e-56   
ref|XP_006850791.1|  hypothetical protein AMTR_s00025p00104130          186   2e-53   
ref|XP_008673654.1|  PREDICTED: uncharacterized protein LOC100191...    180   4e-51   Zea mays [maize]
tpg|DAA49274.1|  TPA: hypothetical protein ZEAMMB73_017777              180   6e-51   
gb|ABR16232.1|  unknown                                                 181   7e-51   Picea sitchensis
dbj|BAK02293.1|  predicted protein                                      175   9e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001130812.1|  uncharacterized protein LOC100191916               180   2e-50   Zea mays [maize]
ref|XP_002466928.1|  hypothetical protein SORBIDRAFT_01g016840          180   3e-50   Sorghum bicolor [broomcorn]
ref|NP_001050476.1|  Os03g0454100                                       179   7e-50   
ref|XP_004982576.1|  PREDICTED: probable serine incorporator-like       177   4e-49   Setaria italica
ref|XP_008458551.1|  PREDICTED: serine incorporator 3                   177   4e-49   Cucumis melo [Oriental melon]
ref|XP_010546829.1|  PREDICTED: serine incorporator 3 isoform X1        176   1e-48   Tarenaya hassleriana [spider flower]
ref|XP_006650244.1|  PREDICTED: probable serine incorporator-like       176   1e-48   Oryza brachyantha
ref|XP_010237604.1|  PREDICTED: probable serine incorporator            175   2e-48   Brachypodium distachyon [annual false brome]
ref|XP_011090806.1|  PREDICTED: probable serine incorporator            174   3e-48   Sesamum indicum [beniseed]
ref|XP_004150322.1|  PREDICTED: serine incorporator 3-like              174   4e-48   Cucumis sativus [cucumbers]
ref|XP_004169518.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...    174   4e-48   
gb|EYU43840.1|  hypothetical protein MIMGU_mgv1a006662mg                174   5e-48   Erythranthe guttata [common monkey flower]
dbj|BAJ86142.1|  predicted protein                                      174   7e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008799134.1|  PREDICTED: probable serine incorporator            173   1e-47   Phoenix dactylifera
ref|XP_010546830.1|  PREDICTED: serine incorporator 3 isoform X2        171   6e-47   Tarenaya hassleriana [spider flower]
ref|XP_004296950.1|  PREDICTED: probable serine incorporator            170   2e-46   Fragaria vesca subsp. vesca
ref|XP_009391591.1|  PREDICTED: serine incorporator 3                   170   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002280143.1|  PREDICTED: serine incorporator 3                   168   7e-46   Vitis vinifera
ref|XP_010938752.1|  PREDICTED: probable serine incorporator            168   1e-45   Elaeis guineensis
ref|XP_009365800.1|  PREDICTED: probable serine incorporator isof...    167   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_006419802.1|  hypothetical protein CICLE_v10005070mg             167   3e-45   Citrus clementina [clementine]
ref|XP_009365799.1|  PREDICTED: probable serine incorporator isof...    166   4e-45   Pyrus x bretschneideri [bai li]
ref|XP_009342179.1|  PREDICTED: probable serine incorporator            166   6e-45   Pyrus x bretschneideri [bai li]
ref|XP_010693925.1|  PREDICTED: serine incorporator 3                   165   1e-44   Beta vulgaris subsp. vulgaris [field beet]
emb|CDO98987.1|  unnamed protein product                                165   1e-44   Coffea canephora [robusta coffee]
emb|CDY05246.1|  BnaC05g45570D                                          164   2e-44   
ref|XP_006356686.1|  PREDICTED: serine incorporator 3-like              164   3e-44   Solanum tuberosum [potatoes]
ref|XP_006595390.1|  PREDICTED: probable serine incorporator-like       163   4e-44   
gb|KDO74827.1|  hypothetical protein CISIN_1g039061mg                   163   6e-44   Citrus sinensis [apfelsine]
emb|CDY24707.1|  BnaA05g31060D                                          163   8e-44   Brassica napus [oilseed rape]
gb|ACJ84561.1|  unknown                                                 162   9e-44   Medicago truncatula
gb|KHN37564.1|  Putative serine incorporator                            162   1e-43   Glycine soja [wild soybean]
ref|XP_010464184.1|  PREDICTED: probable serine incorporator            162   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010486107.1|  PREDICTED: probable serine incorporator            162   2e-43   Camelina sativa [gold-of-pleasure]
gb|KJB28193.1|  hypothetical protein B456_005G040500                    162   2e-43   Gossypium raimondii
ref|XP_009129653.1|  PREDICTED: probable serine incorporator            161   3e-43   Brassica rapa
ref|XP_009799680.1|  PREDICTED: probable serine incorporator            161   4e-43   Nicotiana sylvestris
ref|XP_006297798.1|  hypothetical protein CARUB_v10013833mg             160   5e-43   
ref|XP_010436570.1|  PREDICTED: probable serine incorporator            160   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010322266.1|  PREDICTED: serine incorporator 3                   158   4e-42   Solanum lycopersicum
gb|AAF30310.1|AC018907_10  hypothetical protein                         156   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147778.1|  hypothetical protein PHAVU_006G154400g             158   5e-42   Phaseolus vulgaris [French bean]
ref|XP_002882452.1|  TMS membrane family protein                        158   6e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_001765634.1|  predicted protein                                  158   7e-42   
ref|NP_187268.2|  Serinc-domain containing serine and sphingolipi...    156   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623079.1|  PREDICTED: probable serine incorporator            156   3e-41   Nicotiana tomentosiformis
emb|CAN71158.1|  hypothetical protein VITISV_036762                     153   4e-41   Vitis vinifera
ref|XP_007034589.1|  Serinc-domain containing serine and sphingol...    155   5e-41   
gb|AFK47365.1|  unknown                                                 151   6e-41   Lotus japonicus
ref|XP_010255869.1|  PREDICTED: probable serine incorporator            155   8e-41   Nelumbo nucifera [Indian lotus]
gb|EPS68630.1|  hypothetical protein M569_06136                         154   1e-40   Genlisea aurea
ref|XP_004486156.1|  PREDICTED: probable serine incorporator-like       154   1e-40   Cicer arietinum [garbanzo]
ref|XP_008340909.1|  PREDICTED: probable serine incorporator            154   1e-40   Malus domestica [apple tree]
ref|XP_010103434.1|  putative serine incorporator                       153   3e-40   Morus notabilis
ref|XP_008223013.1|  PREDICTED: probable serine incorporator            153   4e-40   Prunus mume [ume]
ref|XP_008390818.1|  PREDICTED: probable serine incorporator            152   7e-40   
ref|XP_011010290.1|  PREDICTED: probable serine incorporator            151   2e-39   Populus euphratica
ref|XP_006407969.1|  hypothetical protein EUTSA_v10020853mg             148   4e-39   
gb|KDP40096.1|  hypothetical protein JCGZ_02094                         150   5e-39   Jatropha curcas
ref|XP_002312742.1|  TMS membrane family protein                        149   8e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006407970.1|  hypothetical protein EUTSA_v10020853mg             148   2e-38   Eutrema salsugineum [saltwater cress]
ref|XP_007222705.1|  hypothetical protein PRUPE_ppa006444mg             147   4e-38   Prunus persica
ref|XP_002516786.1|  Membrane protein PB1A10.07c, putative              147   5e-38   Ricinus communis
ref|XP_010024424.1|  PREDICTED: serine incorporator 3                   146   1e-37   Eucalyptus grandis [rose gum]
ref|XP_009117775.1|  PREDICTED: wall-associated receptor kinase-l...    147   7e-37   Brassica rapa
ref|XP_002956760.1|  hypothetical protein VOLCADRAFT_83749              142   5e-36   Volvox carteri f. nagariensis
ref|XP_005651318.1|  TMS membrane protein/tumor differentially hy...    141   1e-35   Coccomyxa subellipsoidea C-169
gb|KJB67012.1|  hypothetical protein B456_010G170100                    135   6e-34   Gossypium raimondii
ref|XP_002979274.1|  hypothetical protein SELMODRAFT_110336             129   1e-31   
gb|KIZ05916.1|  putative serine incorporator                            130   1e-31   Monoraphidium neglectum
ref|XP_002506090.1|  predicted protein                                  128   4e-31   Micromonas commoda
ref|XP_001416509.1|  predicted protein                                  124   1e-29   Ostreococcus lucimarinus CCE9901
gb|ABF97020.1|  TMS membrane family protein, putative, expressed        122   6e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002988580.1|  hypothetical protein SELMODRAFT_128126             120   3e-28   
ref|XP_011397622.1|  putative serine incorporator                       120   4e-28   Auxenochlorella protothecoides
gb|AEW08633.1|  hypothetical protein CL976Contig1_02                    112   6e-28   Pinus radiata
dbj|BAD94992.1|  hypothetical protein                                   105   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003075128.1|  OJ1249_F12.26 gene product (ISS)                   112   3e-25   
emb|CEG01070.1|  TMS membrane protein/tumour differentially expre...    112   3e-25   Ostreococcus tauri
emb|CAN80334.1|  hypothetical protein VITISV_009413                     103   6e-25   Vitis vinifera
gb|ACG35592.1|  hypothetical protein                                    102   2e-24   Zea mays [maize]
ref|XP_004302121.1|  PREDICTED: serine incorporator 3-like              106   5e-24   Fragaria vesca subsp. vesca
gb|EFA77480.1|  TMS membrane protein                                    100   4e-21   Heterostelium album PN500
emb|CEG74958.1|  hypothetical protein RMATCC62417_10078               97.4    2e-20   Rhizopus microsporus
emb|CEG74957.1|  hypothetical protein RMATCC62417_10078               97.1    3e-20   Rhizopus microsporus
emb|CEG74956.1|  hypothetical protein RMATCC62417_10078               97.1    5e-20   Rhizopus microsporus
emb|CEG74955.1|  hypothetical protein RMATCC62417_10078               96.7    5e-20   Rhizopus microsporus
emb|CEG67769.1|  hypothetical protein RMATCC62417_04149               96.7    5e-20   Rhizopus microsporus
emb|CEG74954.1|  hypothetical protein RMATCC62417_10078               96.7    1e-19   Rhizopus microsporus
emb|CEG74953.1|  hypothetical protein RMATCC62417_10078               96.7    1e-19   Rhizopus microsporus
emb|CEJ00743.1|  hypothetical protein RMCBS344292_14792               96.3    1e-19   Rhizopus microsporus
emb|CEJ03265.1|  hypothetical protein RMCBS344292_17253               95.1    1e-19   Rhizopus microsporus
ref|XP_002982341.1|  hypothetical protein SELMODRAFT_179397           89.0    3e-17   Selaginella moellendorffii
ref|XP_001770496.1|  predicted protein                                88.2    6e-17   
gb|EXX70672.1|  Tms1p                                                 85.9    1e-16   Rhizophagus irregularis DAOM 197198w
ref|XP_004366977.1|  TMS membrane protein                             87.4    1e-16   Cavenderia fasciculata
ref|XP_003062471.1|  predicted protein                                87.0    3e-16   Micromonas pusilla CCMP1545
ref|XP_001625531.1|  predicted protein                                86.7    3e-16   Nematostella vectensis
ref|XP_009493459.1|  hypothetical protein H696_01290                  81.3    6e-16   Fonticula alba
gb|KDD71727.1|  hypothetical protein H632_c4498p0                     82.4    7e-16   Helicosporidium sp. ATCC 50920
ref|XP_002304839.2|  hypothetical protein POPTR_0003s18530g           84.7    7e-16   
ref|XP_009336936.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  84.0    8e-16   
ref|XP_002157067.2|  PREDICTED: probable serine incorporator-like     85.1    9e-16   Hydra vulgaris
ref|XP_007202140.1|  hypothetical protein PRUPE_ppa006940mg           84.3    1e-15   
ref|XP_002965853.1|  hypothetical protein SELMODRAFT_83891            84.0    1e-15   
ref|XP_008242601.1|  PREDICTED: probable serine incorporator          84.3    1e-15   Prunus mume [ume]
gb|ESA19644.1|  hypothetical protein GLOINDRAFT_19362                 85.1    1e-15   
ref|XP_009352478.1|  PREDICTED: probable serine incorporator          84.0    2e-15   
ref|NP_741562.1|  Protein Y57E12AL.1, isoform b                       83.6    2e-15   
ref|NP_741561.1|  Protein Y57E12AL.1, isoform a                       84.0    3e-15   Caenorhabditis elegans [roundworm]
ref|XP_004336528.1|  serine incorporator 3, putative                  83.6    4e-15   Acanthamoeba castellanii str. Neff
ref|XP_010469509.1|  PREDICTED: probable serine incorporator isof...  82.0    4e-15   
ref|NP_189089.3|  Serinc-domain containing serine and sphingolipi...  83.2    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011458210.1|  PREDICTED: probable serine incorporator isof...  83.2    4e-15   Fragaria vesca subsp. vesca
ref|XP_004287083.1|  PREDICTED: probable serine incorporator isof...  83.2    4e-15   Fragaria vesca subsp. vesca
dbj|GAM29010.1|  hypothetical protein SAMD00019534_121860             82.0    5e-15   Acytostelium subglobosum LB1
gb|KIH42470.1|  TMS membrane protein/tumor differentially express...  78.2    5e-15   Ancylostoma duodenale
ref|XP_010440599.1|  PREDICTED: probable serine incorporator          78.2    5e-15   Camelina sativa [gold-of-pleasure]
gb|EJW79555.1|  serine incorporator 2                                 82.8    6e-15   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|EGT39434.1|  hypothetical protein CAEBREN_08033                    83.2    6e-15   Caenorhabditis brenneri
ref|NP_850202.4|  Serinc-domain containing serine and sphingolipi...  82.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ESA13270.1|  hypothetical protein GLOINDRAFT_347023                81.6    6e-15   
ref|XP_009336915.1|  PREDICTED: probable serine incorporator          82.4    7e-15   
ref|XP_004665239.1|  PREDICTED: serine incorporator 2                 82.8    8e-15   Jaculus jaculus
ref|XP_003136987.1|  hypothetical protein LOAG_01400                  82.4    9e-15   Loa loa
emb|CDX93013.1|  BnaA03g37350D                                        82.0    1e-14   
gb|EXX52304.1|  Tms1p                                                 82.4    1e-14   Rhizophagus irregularis DAOM 197198w
ref|XP_010469504.1|  PREDICTED: probable serine incorporator isof...  82.0    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010469508.1|  PREDICTED: probable serine incorporator isof...  82.0    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010469507.1|  PREDICTED: probable serine incorporator isof...  82.0    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_001901605.1|  TDE2 protein                                     82.4    1e-14   Brugia malayi [agent of lymphatic filariasis]
gb|ETN74193.1|  TMS membrane protein/tumor differentially express...  82.0    1e-14   Necator americanus
gb|EGT35951.1|  hypothetical protein CAEBREN_13181                    82.0    1e-14   Caenorhabditis brenneri
ref|XP_010542976.1|  PREDICTED: probable serine incorporator          81.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_008224089.1|  PREDICTED: probable serine incorporator          81.6    1e-14   Prunus mume [ume]
ref|XP_010049913.1|  PREDICTED: probable serine incorporator isof...  81.3    2e-14   Eucalyptus grandis [rose gum]
gb|ESA09597.1|  hypothetical protein GLOINDRAFT_80906                 81.6    2e-14   
ref|XP_004301051.1|  PREDICTED: probable serine incorporator          81.3    2e-14   Fragaria vesca subsp. vesca
ref|XP_006295917.1|  hypothetical protein CARUB_v10025054mg           81.6    2e-14   
gb|KDP32305.1|  hypothetical protein JCGZ_13230                       81.3    2e-14   Jatropha curcas
gb|EGT34050.1|  hypothetical protein CAEBREN_24071                    81.6    2e-14   Caenorhabditis brenneri
ref|XP_010656350.1|  PREDICTED: probable serine incorporator isof...  80.5    2e-14   
ref|XP_002602420.1|  hypothetical protein BRAFLDRAFT_117027           81.6    2e-14   Branchiostoma floridae
ref|XP_010049722.1|  PREDICTED: probable serine incorporator          80.9    2e-14   Eucalyptus grandis [rose gum]
gb|ENN78699.1|  hypothetical protein YQE_04871                        81.6    2e-14   Dendroctonus ponderosae
emb|CEP13524.1|  hypothetical protein                                 81.6    2e-14   Parasitella parasitica
ref|XP_011174068.1|  PREDICTED: probable serine incorporator          76.6    2e-14   
ref|XP_005665214.1|  PREDICTED: serine incorporator 2-like            77.4    2e-14   
dbj|GAN07994.1|  TMS membrane protein/tumor differentially expres...  81.6    2e-14   Mucor ambiguus
ref|XP_007226418.1|  hypothetical protein PRUPE_ppa023345mg           80.9    3e-14   Prunus persica
ref|XP_010656344.1|  PREDICTED: probable serine incorporator isof...  80.5    3e-14   
gb|EXX55775.1|  Tms1p                                                 81.3    3e-14   Rhizophagus irregularis DAOM 197198w
gb|KHN74385.1|  Serine incorporator 3                                 81.6    3e-14   Toxocara canis
gb|EPB88143.1|  hypothetical protein HMPREF1544_05087                 81.3    3e-14   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_006285723.1|  hypothetical protein CARUB_v10007195mg           80.5    3e-14   Capsella rubella
ref|XP_002863245.1|  hypothetical protein ARALYDRAFT_497050           80.5    3e-14   
ref|XP_009408948.1|  PREDICTED: probable serine incorporator          80.5    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008337449.1|  PREDICTED: probable serine incorporator          80.5    4e-14   
gb|ERL86825.1|  hypothetical protein D910_04228                       81.6    4e-14   Dendroctonus ponderosae
ref|XP_003114570.1|  hypothetical protein CRE_26972                   80.9    4e-14   Caenorhabditis remanei
ref|XP_010435285.1|  PREDICTED: probable serine incorporator          80.1    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010413903.1|  PREDICTED: probable serine incorporator          80.5    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008362934.1|  PREDICTED: probable serine incorporator          80.1    4e-14   
ref|XP_009141295.1|  PREDICTED: probable serine incorporator isof...  80.5    4e-14   Brassica rapa
ref|NP_567403.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            80.1    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003620496.1|  Serine incorporator                              80.1    4e-14   Medicago truncatula
emb|CEG70157.1|  hypothetical protein RMATCC62417_06104               80.9    5e-14   Rhizopus microsporus
ref|XP_002968524.1|  hypothetical protein SELMODRAFT_89240            80.1    5e-14   
ref|XP_010532841.1|  PREDICTED: probable serine incorporator          80.1    5e-14   
ref|XP_002994401.1|  hypothetical protein SELMODRAFT_449363           79.7    5e-14   Selaginella moellendorffii
ref|XP_002637793.1|  Hypothetical protein CBG04578                    80.1    6e-14   Caenorhabditis briggsae
ref|XP_002881267.1|  TMS membrane family protein                      80.1    6e-14   
gb|EGW01137.1|  Serine incorporator 2                                 79.7    6e-14   Cricetulus griseus [Chinese hamsters]
ref|XP_007637556.1|  PREDICTED: serine incorporator 2 isoform X2      80.1    6e-14   
gb|ERE85397.1|  serine incorporator 2-like protein                    80.1    6e-14   Cricetulus griseus [Chinese hamsters]
ref|XP_007624716.1|  PREDICTED: serine incorporator 2 isoform X1      80.1    6e-14   
ref|XP_006645562.1|  PREDICTED: probable serine incorporator-like     80.1    7e-14   
ref|XP_010450223.1|  PREDICTED: probable serine incorporator          79.7    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010688168.1|  PREDICTED: probable serine incorporator          79.7    7e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_005079567.1|  PREDICTED: serine incorporator 2 isoform X1      80.1    7e-14   Mesocricetus auratus [Syrian golden hamster]
ref|XP_004968422.1|  PREDICTED: probable serine incorporator-like...  79.7    7e-14   Setaria italica
gb|KFH68151.1|  hypothetical protein MVEG_06880                       80.1    7e-14   Mortierella verticillata NRRL 6337
ref|XP_010440600.1|  PREDICTED: probable serine incorporator          79.3    8e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002515588.1|  conserved hypothetical protein                   79.3    8e-14   Ricinus communis
ref|XP_002324973.1|  TMS membrane family protein                      79.3    8e-14   
ref|XP_009107689.1|  PREDICTED: probable serine incorporator          79.3    9e-14   
ref|XP_003102359.1|  hypothetical protein CRE_05000                   79.3    1e-13   
emb|CDJ97729.1|  TMS membrane protein tumour differentially expre...  79.0    1e-13   
ref|XP_005079568.1|  PREDICTED: serine incorporator 2 isoform X2      79.0    1e-13   
ref|XP_007318557.1|  hypothetical protein SERLADRAFT_356127           79.3    1e-13   
ref|XP_010509918.1|  PREDICTED: probable serine incorporator          79.3    1e-13   
emb|CBI33332.3|  unnamed protein product                              79.0    1e-13   
ref|XP_006414928.1|  hypothetical protein EUTSA_v10025402mg           79.0    1e-13   
ref|XP_010650214.1|  PREDICTED: probable serine incorporator          79.0    1e-13   
ref|NP_849373.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            78.6    1e-13   
emb|CDJ92178.1|  TMS membrane protein tumour differentially expre...  79.0    1e-13   
ref|XP_006410459.1|  hypothetical protein EUTSA_v10016703mg           79.0    1e-13   
ref|XP_004167946.1|  PREDICTED: serine incorporator 1-like            77.0    1e-13   
ref|XP_007558462.1|  PREDICTED: serine incorporator 1-like            79.0    2e-13   
ref|XP_004230114.1|  PREDICTED: probable serine incorporator          78.6    2e-13   
dbj|BAM19260.1|  membrane protein tms1d                               79.0    2e-13   
gb|EYB93216.1|  hypothetical protein Y032_0184g1001                   78.6    2e-13   
gb|EIE81637.1|  hypothetical protein RO3G_06342                       79.0    2e-13   
ref|XP_008458232.1|  PREDICTED: probable serine incorporator isof...  77.4    2e-13   
ref|XP_008846447.1|  PREDICTED: serine incorporator 2                 78.6    2e-13   
ref|XP_005353216.1|  PREDICTED: serine incorporator 2                 78.6    2e-13   
gb|KFH68448.1|  hypothetical protein MVEG_05263                       79.0    2e-13   
ref|XP_004591703.1|  PREDICTED: serine incorporator 2 isoform X1      78.6    2e-13   
gb|EYB93217.1|  hypothetical protein Y032_0184g1001                   78.2    2e-13   
ref|XP_004512960.1|  PREDICTED: probable serine incorporator-like     78.2    2e-13   
ref|XP_006347785.1|  PREDICTED: probable serine incorporator-like...  78.2    2e-13   
emb|CDP03356.1|  unnamed protein product                              78.2    2e-13   
gb|KFD55197.1|  hypothetical protein M513_03838                       79.0    2e-13   
ref|XP_008272011.1|  PREDICTED: serine incorporator 2                 78.6    2e-13   
ref|XP_008146179.1|  PREDICTED: serine incorporator 2 isoform X2      78.6    2e-13   
ref|XP_010527190.1|  PREDICTED: probable serine incorporator          78.2    2e-13   
ref|XP_004591704.1|  PREDICTED: serine incorporator 2 isoform X2      78.6    2e-13   
ref|XP_009267712.1|  Membrane protein TMS1                            78.6    2e-13   
dbj|BAK01836.1|  predicted protein                                    78.6    2e-13   
ref|XP_002957018.1|  hypothetical protein VOLCADRAFT_77374            78.2    2e-13   
ref|NP_766290.2|  serine incorporator 2 isoform 1 precursor           78.2    2e-13   
gb|KHG16194.1|  Serine incorporator 3                                 78.2    2e-13   
ref|XP_006734246.1|  PREDICTED: serine incorporator 2-like            76.6    2e-13   
ref|NP_001026826.1|  serine incorporator 2 precursor                  78.2    3e-13   
gb|EPY77486.1|  hypothetical protein CB1_001251006                    74.7    3e-13   
ref|XP_006503126.1|  PREDICTED: serine incorporator 2 isoform X1      78.2    3e-13   
ref|XP_011043440.1|  PREDICTED: probable serine incorporator          77.8    3e-13   
ref|NP_001240315.1|  serine incorporator 2 isoform 2                  77.8    3e-13   
gb|KJB54130.1|  hypothetical protein B456_009G023600                  77.8    3e-13   
ref|NP_506611.1|  Protein R11H6.2                                     78.2    3e-13   
gb|ETE65034.1|  Serine incorporator 2                                 77.8    3e-13   
gb|KJB54127.1|  hypothetical protein B456_009G023600                  77.8    3e-13   
ref|XP_002126357.1|  PREDICTED: serine incorporator 5-like            78.2    3e-13   
ref|XP_008146178.1|  PREDICTED: serine incorporator 2 isoform X1      78.2    3e-13   
ref|XP_002411145.1|  conserved hypothetical protein                   78.2    3e-13   
ref|NP_001240143.1|  uncharacterized protein LOC100788574             77.8    3e-13   
ref|XP_009688001.1|  PREDICTED: serine incorporator 2-like            77.4    3e-13   
gb|AGG19193.1|  maternal effect embryo arrest 55-1                    77.4    3e-13   
ref|XP_009381145.1|  PREDICTED: probable serine incorporator          77.8    4e-13   
emb|CAP36379.2|  Protein CBG19072                                     77.8    4e-13   
ref|XP_003528920.1|  PREDICTED: probable serine incorporator-like     77.4    4e-13   
ref|XP_006297795.1|  hypothetical protein CARUB_v10013830mg           77.4    4e-13   
ref|XP_008458214.1|  PREDICTED: probable serine incorporator isof...  77.4    4e-13   
ref|XP_008458224.1|  PREDICTED: probable serine incorporator isof...  77.4    4e-13   
ref|XP_002637371.1|  Hypothetical protein CBG19072                    77.8    4e-13   
sp|Q58CW5.1|SERC2_BOVIN  RecName: Full=Serine incorporator 2; Alt...  77.8    4e-13   
ref|XP_010466851.1|  PREDICTED: probable serine incorporator          77.4    4e-13   
ref|XP_005993191.1|  PREDICTED: serine incorporator 1-like            77.8    4e-13   
ref|NP_001090209.1|  serine incorporator 1 precursor                  77.8    4e-13   
gb|AAI26722.1|  SERINC2 protein                                       77.8    4e-13   
ref|XP_002426175.1|  serine incorporator, putative                    77.4    4e-13   
gb|AAX46603.1|  tumor differentially expressed 2-like                 77.4    5e-13   
ref|XP_010249828.1|  PREDICTED: probable serine incorporator          77.0    5e-13   
ref|XP_005676784.1|  PREDICTED: serine incorporator 2 isoform X1      77.4    5e-13   
ref|XP_010513493.1|  PREDICTED: probable serine incorporator          77.4    5e-13   
ref|XP_008408640.1|  PREDICTED: serine incorporator 1-like            77.4    5e-13   
ref|XP_004139427.1|  PREDICTED: serine incorporator 1-like            77.0    5e-13   
dbj|BAC37344.1|  unnamed protein product                              73.9    5e-13   
ref|XP_007013230.1|  Serinc-domain containing serine and sphingol...  77.0    5e-13   
ref|XP_007573353.1|  PREDICTED: serine incorporator 1-like            77.4    5e-13   
ref|NP_001141791.1|  hypothetical protein                             75.1    5e-13   
gb|AIC61740.1|  SERINC2                                               72.8    6e-13   
ref|XP_007013229.1|  Serinc-domain containing serine and sphingol...  77.0    6e-13   
ref|NP_001030362.1|  serine incorporator 2                            77.0    6e-13   
ref|XP_007952319.1|  PREDICTED: serine incorporator 2                 77.4    6e-13   
emb|CEF63556.1|  TMS1                                                 77.0    6e-13   
ref|XP_011356110.1|  PREDICTED: serine incorporator 2 isoform X1      77.0    6e-13   
ref|NP_001231077.1|  serine incorporator 2 precursor                  77.0    6e-13   
ref|XP_007013228.1|  Serinc-domain containing serine and sphingol...  77.0    6e-13   
ref|XP_003738027.1|  PREDICTED: probable serine incorporator-like...  77.0    6e-13   
gb|AAH07375.2|  SERINC2 protein                                       73.2    6e-13   
ref|XP_004314553.1|  PREDICTED: serine incorporator 1                 76.3    7e-13   
ref|NP_001042203.1|  Os01g0179800                                     77.0    7e-13   
ref|XP_004312132.1|  PREDICTED: serine incorporator 2 isoform 3       77.0    7e-13   
gb|KFK39759.1|  serinc-domain containing serine and sphingolipid ...  76.6    7e-13   
gb|KFV77205.1|  Serine incorporator 1                                 77.0    7e-13   
ref|NP_001037624.1|  membrane protein TMS1 precursor                  77.0    7e-13   
ref|XP_004741007.1|  PREDICTED: serine incorporator 2                 77.0    7e-13   
gb|KFZ58338.1|  Serine incorporator 1                                 77.0    7e-13   
ref|XP_004266597.1|  PREDICTED: serine incorporator 2 isoform 3       77.0    7e-13   
ref|XP_002114508.1|  expressed hypothetical protein                   76.6    8e-13   
ref|XP_005959570.1|  PREDICTED: serine incorporator 2 isoform X2      77.0    8e-13   
emb|CDY37743.1|  BnaA04g19250D                                        77.0    8e-13   
ref|XP_004422332.1|  PREDICTED: serine incorporator 1                 77.0    8e-13   
ref|XP_008579104.1|  PREDICTED: serine incorporator 2                 77.0    8e-13   
ref|XP_006680018.1|  hypothetical protein BATDEDRAFT_37095            77.0    8e-13   
gb|ERG80713.1|  serine incorporator 3                                 77.0    8e-13   
ref|XP_004612673.1|  PREDICTED: serine incorporator 3                 77.4    8e-13   
ref|XP_010166344.1|  PREDICTED: serine incorporator 1                 76.6    8e-13   
ref|XP_011356111.1|  PREDICTED: serine incorporator 2 isoform X2      76.6    8e-13   
gb|EEE53986.1|  hypothetical protein OsJ_00615                        77.0    8e-13   
ref|XP_004312133.1|  PREDICTED: serine incorporator 2 isoform 4       76.6    8e-13   
ref|XP_004312131.1|  PREDICTED: serine incorporator 2 isoform 2       76.6    8e-13   
ref|XP_005959571.1|  PREDICTED: serine incorporator 2 isoform X3      76.6    8e-13   
ref|XP_004312130.1|  PREDICTED: serine incorporator 2 isoform 1       76.6    8e-13   
ref|XP_005906241.1|  PREDICTED: serine incorporator 2 isoform X2      76.6    8e-13   
ref|XP_004005091.1|  PREDICTED: serine incorporator 2 isoform 2       76.6    8e-13   
ref|XP_009907826.1|  PREDICTED: serine incorporator 1                 76.6    8e-13   
ref|XP_005676785.1|  PREDICTED: serine incorporator 2 isoform X2      76.6    8e-13   
ref|XP_007534228.1|  PREDICTED: serine incorporator 2                 76.6    8e-13   
ref|XP_003228070.1|  PREDICTED: serine incorporator 2                 76.6    8e-13   
ref|XP_008064965.1|  PREDICTED: serine incorporator 2                 76.6    9e-13   
ref|XP_004266595.1|  PREDICTED: serine incorporator 2 isoform 1       76.6    9e-13   
ref|XP_010915041.1|  PREDICTED: probable serine incorporator          76.3    9e-13   
ref|XP_004005092.1|  PREDICTED: serine incorporator 2 isoform 3       76.6    9e-13   
ref|XP_004266598.1|  PREDICTED: serine incorporator 2 isoform 4       76.3    9e-13   
ref|XP_007454962.1|  PREDICTED: serine incorporator 1                 76.6    9e-13   
gb|KFM12545.1|  Serine incorporator 2                                 76.6    9e-13   
ref|XP_004266596.1|  PREDICTED: serine incorporator 2 isoform 2       76.6    9e-13   
ref|XP_005959569.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    9e-13   
ref|XP_003638965.2|  PREDICTED: serine incorporator 2                 76.6    9e-13   
ref|XP_005911789.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...  76.6    9e-13   
ref|XP_005959572.1|  PREDICTED: serine incorporator 2 isoform X4      76.3    9e-13   
ref|XP_007897489.1|  PREDICTED: serine incorporator 1                 76.6    9e-13   
ref|XP_004263915.1|  PREDICTED: serine incorporator 1                 76.6    9e-13   
ref|XP_008319400.1|  PREDICTED: serine incorporator 1-like            76.6    9e-13   
gb|EEC70050.1|  hypothetical protein OsI_00646                        76.6    9e-13   
ref|XP_005676787.1|  PREDICTED: serine incorporator 2 isoform X4      76.3    1e-12   
ref|XP_009284929.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_005906240.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    1e-12   
gb|EKC27359.1|  DNA/RNA-binding protein KIN17                         75.1    1e-12   
gb|ELR48720.1|  Serine incorporator 2                                 76.6    1e-12   
ref|XP_010264006.1|  PREDICTED: probable serine incorporator isof...  76.3    1e-12   
ref|XP_009141296.1|  PREDICTED: probable serine incorporator isof...  76.3    1e-12   
ref|XP_004642983.1|  PREDICTED: serine incorporator 2                 76.6    1e-12   
emb|CDY66714.1|  BnaCnng52050D                                        76.3    1e-12   
gb|AAQ88795.1|  GSVL396                                               76.6    1e-12   
ref|XP_004005090.1|  PREDICTED: serine incorporator 2 isoform 1       76.3    1e-12   
ref|XP_011134962.1|  PREDICTED: probable serine incorporator isof...  76.6    1e-12   
ref|XP_010974399.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    1e-12   
ref|XP_007128527.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_005906242.1|  PREDICTED: serine incorporator 2 isoform X3      76.3    1e-12   
gb|KJB06649.1|  hypothetical protein B456_001G003900                  75.9    1e-12   
ref|XP_011304466.1|  PREDICTED: probable serine incorporator isof...  76.3    1e-12   
ref|XP_006767103.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    1e-12   
ref|XP_005875118.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    1e-12   
ref|XP_010950491.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    1e-12   
ref|XP_006767104.1|  PREDICTED: serine incorporator 2 isoform X2      76.3    1e-12   
ref|XP_008778515.1|  PREDICTED: serine incorporator 1-like            73.9    1e-12   
ref|XP_010835380.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_002155155.2|  PREDICTED: probable serine incorporator-like     74.7    1e-12   
ref|XP_010666477.1|  PREDICTED: probable serine incorporator isof...  75.5    1e-12   
ref|XP_007145428.1|  hypothetical protein PHAVU_007G238300g           76.3    1e-12   
ref|XP_006102950.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_006196964.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    1e-12   
ref|XP_010950492.1|  PREDICTED: serine incorporator 2 isoform X2      75.9    1e-12   
ref|XP_007145427.1|  hypothetical protein PHAVU_007G238300g           76.3    1e-12   
ref|XP_006767105.1|  PREDICTED: serine incorporator 2 isoform X3      75.9    1e-12   
gb|EPQ13210.1|  Serine incorporator 2                                 75.9    1e-12   
ref|XP_001836185.1|  membrane protein                                 75.9    1e-12   
ref|XP_004406452.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
gb|KIJ14234.1|  hypothetical protein PAXINDRAFT_163421                76.3    1e-12   
ref|XP_005875119.1|  PREDICTED: serine incorporator 2 isoform X2      75.9    1e-12   
ref|NP_001011399.1|  serine incorporator 1 precursor                  76.3    1e-12   
ref|XP_003937635.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_006176241.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    1e-12   
ref|XP_004425924.1|  PREDICTED: serine incorporator 2 isoform 1       76.3    1e-12   
ref|XP_007190839.1|  PREDICTED: serine incorporator 1                 76.3    1e-12   
ref|XP_006924375.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_010666475.1|  PREDICTED: probable serine incorporator isof...  75.9    1e-12   
ref|XP_003977493.1|  PREDICTED: serine incorporator 1-like isoform 1  75.9    1e-12   
gb|KJB06650.1|  hypothetical protein B456_001G003900                  75.9    2e-12   
ref|XP_006196965.1|  PREDICTED: serine incorporator 2 isoform X2      75.9    2e-12   
ref|XP_010910312.1|  PREDICTED: serine incorporator 1-like            72.4    2e-12   
ref|XP_011062433.1|  PREDICTED: probable serine incorporator isof...  75.9    2e-12   
gb|ELK02034.1|  Serine incorporator 2                                 75.5    2e-12   
ref|XP_005395079.1|  PREDICTED: serine incorporator 2 isoform X1      75.9    2e-12   
ref|NP_593521.1|  sphingolipid biosynthesis protein (predicted)       75.9    2e-12   
ref|XP_002885648.1|  TMS membrane family protein                      75.5    2e-12   
gb|EPY87330.1|  Tumor differentially expressed 2-like protein         75.9    2e-12   
ref|XP_006047642.1|  PREDICTED: serine incorporator 1                 75.9    2e-12   
gb|AAH46718.1|  TDE2 protein                                          75.9    2e-12   
ref|XP_006176242.1|  PREDICTED: serine incorporator 2 isoform X2      75.5    2e-12   
gb|KIK77929.1|  hypothetical protein PAXRUDRAFT_834805                75.9    2e-12   
ref|XP_011062431.1|  PREDICTED: probable serine incorporator isof...  75.9    2e-12   
ref|XP_007114993.1|  PREDICTED: serine incorporator 1                 75.9    2e-12   
ref|XP_011062435.1|  PREDICTED: probable serine incorporator isof...  75.9    2e-12   
ref|XP_010767646.1|  PREDICTED: serine incorporator 1-like            72.8    2e-12   
ref|XP_006158214.1|  PREDICTED: serine incorporator 2                 75.9    2e-12   
gb|EHJ66123.1|  membrane protein TMS1                                 75.5    2e-12   
ref|XP_011062434.1|  PREDICTED: probable serine incorporator isof...  75.5    2e-12   
ref|XP_006132696.1|  PREDICTED: serine incorporator 1                 75.5    2e-12   
ref|XP_005395080.1|  PREDICTED: serine incorporator 2 isoform X2      75.5    2e-12   
ref|XP_005659290.1|  PREDICTED: serine incorporator 1-like            74.7    2e-12   
ref|XP_011449551.1|  PREDICTED: serine incorporator 1-like isofor...  75.5    2e-12   
gb|ELR60415.1|  Serine incorporator 1                                 75.5    2e-12   
gb|AAH17085.2|  SERINC2 protein                                       72.8    2e-12   
ref|XP_007867639.1|  TMS membrane protein/tumor differentially ex...  75.9    2e-12   
ref|XP_006879047.1|  PREDICTED: serine incorporator 1                 75.5    2e-12   
ref|XP_004382785.1|  PREDICTED: serine incorporator 1                 75.5    2e-12   
ref|XP_004346817.1|  hypothetical protein CAOG_05132                  75.5    2e-12   
ref|XP_009891303.1|  PREDICTED: serine incorporator 2                 75.5    2e-12   
gb|KIP08229.1|  hypothetical protein PHLGIDRAFT_18984                 75.5    2e-12   
ref|XP_010230536.1|  PREDICTED: probable serine incorporator          75.5    2e-12   
ref|XP_004705083.1|  PREDICTED: serine incorporator 2                 75.5    2e-12   
ref|XP_011449548.1|  PREDICTED: serine incorporator 1-like isofor...  75.5    2e-12   
gb|KEH21361.1|  serinc-domain serine and sphingolipid biosynthesi...  72.8    2e-12   
ref|NP_001030504.1|  serine incorporator 1 precursor                  75.5    2e-12   
gb|ELW48644.1|  Serine incorporator 2                                 75.5    2e-12   
gb|KFW95730.1|  Serine incorporator 1                                 74.3    2e-12   
ref|XP_004011205.1|  PREDICTED: serine incorporator 1                 75.5    2e-12   
ref|XP_006934583.1|  PREDICTED: serine incorporator 2                 75.1    2e-12   
gb|ELK00692.1|  Serine incorporator 1                                 75.5    2e-12   
gb|EOB02909.1|  Serine incorporator 1                                 75.5    2e-12   
ref|XP_011269371.1|  PREDICTED: probable serine incorporator isof...  75.5    2e-12   



>gb|KDO36650.1| hypothetical protein CISIN_1g028965mg [Citrus sinensis]
Length=201

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  684  SIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaV  505
            +I PASVISLYC YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVLSVVYSAV
Sbjct  29   AILPASVISLYCMYLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAV  88

Query  504  RAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSA  325
            RAGSSTTLLSPPSSPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFSLASMYSA
Sbjct  89   RAGSSTTLLSPPSSPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYSA  148

Query  324  MLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MLLTGWSTSVGESGKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  149  MLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  201



>ref|XP_009354238.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009354239.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370970.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370971.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVLSVVYS
Sbjct  239  NGSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSSTTLLSPP SPRAG GKPLLPLDK DEHEE EKSK V+YSYSFFHIIFSLASMY
Sbjct  299  AVRAGSSTTLLSPPGSPRAGAGKPLLPLDKVDEHEEKEKSKPVSYSYSFFHIIFSLASMY  358

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TA L++WSL+APILFP+R+F
Sbjct  359  SAMLLTGWSTSVGESGKLVDVGWPSVWVRMVTGWATAGLYIWSLLAPILFPEREF  413



>ref|XP_011073234.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073235.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073236.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 162/175 (93%), Gaps = 1/175 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST +L LGLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSSLALGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPPSSPRAG GKPLLPLDKADEH EE EKSK VTYSYSFFH+IFSLASMY
Sbjct  300  VRAGSSTTLLSPPSSPRAGSGKPLLPLDKADEHHEEAEKSKPVTYSYSFFHLIFSLASMY  359

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR++T W TAALF+WSLVAPI+FPDR+F
Sbjct  360  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIITSWATAALFIWSLVAPIIFPDREF  414



>ref|XP_007215456.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16655.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=397

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PASVIS+YCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVLSVVYS
Sbjct  223  NGSILPASVISMYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYS  282

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEHEE EK+K V+YSYSFFHIIFSLASMY
Sbjct  283  AVRAGSSTTLLSPPSSPRAGAGKPLLPLDKADEHEEKEKAKPVSYSYSFFHIIFSLASMY  342

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGW+TSVGESGKLVDVGW SVWVR+VT W TA LF+WSL+APILFP+R+F
Sbjct  343  SAMLLTGWTTSVGESGKLVDVGWPSVWVRIVTSWATAGLFIWSLLAPILFPEREF  397



>ref|XP_006493450.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
Length=413

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  360  AMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  413



>ref|XP_008228861.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228862.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228863.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228864.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=413

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PASVIS+YCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVLSVVYS
Sbjct  239  NGSILPASVISMYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEHEE EK+K V+YSYSFFHIIFSLASMY
Sbjct  299  AVRAGSSTTLLSPPSSPRAGAGKPLLPLDKADEHEEKEKAKPVSYSYSFFHIIFSLASMY  358

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGW+TSVGESGKLVDVGW SVWVR+VT W TA LF+WSL+APILFP+R+F
Sbjct  359  SAMLLTGWTTSVGESGKLVDVGWPSVWVRIVTSWATAGLFIWSLLAPILFPEREF  413



>ref|XP_007215457.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 ref|XP_007215458.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16656.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16657.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=413

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PASVIS+YCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVLSVVYS
Sbjct  239  NGSILPASVISMYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEHEE EK+K V+YSYSFFHIIFSLASMY
Sbjct  299  AVRAGSSTTLLSPPSSPRAGAGKPLLPLDKADEHEEKEKAKPVSYSYSFFHIIFSLASMY  358

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGW+TSVGESGKLVDVGW SVWVR+VT W TA LF+WSL+APILFP+R+F
Sbjct  359  SAMLLTGWTTSVGESGKLVDVGWPSVWVRIVTSWATAGLFIWSLLAPILFPEREF  413



>ref|XP_006427689.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
 gb|ESR40929.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
Length=413

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GS+ PASVISLYC YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVLSVVYSA
Sbjct  240  GSVLPASVISLYCMYLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  360  AMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  413



>gb|KJB67006.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67007.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67008.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67009.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67010.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67011.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67013.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=412

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 165/173 (95%), Gaps = 1/173 (1%)
 Frame = -2

Query  684  SIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaV  505
            SI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGT+T+GLLTT+LSVVYSAV
Sbjct  241  SILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTVTVGLLTTILSVVYSAV  300

Query  504  RAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSA  325
            RAGSSTTLLSPPSSPRAGGGKPLLPLDKADE EE EK+KAVTYSY+FFHIIFSLASMYSA
Sbjct  301  RAGSSTTLLSPPSSPRAGGGKPLLPLDKADE-EEKEKNKAVTYSYAFFHIIFSLASMYSA  359

Query  324  MLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MLLTGWSTSVGESGKLVDVGW SVW+R++T WVTAAL++WSL+APILFPDRDF
Sbjct  360  MLLTGWSTSVGESGKLVDVGWPSVWIRILTAWVTAALYMWSLLAPILFPDRDF  412



>gb|KHG09631.1| Serine incorporator 3 [Gossypium arboreum]
Length=413

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG GKPLLP+DKADEHEE EK+K V+YSY+FFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAGAGKPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  360  AMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYIWSLVAPILFPEREF  413



>gb|KJB68285.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68288.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68289.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=413

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG GKPLLP+DKADEHEE EK+K V+YSY+FFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAGAGKPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  360  AMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLVAPILFPEREF  413



>gb|KJB68287.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVLSVVYSA
Sbjct  238  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVLSVVYSA  297

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG GKPLLP+DKADEHEE EK+K V+YSY+FFHIIFSLASMYS
Sbjct  298  VRAGSSTTLLSPPSSPRAGAGKPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFSLASMYS  357

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  358  AMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLVAPILFPEREF  411



>ref|XP_008342757.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVLSVVYSA
Sbjct  240  GSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPP SPRAG GKPLLPLDK DEH+E EKSK V+YSYSFFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPGSPRAGAGKPLLPLDKVDEHKEKEKSKPVSYSYSFFHIIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L++WSL+APILFP+R+F
Sbjct  360  AMLLTGWSTSVGESGKLVDVGWPSVWVRMVTSWATAGLYIWSLLAPILFPEREF  413



>ref|XP_004158797.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
 gb|KGN45209.1| hypothetical protein Csa_7G431410 [Cucumis sativus]
Length=411

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 164/174 (94%), Gaps = 2/174 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGTL+LGLLTTVLSVVYSA
Sbjct  240  GSVLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTLSLGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG  KPLLPL+KADEHEE EKSK VTYSYSFFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAG--KPLLPLEKADEHEEKEKSKPVTYSYSFFHIIFSLASMYS  357

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGW+TSVG SG+LVDVGWASVWVRVVTGW TAALF+WSL+AP+LFPDRDF
Sbjct  358  AMLLTGWTTSVGGSGRLVDVGWASVWVRVVTGWATAALFIWSLIAPVLFPDRDF  411



>ref|XP_008381162.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVLSVVYSA
Sbjct  240  GSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPR+G GKPLLPLDK DEHEE EKSK V+YSYSFFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRSGAGKPLLPLDKVDEHEEKEKSKPVSYSYSFFHIIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWS SVGESGKLVDVGW SVWVR+VT W TA L++WSL+APILFP+R+F
Sbjct  360  AMLLTGWSASVGESGKLVDVGWPSVWVRMVTSWATAGLYIWSLLAPILFPEREF  413



>ref|XP_009365247.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009365248.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   236 bits (602),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVLSVVYSA
Sbjct  240  GSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPP+SPR+G GKPLLPLDK DEHEE EKSK V+YSY+FFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPNSPRSGAGKPLLPLDKVDEHEEKEKSKPVSYSYAFFHIIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWS SVGESGKLVDVGW SVWVR+VT W TA L++WSL+APILFP+R+F
Sbjct  360  AMLLTGWSASVGESGKLVDVGWPSVWVRMVTSWATAGLYIWSLLAPILFPEREF  413



>ref|XP_007024820.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 ref|XP_007024821.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27442.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27443.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
Length=413

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLT GLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTFGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG GK LLPLDKADE EE +K+K VTYSY+FFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAGAGKSLLPLDKADEQEEKDKNKPVTYSYAFFHIIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L+LWSL+APILFP+R+F
Sbjct  360  AMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYLWSLIAPILFPEREF  413



>ref|XP_011466994.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466995.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466996.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466997.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
Length=414

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS+YCTYLCYSALASEPRDYECN+LHKHSK+VSTGTLTLGLLTTVLSVVYSA
Sbjct  241  GSILPASVISVYCTYLCYSALASEPRDYECNSLHKHSKAVSTGTLTLGLLTTVLSVVYSA  300

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG GKPLLPLDK +E EE EK+K+V+YSY+FFHIIFSLASMYS
Sbjct  301  VRAGSSTTLLSPPSSPRAGAGKPLLPLDKPEEREENEKAKSVSYSYAFFHIIFSLASMYS  360

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKL+DVGW SVWVRV+T W TA L++WSL+APILFP+R+F
Sbjct  361  AMLLTGWSTSVGESGKLIDVGWPSVWVRVMTSWATAGLYIWSLLAPILFPEREF  414



>ref|XP_009759114.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009759115.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTVLSVVYSA
Sbjct  240  GSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  360  AMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  413



>ref|XP_010318692.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
Length=413

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+GTL LGLLTTVLSVVYSA
Sbjct  240  GSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGTLALGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E+SK V+YSYSFFH+IFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAGSGKPLLPLDKVDEEEEKERSKPVSYSYSFFHLIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  360  AMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  413



>ref|XP_009615680.1| PREDICTED: serine incorporator 3 isoform X2 [Nicotiana tomentosiformis]
Length=413

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
            +GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTVLSVVYS
Sbjct  239  RGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IFSLASMY
Sbjct  299  AVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLASMY  358

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+F
Sbjct  359  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPEREF  413



>gb|KJB68286.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   231 bits (588),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 163/174 (94%), Gaps = 2/174 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG  KPLLP+DKADEHEE EK+K V+YSY+FFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAG--KPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFSLASMYS  357

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  358  AMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLVAPILFPEREF  411



>ref|XP_009615679.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTVLSVVYSA
Sbjct  240  GSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+F
Sbjct  360  AMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPEREF  413



>ref|XP_006341429.1| PREDICTED: probable serine incorporator-like isoform X1 [Solanum 
tuberosum]
Length=413

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+GTL LGLLTTVLSVVYSA
Sbjct  240  GSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGTLALGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E+SK V+YSYSFFH+IFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERSKPVSYSYSFFHLIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGE+G LVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  360  AMLLTGWSTSVGENGNLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  413



>gb|KDO36651.1| hypothetical protein CISIN_1g028965mg [Citrus sinensis]
Length=161

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -2

Query  645  YLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGssttllspps  466
            YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVLSVVYSAVRAGSSTTLLSPPS
Sbjct  2    YLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAVRAGSSTTLLSPPS  61

Query  465  sPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGES  286
            SPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGES
Sbjct  62   SPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGES  121

Query  285  GKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            GKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  122  GKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  161



>ref|XP_004135884.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
Length=422

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 161/180 (89%), Gaps = 8/180 (4%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltl------gllttvl  526
            GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGTL+L        LTTVL
Sbjct  245  GSVLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTLSLGLLTTVLSLTTVL  304

Query  525  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  346
            SVVYSAVRAGSSTTLLSPPSSP AG  KPLLPL+KADEHEE EKSK VTYSYSFFHIIFS
Sbjct  305  SVVYSAVRAGSSTTLLSPPSSPYAG--KPLLPLEKADEHEEKEKSKPVTYSYSFFHIIFS  362

Query  345  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            LASMYSAMLLTGW+TSVG SG+LVDVGWASVWVRVVTGW TAALF+WSL+AP+LFPDRDF
Sbjct  363  LASMYSAMLLTGWTTSVGGSGRLVDVGWASVWVRVVTGWATAALFIWSLIAPVLFPDRDF  422



>gb|AFK43836.1| unknown [Medicago truncatula]
Length=190

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS YC YLCYSALASEPRDYECN LHKHSK+VSTG+LTLGL+TTVLSVVYS
Sbjct  19   NGSVLPASVISFYCMYLCYSALASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVLSVVYS  78

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSS T+LSPPSSPRAG  KPLLPLD  DE E  EK+K VTYSY+FFH+IFSLASMY
Sbjct  79   AVRAGSSATVLSPPSSPRAG--KPLLPLDAKDE-ESNEKAKPVTYSYAFFHLIFSLASMY  135

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  136  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  190



>ref|XP_002270610.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 ref|XP_010655133.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 emb|CBI25248.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASV+SLYC YLCYS L+SEPRDYECN LHKHSK+VSTGTLTLGLLTT+LSV+YSA
Sbjct  240  GSILPASVVSLYCMYLCYSGLSSEPRDYECNGLHKHSKAVSTGTLTLGLLTTILSVIYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG GKPLLPL+K D  EE  ++K VTYSY+FFHIIFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAGAGKPLLPLEKTDVPEEKHEAKPVTYSYTFFHIIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  360  AMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  413



>ref|XP_009759116.1| PREDICTED: probable serine incorporator isoform X2 [Nicotiana 
sylvestris]
Length=411

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 162/174 (93%), Gaps = 2/174 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTVLSVVYSA
Sbjct  240  GSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG  KPLLPLDK DE EE E++K VTYSYSFFH+IFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLASMYS  357

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  358  AMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  411



>gb|EYU21792.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21793.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21794.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=416

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 162/178 (91%), Gaps = 3/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST +L LGLLTTVLSVVYS
Sbjct  239  SGSLLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSSLGLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHIIFSLA  340
            AVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEH E E+    +AVTYSYSFFH+IFSLA
Sbjct  299  AVRAGSSTTLLSPPSSPRAGSGKPLLPLDKADEHHEEEEKSKSRAVTYSYSFFHLIFSLA  358

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLLTGWSTSVGESGKLVDVGWASVWVR++T W TAALF+WSLVAPILFPDR+F
Sbjct  359  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRIITSWATAALFIWSLVAPILFPDREF  416



>ref|XP_011020548.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=415

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC YLCYS LASEPR+YECN LH+HSK+VSTGTL++GLLTTVLSVVYS
Sbjct  239  NGSVLPASVISLYCMYLCYSGLASEPREYECNGLHRHSKAVSTGTLSIGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKS-KAVTYSYSFFHIIFSLAS  337
            AVRAGSST LLSPPSSPRAG  KPLLPLD KA+E EE EK+ K VTYSYSFFHIIFSLAS
Sbjct  299  AVRAGSSTALLSPPSSPRAGADKPLLPLDNKANEQEEKEKARKPVTYSYSFFHIIFSLAS  358

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTS+GESGKLVDVGW SVWVR++TGW TA L+ WSLVAPILFPDR+F
Sbjct  359  MYSAMLLTGWSTSIGESGKLVDVGWPSVWVRILTGWATAGLYTWSLVAPILFPDREF  415



>gb|EMS53525.1| putative serine incorporator [Triticum urartu]
Length=316

 Score =   220 bits (561),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK++STG+LTLGL TT+LSVVYS
Sbjct  142  NGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAMSTGSLTLGLCTTILSVVYS  201

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSS T+LS P SPRAG  KPLLP  KADE E  +  K VTYSYSFFH+IFSLASMY
Sbjct  202  AVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEETKDVPKPVTYSYSFFHLIFSLASMY  261

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  262  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPLLFPDREF  316



>ref|XP_009615681.1| PREDICTED: probable serine incorporator isoform X3 [Nicotiana 
tomentosiformis]
Length=411

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 2/174 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTVLSVVYSA
Sbjct  240  GSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG  KPLLPLDK DE EE E++K VTYSYSFFH+IFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLASMYS  357

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+F
Sbjct  358  AMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPEREF  411



>gb|ABR25551.1| serine incorporator 3 [Oryza sativa Indica Group]
Length=220

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+LSVVYS
Sbjct  45   NGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVYS  104

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIFSLASM  334
            AVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IFSLASM
Sbjct  105  AVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIFSLASM  164

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  165  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDREF  220



>ref|XP_011082649.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 159/176 (90%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI P+SVISLYC YLCYS LASEPRDYECN LH+HSK+VST +L +GLLTTVLSVVYS
Sbjct  239  SGSILPSSVISLYCMYLCYSGLASEPRDYECNGLHRHSKAVSTSSLAIGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIFSLASM  334
            AVRAGSSTTLLSPPSSPRAG GKPLLPLDKADE  E ++    VTYSYSFFH+IFSLASM
Sbjct  299  AVRAGSSTTLLSPPSSPRAGSGKPLLPLDKADEEHEEKEKSKPVTYSYSFFHLIFSLASM  358

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WSLVAPI+FPDR+F
Sbjct  359  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSLVAPIIFPDREF  414



>ref|XP_006341430.1| PREDICTED: probable serine incorporator-like isoform X2 [Solanum 
tuberosum]
Length=411

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 161/174 (93%), Gaps = 2/174 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+GTL LGLLTTVLSVVYSA
Sbjct  240  GSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGTLALGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSPPSSPRAG  KPLLPLDK DE EE E+SK V+YSYSFFH+IFSLASMYS
Sbjct  300  VRAGSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERSKPVSYSYSFFHLIFSLASMYS  357

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGE+G LVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  358  AMLLTGWSTSVGENGNLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  411



>ref|XP_008461193.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Cucumis melo]
Length=416

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 131/177 (74%), Gaps = 3/177 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GS+ PASVISLYC YLCYS LASEPRDYECN LHKHS  +S GT  + + +         
Sbjct  240  GSVLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSVEISCGTSXISISSKEGDFFSLH  299

Query  507  VRAGssttllsppssPRAG---GGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
                 S                 GKPLLPL+K+DEHEE EKSK VTYSYSFFHIIFSLAS
Sbjct  300  FVCSVSYIEFIRCHILDFSIKWAGKPLLPLEKSDEHEEKEKSKPVTYSYSFFHIIFSLAS  359

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGW+TSVG SGKLVDVGWASVWVR+VTGW TAALF+WSL+AP+LFPDRDF
Sbjct  360  MYSAMLLTGWTTSVGGSGKLVDVGWASVWVRIVTGWATAALFIWSLIAPVLFPDRDF  416



>ref|XP_007140603.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
 gb|ESW12597.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
Length=410

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 159/175 (91%), Gaps = 3/175 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGT+T+GL+TTVLSVVYS
Sbjct  239  NGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTVTMGLVTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSS  +LSPPSSPRAG  KPLLPLD A E E+ EK+K VTYSY+FFH+IFSLASMY
Sbjct  299  AVRAGSSAAVLSPPSSPRAG--KPLLPLD-AREEEDKEKAKPVTYSYAFFHLIFSLASMY  355

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  356  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTSWATALLYLWSLVAPIMFPEREF  410



>ref|XP_009399576.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PAS+ISLYCTYLCYS L+SEPRDYECN LH HSK VSTG+LTLGLLTTVLSVVYS
Sbjct  239  NGSLLPASIISLYCTYLCYSGLSSEPRDYECNGLHNHSKVVSTGSLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM--EKSKAVTYSYSFFHIIFSLAS  337
            AVRAGSST+L SPPSSPRAG  KPLLP DK DE E+   +++K V+YSY+FFH+IFSLAS
Sbjct  299  AVRAGSSTSLFSPPSSPRAGSEKPLLPFDKLDEQEDKKNDEAKPVSYSYTFFHLIFSLAS  358

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTSVGESGKL+DVGW SVWVR+VTGW TAALF+WSLVAP++FPDR+F
Sbjct  359  MYSAMLLTGWSTSVGESGKLIDVGWPSVWVRIVTGWATAALFMWSLVAPLIFPDREF  415



>gb|KDP41926.1| hypothetical protein JCGZ_26944 [Jatropha curcas]
Length=413

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 4/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PASVIS+YC YLCYS LASEPRDYECN LHKHSK+VSTGTLT+GL TTVLSVVYS
Sbjct  239  NGSILPASVISVYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTLTVGLFTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKA--DEHEEMEKSKAVTYSYSFFHIIFSLAS  337
            AVRAGSSTTLLSPPSSPRAG  KPLLPL+ +  + HEE +K K VTYSY+FFHIIFSLAS
Sbjct  299  AVRAGSSTTLLSPPSSPRAG--KPLLPLENSTGEHHEEKDKVKPVTYSYAFFHIIFSLAS  356

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVRV+TGW TA L+LWSLVAPI+FPDR+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVITGWATAGLYLWSLVAPIMFPDREF  413



>ref|XP_010268463.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=414

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 158/175 (90%), Gaps = 1/175 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYCTYLC+S LASEPRDYECN  H+H+K+VSTGTLTLGL TTVLSVVYSA
Sbjct  240  GSILPASVISLYCTYLCFSGLASEPRDYECNGFHRHTKAVSTGTLTLGLFTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDK-ADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLL  P SPR G  KPLLP++K ADE E+ ++++ VTYSY+FFH+IFSLASMY
Sbjct  300  VRAGSSTTLLLEPDSPRGGADKPLLPMNKTADEDEKKDEARPVTYSYAFFHVIFSLASMY  359

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESG LVDVGW SVWVR+VTGWVTAAL++WSLVAP+LFP+R+F
Sbjct  360  SAMLLTGWSTSVGESGNLVDVGWPSVWVRIVTGWVTAALYIWSLVAPLLFPEREF  414



>gb|EMT13726.1| Putative serine incorporator [Aegilops tauschii]
Length=414

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK++STG+LTLGL TT+LSVVYS
Sbjct  240  NGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAMSTGSLTLGLCTTILSVVYS  299

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSS T+LS P SPRAG  KPLLP  KADE E  +  K VTYSYSFFH+IFSLASMY
Sbjct  300  AVRAGSSATVLSAPDSPRAGSDKPLLPFSKADEEETKDVPKPVTYSYSFFHLIFSLASMY  359

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  360  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPLLFPDREF  414



>ref|XP_004492298.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=410

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 158/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGL+TTVLSVVYS
Sbjct  239  NGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLVTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSS T+LSPPSSPRAG  KPLLPLD   E E  EK+K VTYSY+FFH+IFSLASMY
Sbjct  299  AVRAGSSATVLSPPSSPRAG--KPLLPLD-VKEEESNEKAKPVTYSYAFFHLIFSLASMY  355

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  356  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  410



>ref|XP_010687311.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687312.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PASVISLYC YLCYS LASEPRDY+CN LHKHS++VST +LTLGLLTTVLSVVYS
Sbjct  239  NGSILPASVISLYCMYLCYSGLASEPRDYQCNGLHKHSQAVSTTSLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSSTTLLSPPSSPRAG G+PLLPLDK  E EE EK+K V+YSYSFFHIIFSLASMY
Sbjct  299  AVRAGSSTTLLSPPSSPRAGAGRPLLPLDKVAEEEEKEKAKPVSYSYSFFHIIFSLASMY  358

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGW+TSVGESGKLVDVGW+SVWVR+VTGW TAAL++WSLVAP LFPDR+F
Sbjct  359  SAMLLTGWTTSVGESGKLVDVGWSSVWVRIVTGWATAALYIWSLVAPSLFPDREF  413



>ref|XP_003570284.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=414

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI+LYCTYLCYSAL+SEPRDY+CN LH HSK++STG+LTLGL+TT+LSVVYS
Sbjct  239  NGSLLPASVIALYCTYLCYSALSSEPRDYKCNGLHNHSKAMSTGSLTLGLITTILSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHE-EMEKSKAVTYSYSFFHIIFSLASM  334
            AVRAGSS T+LS P SPRAG  KPLLP  KADE E + +  K VTYSYSFFH+IFSLASM
Sbjct  299  AVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEEAKKDVPKPVTYSYSFFHLIFSLASM  358

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAPILFPDR+F
Sbjct  359  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRMATQWATAGLFVWSLVAPILFPDREF  414



>gb|AFK46909.1| unknown [Lotus japonicus]
Length=353

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 156/175 (89%), Gaps = 3/175 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI P+SVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGLLTT LSVVYS
Sbjct  182  NGSILPSSVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLLTTTLSVVYS  241

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSS T+LSPPSSPRAG  KPLLPLD  +E E+ EK K VTYSYSFFH+IFSLASMY
Sbjct  242  AVRAGSSATVLSPPSSPRAG--KPLLPLD-GNEEEKNEKGKPVTYSYSFFHLIFSLASMY  298

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
             AMLLTGWS SVGESGKLVDVGW SVWVR+VT W TA LFLWSLVAPI+FP+R+F
Sbjct  299  FAMLLTGWSPSVGESGKLVDVGWPSVWVRIVTCWATAILFLWSLVAPIMFPEREF  353



>gb|EYU21795.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=414

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 161/178 (90%), Gaps = 5/178 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST +L LGLLTTVLSVVYS
Sbjct  239  SGSLLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSSLGLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHIIFSLA  340
            AVRAGSSTTLLSPPSSPRAG  KPLLPLDKADEH E E+    +AVTYSYSFFH+IFSLA
Sbjct  299  AVRAGSSTTLLSPPSSPRAG--KPLLPLDKADEHHEEEEKSKSRAVTYSYSFFHLIFSLA  356

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLLTGWSTSVGESGKLVDVGWASVWVR++T W TAALF+WSLVAPILFPDR+F
Sbjct  357  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRIITSWATAALFIWSLVAPILFPDREF  414



>gb|KEH22798.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=410

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS YC YLCYSALASEPRDYECN LHKHSK+VSTG+LTLGL+TTVLSVVYS
Sbjct  239  NGSVLPASVISFYCMYLCYSALASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSS T+LSPPSSPRAG  KPLLPLD  DE E  EK+K VTYSY+FFH+IFSLASMY
Sbjct  299  AVRAGSSATVLSPPSSPRAG--KPLLPLDAKDE-ESNEKAKPVTYSYAFFHLIFSLASMY  355

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  356  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  410



>gb|KEH22799.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=427

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS YC YLCYSALASEPRDYECN LHKHSK+VSTG+LTLGL+TTVLSVVYS
Sbjct  256  NGSVLPASVISFYCMYLCYSALASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVLSVVYS  315

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSS T+LSPPSSPRAG  KPLLPLD  DE E  EK+K VTYSY+FFH+IFSLASMY
Sbjct  316  AVRAGSSATVLSPPSSPRAG--KPLLPLDAKDE-ESNEKAKPVTYSYAFFHLIFSLASMY  372

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  373  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  427



>ref|XP_010107188.1| putative serine incorporator [Morus notabilis]
 gb|EXC14084.1| putative serine incorporator [Morus notabilis]
Length=413

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PAS+ISLYCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVLSVVYS
Sbjct  239  SGSILPASIISLYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSSTTLLSPPSSPRAG GKPLLPLDK +EHEE EK+K VTYSYSFFH+IFSLASMY
Sbjct  299  AVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVEEHEEKEKAKPVTYSYSFFHLIFSLASMY  358

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  359  SAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  413



>ref|XP_006649122.1| PREDICTED: probable serine incorporator-like, partial [Oryza 
brachyantha]
Length=384

 Score =   214 bits (546),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+LSVVYS
Sbjct  209  NGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVYS  268

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIFSLASM  334
            AVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IFSLASM
Sbjct  269  AVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIFSLASM  328

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  329  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDREF  384



>emb|CDO98258.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST TLT+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSTLTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            VRAGSSTTLLSP        GKPLLPLDKAD+ EE EK+K VTYSYSFFH+IFSLASMYS
Sbjct  300  VRAGSSTTLLSPSPPSSPRAGKPLLPLDKADKEEEKEKAKPVTYSYSFFHLIFSLASMYS  359

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            AMLLTGWSTSVGESGKLVDVGWASVWVR+VTGW TAALFLWSLVAPILFPDR+F
Sbjct  360  AMLLTGWSTSVGESGKLVDVGWASVWVRIVTGWATAALFLWSLVAPILFPDREF  413



>gb|EAZ24909.1| hypothetical protein OsJ_08689 [Oryza sativa Japonica Group]
Length=414

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+LSVVYS
Sbjct  239  NGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIFSLASM  334
            AVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IFSLASM
Sbjct  299  AVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIFSLASM  358

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  359  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDREF  414



>ref|NP_001048364.1| Os02g0792900 [Oryza sativa Japonica Group]
 dbj|BAD19186.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAD19654.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAF10278.1| Os02g0792900 [Oryza sativa Japonica Group]
 gb|EAY87831.1| hypothetical protein OsI_09251 [Oryza sativa Indica Group]
 dbj|BAG96913.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97616.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+LSVVYS
Sbjct  239  NGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIFSLASM  334
            AVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IFSLASM
Sbjct  299  AVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIFSLASM  358

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  359  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDREF  414



>ref|XP_008790112.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
 ref|XP_008778863.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
Length=415

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASV+SLYC YLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVYS
Sbjct  239  NGSLLPASVLSLYCAYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHIIFSLAS  337
            AVRAGSST++LSPPSSPRAG  KPLLP DK ++ E+ +K  +K V+YSYSFF++IFSLAS
Sbjct  299  AVRAGSSTSVLSPPSSPRAGSEKPLLPFDKVEQQEDRKKDEAKPVSYSYSFFYLIFSLAS  358

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TAAL++WSL+APILFPDR+F
Sbjct  359  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTEWATAALYIWSLIAPILFPDREF  415



>ref|XP_008794380.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=415

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 160/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVYS
Sbjct  239  NGSLLPASVISLYCTYLCYSGLSSEPRDYECNGLHGHSKAVSTGSLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHIIFSLAS  337
            AVRAGSSTTLLSPPSSPRA   +PLLP DK ++ E+ +K  +K V+YSYSFFH+IFSLAS
Sbjct  299  AVRAGSSTTLLSPPSSPRASSERPLLPFDKVEQQEDRKKDEAKPVSYSYSFFHLIFSLAS  358

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAAL++WSL+APILFPDR+F
Sbjct  359  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALYIWSLIAPILFPDREF  415



>ref|XP_009383181.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYCTYLCYS ++SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVYS
Sbjct  239  NGSLLPASVISLYCTYLCYSGISSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHIIFSLAS  337
            AVRAGSSTTL+SPPSSPRAG  KPLLP DK +E E+ +K  +K V+YSY+FFH+IFSLAS
Sbjct  299  AVRAGSSTTLISPPSSPRAGSEKPLLPFDKLEEQEDKKKDEAKPVSYSYAFFHLIFSLAS  358

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTSVG SGKLVDVGW SVWVR++TGW TA+LF+WSL+AP++FP+R F
Sbjct  359  MYSAMLLTGWSTSVGGSGKLVDVGWPSVWVRIITGWATASLFIWSLIAPLIFPERVF  415



>gb|ABK96018.1| unknown [Populus trichocarpa]
Length=414

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 159/176 (90%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC YLCYS L+SEPR+YECN LH+HSK+VST TLT+GLLTTVLSVVYS
Sbjct  239  NGSVLPASVISLYCMYLCYSGLSSEPREYECNGLHRHSKAVSTSTLTIGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASM  334
            AVRAGSSTTLLSPPSSPRAG  KPLLPLD K  E EE EK+K VTYSYSFFHIIFSLASM
Sbjct  299  AVRAGSSTTLLSPPSSPRAGADKPLLPLDNKPSEKEEKEKAKPVTYSYSFFHIIFSLASM  358

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFPDR+F
Sbjct  359  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAGLYIWSLVAPILFPDREF  414



>ref|XP_010532058.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
 ref|XP_010532059.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
Length=414

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 163/175 (93%), Gaps = 1/175 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS+YC YLCYS LASEPRDYECN LHKH+K+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISMYCMYLCYSGLASEPRDYECNGLHKHAKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPPSSPRAG  KPLLPLD KA+E E+ EKSK VTYSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPSSPRAGSEKPLLPLDGKAEEKEDKEKSKPVTYSYAFFHIIFSLASMY  359

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSLVAPILFPDR+F
Sbjct  360  SAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLVAPILFPDREF  414



>ref|XP_010914044.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=415

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASV+SLYC YLCYS L+SEPRDYECN LH HS++VSTG+LTLGLLTTVLSV+YS
Sbjct  239  NGSLLPASVLSLYCAYLCYSGLSSEPRDYECNGLHNHSEAVSTGSLTLGLLTTVLSVIYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM--EKSKAVTYSYSFFHIIFSLAS  337
            AVRAGSSTT+LSPPSSPRAG  KPLLP D  ++ E+   +++K V+YSYSFF++IFSLAS
Sbjct  299  AVRAGSSTTVLSPPSSPRAGAEKPLLPFDTVEQQEDRKNDEAKPVSYSYSFFYLIFSLAS  358

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MY+AMLLTGWSTSVGESGKLVDVGW+SVWVR+VT W TAAL++WSL+APILFPDR+F
Sbjct  359  MYAAMLLTGWSTSVGESGKLVDVGWSSVWVRIVTQWATAALYIWSLIAPILFPDREF  415



>ref|XP_010929190.1| PREDICTED: probable serine incorporator isoform X1 [Elaeis guineensis]
Length=423

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 160/185 (86%), Gaps = 10/185 (5%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVYS
Sbjct  239  NGSLLPASVISLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRA--------GGGKPLLPLDKADEHEEMEKSKA--VTYSYSFF  361
            AVRAGSST+LLSPPSSPRA        G  KPLLP DK ++ E+ +K +A  ++YSY FF
Sbjct  299  AVRAGSSTSLLSPPSSPRAISCVQPGVGSEKPLLPFDKVEQQEDRKKDEAKLISYSYPFF  358

Query  360  HIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILF  181
            H+IFSLASMYSAMLLTGWSTS+GESGKLVDVGW SVWVR+VTGW TAAL++WSL+AP+LF
Sbjct  359  HLIFSLASMYSAMLLTGWSTSIGESGKLVDVGWPSVWVRIVTGWATAALYIWSLIAPMLF  418

Query  180  PDRDF  166
            PDR+F
Sbjct  419  PDREF  423



>ref|XP_002454688.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
 gb|EES07664.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
Length=413

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVYS
Sbjct  239  NGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLASM  334
            AVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IFSLASM
Sbjct  299  AVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIFSLASM  357

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAPILFPDR+F
Sbjct  358  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPILFPDREF  413



>ref|XP_010929191.1| PREDICTED: probable serine incorporator isoform X2 [Elaeis guineensis]
Length=415

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 159/177 (90%), Gaps = 2/177 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVYS
Sbjct  239  NGSLLPASVISLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLAS  337
            AVRAGSST+LLSPPSSPRA   KPLLP DK ++ E+ +K +A  ++YSY FFH+IFSLAS
Sbjct  299  AVRAGSSTSLLSPPSSPRASSEKPLLPFDKVEQQEDRKKDEAKLISYSYPFFHLIFSLAS  358

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTS+GESGKLVDVGW SVWVR+VTGW TAAL++WSL+AP+LFPDR+F
Sbjct  359  MYSAMLLTGWSTSIGESGKLVDVGWPSVWVRIVTGWATAALYIWSLIAPMLFPDREF  415



>ref|XP_004954190.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=413

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTT+LSVVYS
Sbjct  239  NGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTILSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLASM  334
            AVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IFSLASM
Sbjct  299  AVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIFSLASM  357

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTS+GESGKLVDVGW SVWVR+ T W TA LF+WSLVAPILFPDR+F
Sbjct  358  YSAMLLTGWSTSIGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPILFPDREF  413



>ref|XP_010459155.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPP SPRA   KPLLPLD KADE EE E  K V+YSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPDSPRAE--KPLLPLDGKADEKEEKECKKPVSYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  358  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>ref|XP_006307669.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
 gb|EOA40567.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
Length=412

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPP SPRA   KPLLPLD KADE EE E  K V+YSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPDSPRAE--KPLLPLDGKADEKEEKENKKPVSYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  358  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>ref|XP_011034606.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034607.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034608.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=414

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC YLCYS L+SEPR+YECN LH+HSK+VST TLT+GLLTTVLSVVYS
Sbjct  239  NGSVLPASVISLYCMYLCYSGLSSEPREYECNGLHRHSKAVSTSTLTIGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASM  334
            AVRAGSS TLLSPPSSPRAG  KPLLPLD K  E EE EK+K VTYSYSFFHIIFSLASM
Sbjct  299  AVRAGSSNTLLSPPSSPRAGADKPLLPLDNKPSEKEEKEKAKPVTYSYSFFHIIFSLASM  358

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWS SVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFPDR+F
Sbjct  359  YSAMLLTGWSASVGESGKLVDVGWPSVWVRILTGWATAGLYIWSLVAPILFPDREF  414



>ref|XP_010497691.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497697.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497701.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497705.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPP SPRA   KPLLPLD KADE EE E  K V+YSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPDSPRAE--KPLLPLDGKADEKEEKECKKPVSYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSL+APILFPDR+F
Sbjct  358  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLIAPILFPDREF  412



>ref|XP_002297693.2| TMS membrane family protein [Populus trichocarpa]
 gb|EEE82498.2| TMS membrane family protein [Populus trichocarpa]
Length=414

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC YLCYS L+SEPR+YECN LH+HSK+VST TLT+GLLTTVLSVVYS
Sbjct  239  NGSVLPASVISLYCMYLCYSGLSSEPREYECNGLHRHSKAVSTSTLTIGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASM  334
            AVRAGSSTTLLSPPSSP AG  KPLLPLD K  E EE EK+K VTYSYSFFHIIFSLASM
Sbjct  299  AVRAGSSTTLLSPPSSPHAGADKPLLPLDNKPSEKEEKEKAKPVTYSYSFFHIIFSLASM  358

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFPDR+F
Sbjct  359  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAGLYIWSLVAPILFPDREF  414



>ref|XP_010063622.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
Length=414

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PA+VISLYC YLCYS LASEPRDYECN LH HSK+VSTGTLTLGL+TTVLSVVYS
Sbjct  239  NGSILPAAVISLYCMYLCYSGLASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK-AVTYSYSFFHIIFSLASM  334
            AVRAGSSTTLLSPPSSPRA  GKPLLPLD   E EE ++    VTYSYSFFHIIFSLASM
Sbjct  299  AVRAGSSTTLLSPPSSPRAAAGKPLLPLDNKAEEEEEKEKSKTVTYSYSFFHIIFSLASM  358

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAM+LTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  359  YSAMILTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  414



>ref|NP_001130490.1| hypothetical protein precursor [Zea mays]
 gb|ACF78724.1| unknown [Zea mays]
 gb|ACN28943.1| unknown [Zea mays]
 gb|AFW73836.1| hypothetical protein ZEAMMB73_916907 [Zea mays]
Length=413

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI +YCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVYS
Sbjct  239  NGSLLPASVIGMYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLASM  334
            AVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IFSLASM
Sbjct  299  AVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIFSLASM  357

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  358  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPVLFPDREF  413



>gb|ACL54492.1| unknown [Zea mays]
Length=413

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI +YCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVYS
Sbjct  239  NGSLLPASVIGMYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLASM  334
            AVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IFSLASM
Sbjct  299  AVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIFSLASM  357

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  358  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPVLFPDREF  413



>ref|XP_006845424.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
 gb|ERN07099.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
Length=415

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YCTYLCYSAL+SEPRDYECN LH HSK+VSTGTLTLGLLTTVLSVVYS
Sbjct  239  NGSLLPASVISVYCTYLCYSALSSEPRDYECNGLHHHSKAVSTGTLTLGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHIIFSLAS  337
            AVRAGSSTTLLSPPSSPRAG  KPLL  DK ++ E+ +K  +K V+YSYSFFH+IFSLAS
Sbjct  299  AVRAGSSTTLLSPPSSPRAGSEKPLLSFDKLEKQEDKKKHEAKPVSYSYSFFHLIFSLAS  358

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWS+SVGESG+LVDVGW SVWVR++T W TA LF+WSL+AP LFP+R+F
Sbjct  359  MYSAMLLTGWSSSVGESGQLVDVGWPSVWVRIITQWATAGLFVWSLIAPHLFPEREF  415



>ref|XP_010476724.1| PREDICTED: serine incorporator 3 [Camelina sativa]
Length=412

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 156/175 (89%), Gaps = 3/175 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPP SP A   KPLLPLD KADE EE E  K V+YSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPDSPPAE--KPLLPLDGKADEKEEKECKKPVSYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  358  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>gb|KCW70853.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=316

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 156/176 (89%), Gaps = 3/176 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PA+VISLYC YLCYS LASEPRDYECN LH HSK+VSTGTLTLGL+TTVLSVVYS
Sbjct  143  NGSILPAAVISLYCMYLCYSGLASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVLSVVYS  202

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK-AVTYSYSFFHIIFSLASM  334
            AVRAGSSTTLLSPPSSPRAG  KPLLPLD   E EE ++    VTYSYSFFHIIFSLASM
Sbjct  203  AVRAGSSTTLLSPPSSPRAG--KPLLPLDNKAEEEEEKEKSKTVTYSYSFFHIIFSLASM  260

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAM+LTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  261  YSAMILTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  316



>emb|CDY52849.1| BnaA09g56410D [Brassica napus]
Length=400

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 158/175 (90%), Gaps = 2/175 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS+YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  227  GSILPASVISVYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  286

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLS P SPRAG  KPLLPLD KA++ EE E+ K VTYSY+FFHIIFSLASMY
Sbjct  287  VRAGSSTTLLSSPDSPRAGE-KPLLPLDGKAEDKEEKEQKKPVTYSYAFFHIIFSLASMY  345

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  346  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  400



>ref|XP_010246591.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=409

 Score =   205 bits (521),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 151/175 (86%), Gaps = 1/175 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSIFPAS ISL+CTYLCYS LASEPRDYECN LH+HSK+V TGT+ LGLLTTV+SVVYSA
Sbjct  235  GSIFPASAISLFCTYLCYSGLASEPRDYECNGLHQHSKTVPTGTIILGLLTTVVSVVYSA  294

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLASMY  331
            VRAGSST+L S  +  R G  K L+PL+K DE EE E  S+  TYSY+FFH+IFSLASMY
Sbjct  295  VRAGSSTSLFSESTLSRVGEEKHLIPLNKTDEEEEEEDESRPATYSYAFFHVIFSLASMY  354

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGE GKLVDVGW SVWVR+VTGW TAA+++WSLVAP+LFPDR+F
Sbjct  355  SAMLLTGWSTSVGEIGKLVDVGWPSVWVRIVTGWATAAVYIWSLVAPLLFPDREF  409



>ref|XP_009117776.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
 ref|XP_009117777.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
Length=413

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS+YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISVYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLS P SPRAG  KPLLPLD   E +E ++ K  VTYSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSSPDSPRAGE-KPLLPLDGKAEDKEEKEQKKPVTYSYAFFHIIFSLASMY  358

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  359  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  413



>emb|CDX81752.1| BnaC08g38490D [Brassica napus]
Length=412

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 156/175 (89%), Gaps = 3/175 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLS P SPRA   KPLLPLD KA+E EE E+ K VTYSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSSPDSPRAE--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDRDF
Sbjct  358  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRDF  412



>ref|XP_009110458.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
 ref|XP_009110459.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
Length=412

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 158/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPP SPRAG  KPLLPLD KA+E EE E+ K VTYSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPDSPRAG--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WS+VAPILFPDR+F
Sbjct  358  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSVVAPILFPDREF  412



>emb|CDY70974.1| BnaAnng35710D [Brassica napus]
Length=412

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 155/175 (89%), Gaps = 3/175 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPP SPRAG  KPLLPLD   E +E ++ K  VTYSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPDSPRAG--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WS+VAPILFPDR+F
Sbjct  358  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSVVAPILFPDREF  412



>ref|XP_003532291.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN07179.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 158/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGL TTVLSVVYS
Sbjct  239  NGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLATTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSS  +LSPPSSPRAG  KPLLPLD  ++ EE EK+K VTYSY+FFH+IFSLASMY
Sbjct  299  AVRAGSSAAVLSPPSSPRAG--KPLLPLDAKED-EEKEKAKPVTYSYAFFHLIFSLASMY  355

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR++T W TA L+LWSLVAPI+FP+R+F
Sbjct  356  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIITSWATALLYLWSLVAPIMFPEREF  410



>ref|XP_010063623.1| PREDICTED: probable serine incorporator isoform X2 [Eucalyptus 
grandis]
 gb|KCW70852.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=412

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 156/176 (89%), Gaps = 3/176 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PA+VISLYC YLCYS LASEPRDYECN LH HSK+VSTGTLTLGL+TTVLSVVYS
Sbjct  239  NGSILPAAVISLYCMYLCYSGLASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK-AVTYSYSFFHIIFSLASM  334
            AVRAGSSTTLLSPPSSPRAG  KPLLPLD   E EE ++    VTYSYSFFHIIFSLASM
Sbjct  299  AVRAGSSTTLLSPPSSPRAG--KPLLPLDNKAEEEEEKEKSKTVTYSYSFFHIIFSLASM  356

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAM+LTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  357  YSAMILTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  412



>ref|XP_003552131.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN15373.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGT+TLGL TTVLSVVYS
Sbjct  239  NGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTITLGLATTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSS  +LSPPSSPRAG  KPLLPLD  ++ EE EK+K VTYSY+FFH+IFSLASMY
Sbjct  299  AVRAGSSAAVLSPPSSPRAG--KPLLPLDAKED-EEKEKAKPVTYSYAFFHLIFSLASMY  355

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVR++T W TA L+LWSL+API+FP+R+F
Sbjct  356  SAMLLTGWSTSVGESGKLVDVGWPSVWVRIITSWATALLYLWSLIAPIMFPEREF  410



>ref|XP_002890152.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66411.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPP SPRA   KPLLP+D KA+E EE E  K V+YSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPDSPRAE--KPLLPIDGKAEEKEEKENKKPVSYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  358  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>ref|XP_002512768.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF49271.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=413

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 156/177 (88%), Gaps = 4/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PASVIS YC YLCYS LASEPR+YECN LHKHSK+VSTGTL++GLLTTVLSVVYS
Sbjct  239  SGSILPASVISAYCMYLCYSGLASEPREYECNGLHKHSKAVSTGTLSIGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLAS  337
            AVRAGSSTTLLSPPSSPRAG  KPLLPL+     E  EK KA  VTYSY+FFHIIFSLAS
Sbjct  299  AVRAGSSTTLLSPPSSPRAG--KPLLPLENKIAEEHEEKEKAKPVTYSYAFFHIIFSLAS  356

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSL+APILFPDR+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLLAPILFPDREF  413



>ref|NP_173069.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 ref|NP_001185008.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAF18512.1|AC010924_25 Contains similarity to gb|AF181686 membrane protein TMS1d from 
Drosophila melanogaster. ESTs gb|R64994, gb|AI994832, gb|Z47674 
come from this gene [Arabidopsis thaliana]
 gb|AEE29416.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEE29417.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=412

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 156/175 (89%), Gaps = 3/175 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVISLYC YLCYS LASEPRDYECN LH HSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISLYCMYLCYSGLASEPRDYECNGLHNHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPP SPRA   KPLLP+D KA+E EE E  K V+YSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPDSPRAE--KPLLPIDGKAEEKEEKENKKPVSYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  358  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>ref|XP_006416842.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 ref|XP_006416843.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35195.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35196.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
Length=412

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 155/175 (89%), Gaps = 3/175 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPP SPRA   KPLLPLD KA+E EE E  K V+YSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPDSPRAE--KPLLPLDGKAEEKEEKENKKPVSYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGWSTSVGESG LVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  358  SAMLLTGWSTSVGESGNLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>gb|ABR17762.1| unknown [Picea sitchensis]
 gb|ABR17907.1| unknown [Picea sitchensis]
Length=417

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 150/178 (84%), Gaps = 3/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YCTYLCYS L+SEPRDYECN LH H K+VST TL LG++TTVLSVVYS
Sbjct  239  NGSLLPASVISVYCTYLCYSGLSSEPRDYECNGLHGHVKAVSTSTLLLGMITTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADE-HEEMEK--SKAVTYSYSFFHIIFSLA  340
            AVRAGSST LLSPPSSPRAG GKPLL  D+ +E H+  +K   + VTYSYSFFH+IF+LA
Sbjct  299  AVRAGSSTALLSPPSSPRAGSGKPLLSFDEIEEGHKNTQKDEERPVTYSYSFFHVIFALA  358

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLLTGW++S  +  KL+ VGW +VWVR+ T W+TAAL++WSLVAP+LFPDR+F
Sbjct  359  SMYSAMLLTGWTSSTADGEKLIGVGWHTVWVRICTEWITAALYIWSLVAPLLFPDREF  416



>emb|CDX83957.1| BnaC08g16880D [Brassica napus]
Length=821

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 157/174 (90%), Gaps = 3/174 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVVYSA
Sbjct  240  GSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            VRAGSSTTLLSPP SPRAG  KPLLPLD KA+E EE E+ K VTYSY+FFHIIFSLASMY
Sbjct  300  VRAGSSTTLLSPPDSPRAG--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIFSLASMY  357

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  169
            SAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSL+APILFPDR+
Sbjct  358  SAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLIAPILFPDRE  411



>ref|XP_006850791.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
 gb|ERN12372.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
Length=339

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 151/177 (85%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+FPASVIS+YC YLCY+ L+SEPRDYECN LHKHSK+VSTGTL +G++TTVLSVVYS
Sbjct  163  NGSLFPASVISMYCAYLCYTGLSSEPRDYECNGLHKHSKAVSTGTLIMGMITTVLSVVYS  222

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLAS  337
            AVRAGSSTT LSPPSSP+AG  KPLL  D  DE E+ ++++A  V+YSY+FFH+IF+LAS
Sbjct  223  AVRAGSSTTFLSPPSSPKAGEKKPLLESDNLDEVEKNKQNEARPVSYSYTFFHLIFALAS  282

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGW TS+ +S  L+DVGW SVWVR+ T WVTA L++WSLVAP++  DR+F
Sbjct  283  MYSAMLLTGW-TSLSDSEDLIDVGWTSVWVRMCTEWVTAGLYVWSLVAPLILSDREF  338



>ref|XP_008673654.1| PREDICTED: uncharacterized protein LOC100191916 isoform X1 [Zea 
mays]
Length=339

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 146/176 (83%), Gaps = 3/176 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS   L LG+LTTVLSVVYSA
Sbjct  164  GSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSMSALILGMLTTVLSVVYSA  223

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHIIFSLASM  334
            VRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+IF+LASM
Sbjct  224  VRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLIFALASM  282

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGW+++  ES +L+DVGW +VWVR+ T WVTA L++W+L+AP+LFPDRDF
Sbjct  283  YSAMLLTGWTSAASESSELMDVGWTTVWVRICTEWVTAGLYIWTLIAPLLFPDRDF  338



>tpg|DAA49274.1| TPA: hypothetical protein ZEAMMB73_017777 [Zea mays]
Length=359

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 146/176 (83%), Gaps = 3/176 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS   L LG+LTTVLSVVYSA
Sbjct  184  GSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSMSALILGMLTTVLSVVYSA  243

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHIIFSLASM  334
            VRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+IF+LASM
Sbjct  244  VRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLIFALASM  302

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGW+++  ES +L+DVGW +VWVR+ T WVTA L++W+L+AP+LFPDRDF
Sbjct  303  YSAMLLTGWTSAASESSELMDVGWTTVWVRICTEWVTAGLYIWTLIAPLLFPDRDF  358



>gb|ABR16232.1| unknown [Picea sitchensis]
Length=407

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 146/177 (82%), Gaps = 3/177 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GS+ PASVIS+YC YLCY  L+SEPRDY CN LH H+ +VSTGTL LG+LTTVLSV+YSA
Sbjct  231  GSLLPASVISVYCAYLCYCGLSSEPRDYGCNGLHNHTAAVSTGTLILGMLTTVLSVIYSA  290

Query  507  VRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
            VRAGSSTT LSPP+SPR G  KPLL    +++  + E+ ++ + VTYSY+FFH+IF+LAS
Sbjct  291  VRAGSSTTFLSPPTSPRTGSEKPLLESKDVEEGQKDEKKDEGRPVTYSYTFFHLIFALAS  350

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGW++S  +S +LVDVGW SVWVR+ T W+TA L++W+L+API FPDR+F
Sbjct  351  MYSAMLLTGWTSSTKDSEELVDVGWPSVWVRICTEWITAGLYVWTLLAPIFFPDREF  407



>dbj|BAK02293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=186

 Score =   175 bits (443),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 141/178 (79%), Gaps = 3/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC YLCY++L+SEP DY CN LH HSK VS   L LG+LTTVLSVVYS
Sbjct  8    NGSVMPASVISVYCAYLCYTSLSSEPYDYACNGLHMHSKQVSMSALVLGMLTTVLSVVYS  67

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHE---EMEKSKAVTYSYSFFHIIFSLA  340
            AVRAGSSTT LSPPSSPR+G   PLL     +E +   E  ++  V+YSY+FFH+IF+LA
Sbjct  68   AVRAGSSTTFLSPPSSPRSGARNPLLGDANVEEGKGSSEGSEAHPVSYSYTFFHLIFALA  127

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLLTGW+++  +  +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  128  SMYSAMLLTGWTSATSDRSELMDVGWTTVWVRICTEWSTAALYIWTLVAPLLFPDRDF  185



>ref|NP_001130812.1| uncharacterized protein LOC100191916 [Zea mays]
 gb|ACF79174.1| unknown [Zea mays]
 gb|ACF82535.1| unknown [Zea mays]
 gb|ACF85768.1| unknown [Zea mays]
 gb|ACG39558.1| serine incorporator 3 [Zea mays]
 tpg|DAA49275.1| TPA: Serine incorporator 3 isoform 1 [Zea mays]
 tpg|DAA49276.1| TPA: Serine incorporator 3 isoform 2 [Zea mays]
Length=415

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 146/176 (83%), Gaps = 3/176 (2%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS   L LG+LTTVLSVVYSA
Sbjct  240  GSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSMSALILGMLTTVLSVVYSA  299

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHIIFSLASM  334
            VRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+IF+LASM
Sbjct  300  VRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLIFALASM  358

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGW+++  ES +L+DVGW +VWVR+ T WVTA L++W+L+AP+LFPDRDF
Sbjct  359  YSAMLLTGWTSAASESSELMDVGWTTVWVRICTEWVTAGLYIWTLIAPLLFPDRDF  414



>ref|XP_002466928.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
 gb|EER93926.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
Length=415

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS G L LG+LTTVLSVVYS
Sbjct  239  NGSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSLGALILGMLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHIIFSLAS  337
            AVRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+IF+LAS
Sbjct  299  AVRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLIFALAS  357

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGW+++  E  +L+DVGW +VWVR+ T WVTAAL++W+L+AP+LFPDRDF
Sbjct  358  MYSAMLLTGWTSAASERSELMDVGWTTVWVRICTEWVTAALYIWTLIAPLLFPDRDF  414



>ref|NP_001050476.1| Os03g0454100 [Oryza sativa Japonica Group]
 gb|AAO73245.1| putative membrane protein [Oryza sativa Japonica Group]
 gb|ABF97019.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12390.1| Os03g0454100 [Oryza sativa Japonica Group]
 dbj|BAG90227.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75563.1| hypothetical protein OsI_12232 [Oryza sativa Indica Group]
 gb|EEE59340.1| hypothetical protein OsJ_11423 [Oryza sativa Japonica Group]
Length=417

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 143/178 (80%), Gaps = 3/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC YLCY++L+SEP DY CN LH+HSK VS   L LG+LTTVLSVVYS
Sbjct  239  NGSVMPASVISVYCAYLCYTSLSSEPDDYACNGLHRHSKQVSMSALILGMLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK---SKAVTYSYSFFHIIFSLA  340
            AVRAGSSTT LSPPSSPR+G   PLL  D  +  +   K   ++ V+YSY+FFH+IF+LA
Sbjct  299  AVRAGSSTTFLSPPSSPRSGIKNPLLGDDNVEAGKSNSKEIDARPVSYSYTFFHVIFALA  358

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLLTGW+++  +S +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  359  SMYSAMLLTGWTSAASDSSELMDVGWTTVWVRICTEWATAALYIWTLVAPLLFPDRDF  416



>ref|XP_004982576.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=415

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GSI PASVIS+YC YLCYS+L+SEP  YECN LH HSK VS   L LG+LTTVLSVVYS
Sbjct  239  NGSIMPASVISVYCAYLCYSSLSSEPDGYECNGLHMHSKQVSMSALILGMLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME-KSKAVTYSYSFFHIIFSLASM  334
            AVRAGSSTT LSPPSSPR+G   PLL  ++  +  + + + + V+YSY+FFH+IF+LASM
Sbjct  299  AVRAGSSTTFLSPPSSPRSGAKNPLLGDEETGKGVDKDTEPRPVSYSYTFFHLIFALASM  358

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLLTGW+++  E  +L+DVGW +VWVR+ T WVTAAL++W+L+AP+LFPDRDF
Sbjct  359  YSAMLLTGWTSAASEKSELMDVGWTTVWVRICTEWVTAALYIWTLIAPLLFPDRDF  414



>ref|XP_008458551.1| PREDICTED: serine incorporator 3 [Cucumis melo]
Length=411

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 144/178 (81%), Gaps = 4/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+VS GTL LG+LTTVLSV+YS
Sbjct  234  NGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLHTKSKAVSVGTLVLGMLTTVLSVIYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
            A+RAGSSTT LSPPSSPRAGG KPLL    L+     +   + + V+YSY+FFH+IF+LA
Sbjct  294  ALRAGSSTTFLSPPSSPRAGGSKPLLESEDLEDGKNKKTEGEGQPVSYSYTFFHLIFALA  353

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLL+GW TS+ ES  L+DVGW SVWVR+ T WVTA L++WSLVAP+LFPDR+F
Sbjct  354  SMYSAMLLSGW-TSLNESSDLIDVGWTSVWVRICTEWVTAGLYIWSLVAPLLFPDREF  410



>ref|XP_010546829.1| PREDICTED: serine incorporator 3 isoform X1 [Tarenaya hassleriana]
Length=410

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 142/177 (80%), Gaps = 4/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPRDYECN LH  SK+V+T TL LG+LTTVLSV+YS
Sbjct  235  NGSLLPASVISVYCVYVCYTGLSSEPRDYECNGLHNKSKAVTTSTLILGMLTTVLSVIYS  294

Query  510  aVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
            AVRAGSSTT LSPPSSPRA G  PLL  P D   +  E E  + V+YSYSFFH+IF+LAS
Sbjct  295  AVRAGSSTTFLSPPSSPRAAGATPLLEDPEDGKKKSNETEP-RPVSYSYSFFHVIFALAS  353

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MY+AMLL+GW+ S  ES  L+DVGW SVWVR+ TGWVTA L++W+LVAP + PDR+F
Sbjct  354  MYAAMLLSGWTDS-SESASLIDVGWTSVWVRICTGWVTAGLYIWTLVAPFVLPDREF  409



>ref|XP_006650244.1| PREDICTED: probable serine incorporator-like [Oryza brachyantha]
Length=417

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 141/178 (79%), Gaps = 3/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PAS+IS+YC YLCY++L+SEP DY CN LH+HSK VS   L LG+LTTVLSVVYS
Sbjct  239  NGSVMPASIISVYCAYLCYTSLSSEPDDYACNGLHRHSKQVSMSALILGMLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK---SKAVTYSYSFFHIIFSLA  340
            AVRAGSSTT LSPPSSPR+G   PLL  D  +      K   ++ V+YSY+FFH+IF+LA
Sbjct  299  AVRAGSSTTFLSPPSSPRSGTKNPLLGDDNVEAGNGNGKELDARPVSYSYTFFHLIFALA  358

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLLTGW+++  +S +L+DVGW +VWVR+ T W TA L++W+LVAP+LFPDRDF
Sbjct  359  SMYSAMLLTGWTSAASDSSELMDVGWTTVWVRICTEWATAGLYIWTLVAPLLFPDRDF  416



>ref|XP_010237604.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
 ref|XP_010237605.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=418

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 143/179 (80%), Gaps = 4/179 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC YLCYS+L+SEP DY CN LH HSK VS G L LG+LTTVLSVVYS
Sbjct  239  NGSVMPASVISVYCAYLCYSSLSSEPDDYACNGLHMHSKQVSVGALILGMLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFHIIFSL  343
            AVRAGSSTT LSPPSSPR+G   PLL     +E +  + +    + V+YSY+FFH+IF+L
Sbjct  299  AVRAGSSTTFLSPPSSPRSGTKNPLLGDANVEEGKGEDTTGSEPRPVSYSYTFFHLIFAL  358

Query  342  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            ASMYSAMLLTGW+++  ESG+L+DVGW +VWVR+   W TAAL++W+LVAP+LFPDRDF
Sbjct  359  ASMYSAMLLTGWTSAGSESGELMDVGWTTVWVRICMEWATAALYIWTLVAPLLFPDRDF  417



>ref|XP_011090806.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=411

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 145/177 (82%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC YLCY+ L+SEPRDY CN LH  SK+VST TL LG+LTTVLSV+YS
Sbjct  235  NGSLLPASVISVYCAYLCYTGLSSEPRDYVCNGLHNKSKAVSTSTLVLGMLTTVLSVLYS  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLAS  337
            A+RAGSSTT LSPPSSPRAG  KPLL  D+ +  +    ++A  V+YSY+FFH+IF+LAS
Sbjct  295  ALRAGSSTTFLSPPSSPRAGDKKPLLESDELESGKGKNDAEARPVSYSYTFFHLIFALAS  354

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW TS  E+ +L+D+GW SVWVR+ T WVTA L++WSL+AP+LFPDR+F
Sbjct  355  MYSAMLLSGW-TSSSENPELIDIGWTSVWVRICTEWVTAGLYIWSLIAPLLFPDREF  410



>ref|XP_004150322.1| PREDICTED: serine incorporator 3-like [Cucumis sativus]
 gb|KGN47263.1| hypothetical protein Csa_6G238640 [Cucumis sativus]
Length=411

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 143/178 (80%), Gaps = 4/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+VS GTL LG+LTTVLSV+YS
Sbjct  234  NGSLLPASVISVYCAYVCYTGLSSEPRDYVCNDLHTKSKAVSVGTLVLGMLTTVLSVIYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
            A+RAGSSTT LSPPSSPRAGG KPLL    L+     +   + + V+YSY+FFH+IF+LA
Sbjct  294  ALRAGSSTTFLSPPSSPRAGGSKPLLESEDLEDGKNKKTEGEGQPVSYSYTFFHLIFALA  353

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLL+GW TS+ ES  L+DVGW SVWVR+ T WVT  L++WSLVAP+LFPDR+F
Sbjct  354  SMYSAMLLSGW-TSLNESSDLIDVGWTSVWVRICTEWVTGGLYIWSLVAPLLFPDREF  410



>ref|XP_004169518.1| PREDICTED: LOW QUALITY PROTEIN: serine incorporator 3-like [Cucumis 
sativus]
Length=411

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 143/178 (80%), Gaps = 4/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+VS GTL LG+LTTVLSV+YS
Sbjct  234  NGSLLPASVISVYCAYVCYTGLSSEPRDYVCNDLHTKSKAVSVGTLVLGMLTTVLSVIYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
            A+RAGSSTT LSPPSSPRAGG KPLL    L+     +   + + V+YSY+FFH+IF+LA
Sbjct  294  ALRAGSSTTFLSPPSSPRAGGSKPLLESEDLEDGKNKKTEGEGQPVSYSYTFFHLIFALA  353

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLL+GW TS+ ES  L+DVGW SVWVR+ T WVT  L++WSLVAP+LFPDR+F
Sbjct  354  SMYSAMLLSGW-TSLNESSDLIDVGWTSVWVRICTEWVTGGLYIWSLVAPLLFPDREF  410



>gb|EYU43840.1| hypothetical protein MIMGU_mgv1a006662mg [Erythranthe guttata]
Length=436

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK VST TL LG+LTTVLSV+YS
Sbjct  260  NGSLLPASVISMYCAYVCYTGLSSEPRDYVCNGLHNKSKVVSTSTLILGMLTTVLSVLYS  319

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKAD--EHEEMEKSKAVTYSYSFFHIIFSLAS  337
            A+RAGSSTT LSPPSSPRAGG KPLL  D+ +  + +   ++K VTYSY FFH+IF+LAS
Sbjct  320  ALRAGSSTTFLSPPSSPRAGGKKPLLEGDELESGKGKNETENKPVTYSYMFFHLIFALAS  379

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW TS  E+ +L+DVGW SVWVR+ T WVTA L++WSL+AP++ PDR+F
Sbjct  380  MYSAMLLSGW-TSDSENPQLIDVGWTSVWVRICTEWVTAGLYVWSLIAPLILPDREF  435



>dbj|BAJ86142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 141/178 (79%), Gaps = 3/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC YLCY++L+SEP DY CN LH HSK VS   L LG+LTTVLSVVYS
Sbjct  239  NGSVMPASVISVYCAYLCYTSLSSEPYDYACNGLHMHSKQVSMSALVLGMLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHE---EMEKSKAVTYSYSFFHIIFSLA  340
            AVRAGSSTT LSPPSSPR+G   PLL     +E +   E  ++  V+YSY+FFH+IF+LA
Sbjct  299  AVRAGSSTTFLSPPSSPRSGARNPLLGDANVEEGKGSSEGSEAHPVSYSYTFFHLIFALA  358

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLLTGW+++  +  +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  359  SMYSAMLLTGWTSATSDRSELMDVGWTTVWVRICTEWSTAALYIWTLVAPLLFPDRDF  416



>ref|XP_008799134.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=416

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 147/178 (83%), Gaps = 3/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC YLCYS L+SEPRDY CN LHKHSK VSTGTL LGLLTTV+SVVYS
Sbjct  239  NGSLLPASVISVYCAYLCYSGLSSEPRDYACNGLHKHSKQVSTGTLVLGLLTTVISVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
            AVR GSST+ LSPPSSP++G  KPLL    L+   + ++  +++ V+YSY+FFH+IF+LA
Sbjct  299  AVRTGSSTSFLSPPSSPKSGSTKPLLEDGELESGKDDKKEGEARPVSYSYTFFHLIFALA  358

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAM+LTGW++S  +S +L+DVGW SVWVR+ T W TAAL++W+LVAP++ PDR+F
Sbjct  359  SMYSAMVLTGWTSSTSDSSELIDVGWTSVWVRICTEWATAALYIWTLVAPLILPDREF  416



>ref|XP_010546830.1| PREDICTED: serine incorporator 3 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 142/177 (80%), Gaps = 5/177 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPRDYECN LH  SK+V+T TL LG+LTTVLSV+YS
Sbjct  235  NGSLLPASVISVYCVYVCYTGLSSEPRDYECNGLHNKSKAVTTSTLILGMLTTVLSVIYS  294

Query  510  aVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
            AVRAGSSTT LSPPSSPRAG   PLL  P D   +  E E  + V+YSYSFFH+IF+LAS
Sbjct  295  AVRAGSSTTFLSPPSSPRAGA-TPLLEDPEDGKKKSNETEP-RPVSYSYSFFHVIFALAS  352

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MY+AMLL+GW+ S  ES  L+DVGW SVWVR+ TGWVTA L++W+LVAP + PDR+F
Sbjct  353  MYAAMLLSGWTDS-SESASLIDVGWTSVWVRICTGWVTAGLYIWTLVAPFVLPDREF  408



>ref|XP_004296950.1| PREDICTED: probable serine incorporator [Fragaria vesca subsp. 
vesca]
Length=409

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 144/178 (81%), Gaps = 6/178 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+Y  Y+CY+AL+SEPRDY CN LH HS +VS GTL LG+ TT+LSV+YS
Sbjct  235  NGSLLPASVISVYSAYVCYTALSSEPRDYACNGLH-HSSAVSVGTLLLGMATTILSVLYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
            A+RAGSSTT LSPPSSPRA   KPLL    L++  +  E E +K V+YSY+FFH+IF+LA
Sbjct  294  ALRAGSSTTFLSPPSSPRAAEKKPLLEGKELEEGKDKNEKE-AKPVSYSYTFFHLIFALA  352

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTAAL++WSLVAP+LFPDR+F
Sbjct  353  SMYSAMLLSGWTNS-AESSDLIDVGWTSVWVRICTEWVTAALYVWSLVAPLLFPDREF  409



>ref|XP_009391591.1| PREDICTED: serine incorporator 3 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 145/179 (81%), Gaps = 5/179 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ P+SVIS+YC YLCYS L+SEPRDY CN LH H K VSTGTL LG+LTTVLSVVYS
Sbjct  239  NGSLLPSSVISIYCAYLCYSGLSSEPRDYACNGLHNHVKQVSTGTLVLGMLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKAD----EHEEMEKSKAVTYSYSFFHIIFSL  343
            AVRAGSSTT LSPPSSP++G   PLL    A+    E +E E ++ V+YSY+FFH+IF+L
Sbjct  299  AVRAGSSTTFLSPPSSPKSGSRSPLLEAGDAESGKPEKKENE-ARPVSYSYTFFHLIFAL  357

Query  342  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            ASMYSAMLLTGWS S+ ES +L+DVGW SVWVR+ T W TAAL++W+LVAP++ PDR+F
Sbjct  358  ASMYSAMLLTGWSGSISESSELIDVGWTSVWVRICTEWATAALYIWTLVAPLILPDREF  416



>ref|XP_002280143.1| PREDICTED: serine incorporator 3 [Vitis vinifera]
 emb|CBI26177.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 143/183 (78%), Gaps = 15/183 (8%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC Y+CY+ L+SEPRDY CN LH  SK+VST TL LG+LTTVLSV+YS
Sbjct  235  NGSLLPASVISLYCAYVCYTGLSSEPRDYACNGLHNKSKAVSTSTLILGMLTTVLSVLYS  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--------VTYSYSFFHI  355
            AVRAGSSTT LSPPSSP++GG KPLL      E E+ E  K         V+YSY+FFH+
Sbjct  295  AVRAGSSTTFLSPPSSPKSGGKKPLL------ESEDTESGKEKKEEEAKPVSYSYTFFHL  348

Query  354  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  175
            IF+LASMYSAMLL+GW TS  +S  ++DVGW SVWVR+ T WVTA L++WSL+APILFPD
Sbjct  349  IFALASMYSAMLLSGW-TSSNDSSDMIDVGWTSVWVRICTEWVTALLYVWSLLAPILFPD  407

Query  174  RDF  166
            R+F
Sbjct  408  REF  410



>ref|XP_010938752.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=416

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 147/178 (83%), Gaps = 3/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC YLCYS L+SEPRDY CN LHKHSK VSTGTL LGLLTTV+SVVYS
Sbjct  239  NGSLLPASVISVYCAYLCYSGLSSEPRDYACNGLHKHSKQVSTGTLVLGLLTTVISVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
            AVR GSST+ LSPPSSP++G  KPLL    ++   + ++  +++ VTYSY+FFH+IF+LA
Sbjct  299  AVRTGSSTSFLSPPSSPKSGSSKPLLEEGEVESGKDDKKESEARPVTYSYTFFHLIFALA  358

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLLTGW++S  +S +L+DVGW SVWVR+ T W TAAL++W+L+AP++ PDR+F
Sbjct  359  SMYSAMLLTGWTSSTSDSSELIDVGWTSVWVRICTEWATAALYIWTLIAPLVLPDREF  416



>ref|XP_009365800.1| PREDICTED: probable serine incorporator isoform X2 [Pyrus x bretschneideri]
Length=409

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 143/178 (80%), Gaps = 6/178 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+Y  Y+CY+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVLSV+YS
Sbjct  235  NGSLLPASVISVYSAYVCYTALSSEPRGYACNGLH-HSKAVSLSTLLLGMATTVLSVLYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLL---PLDKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
            A+RAGSST  LSPPSSPR     PLL    L++A E  + E +K V+YSY+FFH+IF+LA
Sbjct  294  ALRAGSSTNFLSPPSSPRGAEKTPLLDGKELEEAKEKNDKE-AKPVSYSYTFFHLIFALA  352

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLL+GW++S+ ES  L+DVGW SVWVR+ T WVTAAL++WSL+APILFPDR+F
Sbjct  353  SMYSAMLLSGWTSSL-ESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILFPDREF  409



>ref|XP_006419802.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
 ref|XP_006489289.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
 gb|ESR33042.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
Length=414

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 143/178 (80%), Gaps = 4/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+AL+SEP DY CN LH  SK+V+  TL LG+LTTVLSV+YS
Sbjct  237  NGSLLPASVISVYCAYVCYTALSSEPHDYVCNGLHNKSKAVTISTLVLGMLTTVLSVLYS  296

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHIIFSLA  340
            A+RAGSSTT LSPPSSP++ G KPLL  +  +E  E +K    + V+YSYSFFH+IF+LA
Sbjct  297  ALRAGSSTTFLSPPSSPKSAGKKPLLEGEDVEEGTENKKDIEGRPVSYSYSFFHLIFALA  356

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLL+GW TS  ES  L+DVGW SVWVR+ + WVTA L++W+LVAP+LFPDR+F
Sbjct  357  SMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICSQWVTAGLYIWTLVAPLLFPDREF  413



>ref|XP_009365799.1| PREDICTED: probable serine incorporator isoform X1 [Pyrus x bretschneideri]
Length=411

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 141/179 (79%), Gaps = 6/179 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+Y  Y+CY+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVLSV+YS
Sbjct  235  NGSLLPASVISVYSAYVCYTALSSEPRGYACNGLH-HSKAVSLSTLLLGMATTVLSVLYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFHIIFSL  343
            A+RAGSST  LSPPSSPR G  +    LD  +  E  EK+    K V+YSY+FFH+IF+L
Sbjct  294  ALRAGSSTNFLSPPSSPRGGAAEKTPLLDGKELEEAKEKNDKEAKPVSYSYTFFHLIFAL  353

Query  342  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            ASMYSAMLL+GW++S+ ES  L+DVGW SVWVR+ T WVTAAL++WSL+APILFPDR+F
Sbjct  354  ASMYSAMLLSGWTSSL-ESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILFPDREF  411



>ref|XP_009342179.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=411

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 141/179 (79%), Gaps = 6/179 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+Y  Y+CY+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVLSV+YS
Sbjct  235  NGSLLPASVISVYSAYVCYTALSSEPRGYACNGLH-HSKAVSLSTLLLGMATTVLSVLYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFHIIFSL  343
            A+RAGSST  LSPPSSPR G  +    LD  +  E  EK+    K V+YSY+FFH+IF+L
Sbjct  294  ALRAGSSTNFLSPPSSPRGGAAERTPLLDGKELEEAKEKNDKEAKPVSYSYTFFHLIFAL  353

Query  342  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            ASMYSAMLL+GW++S+ ES  L+DVGW SVWVR+ T WVTAAL++WSL+APILFPDR+F
Sbjct  354  ASMYSAMLLSGWTSSL-ESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILFPDREF  411



>ref|XP_010693925.1| PREDICTED: serine incorporator 3 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 139/177 (79%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+V+T TL LG++TTVLSV+YS
Sbjct  234  NGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLHNKSKAVTTSTLVLGMITTVLSVLYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHIIFSLAS  337
            A+RAGSS   LSPPSSPRAG  K LL  +  +   + + S  + V+YSY FFH+IF+LAS
Sbjct  294  ALRAGSSKAFLSPPSSPRAGATKSLLSSEDTEAGRDKKDSEPRPVSYSYMFFHLIFALAS  353

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW++S   S  L+D+GWASVWV++ T WVTA L++WSLVAP+L PDR+F
Sbjct  354  MYSAMLLSGWTSSTDNS-DLIDIGWASVWVKICTEWVTAGLYVWSLVAPLLLPDREF  409



>emb|CDO98987.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 146/177 (82%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPR+Y CN LHK S++VST TL LGLLTT++SV+YS
Sbjct  235  NGSLLPASVISVYCAYVCYTGLSSEPRNYVCNGLHKASRAVSTSTLILGLLTTIISVLYS  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDK--ADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
            A+RAGSSTT LSPPSSPR+GG KPLL  D+  A + ++  + + V+YSYSFF +IF+LAS
Sbjct  295  ALRAGSSTTFLSPPSSPRSGGQKPLLESDELEAGKDKKDAEPRPVSYSYSFFLLIFALAS  354

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSLVAP++FPDR+F
Sbjct  355  MYSAMLLSGW-TSSSESSDLIDVGWTSVWVRMCTEWVTAGLYVWSLVAPLIFPDREF  410



>emb|CDY05246.1| BnaC05g45570D [Brassica napus]
Length=408

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 127/175 (73%), Gaps = 2/175 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++      L T +  +  +
Sbjct  235  NGSLLPASVISVYCAYICYTGLSSEPHDYVCNGLNRSKAVTASTLTLGMLTTVLSVLYSA  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
              RAGSSTT LSPPSSPRAGG + LL   +  +     +++ V+YSYSFFHIIF+LASMY
Sbjct  295  L-RAGSSTTFLSPPSSPRAGGKEALLEDPEDGKKNGEAEARPVSYSYSFFHIIFALASMY  353

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            +AMLL+GW+ S  ES  L+DVGW SVWVR+ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  354  AAMLLSGWTDS-SESASLIDVGWTSVWVRICTGWVTAALYIWTLIAPLILPDREF  407



>ref|XP_006356686.1| PREDICTED: serine incorporator 3-like [Solanum tuberosum]
Length=409

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CYS L+SEPRDY CN LH  SK+V+T TL LG+LTTVLSV+YS
Sbjct  235  NGSLLPASVISVYCAYVCYSGLSSEPRDYVCNGLHNKSKAVTTSTLVLGMLTTVLSVLYS  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            A+RAGS+TT +SPPSSPR+G  K LL  ++ +  +   +++ V+YSY+FFH+IF+LASMY
Sbjct  295  ALRAGSATTFMSPPSSPRSGEKKSLLASEELESGKGSPEARPVSYSYTFFHLIFALASMY  354

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLL+GW TS  ES +L+DVGW S+WVR+ T WVTA L++WSLVAP+ FPDR+F
Sbjct  355  SAMLLSGW-TSSSESSELIDVGWTSLWVRICTEWVTAGLYVWSLVAPLFFPDREF  408



>ref|XP_006595390.1| PREDICTED: probable serine incorporator-like [Glycine max]
Length=375

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PA+V+SLYC Y+CY+ L+SEP DYECN L+K     +   +   L T +  +  +
Sbjct  201  NGSLLPAAVVSLYCAYVCYTGLSSEPHDYECNGLNKSRAVSTGTLVLGMLTTVLSVLYSA  260

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS-KAVTYSYSFFHIIFSLASM  334
              RAGSSTT LSPPSSPR GG KPLL   +  + ++ EK  + V+YSYSFFH+IF+LASM
Sbjct  261  L-RAGSSTTFLSPPSSPRLGGSKPLLEEAEEGKAKKEEKEARPVSYSYSFFHLIFALASM  319

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSL+AP+LFPDR+F
Sbjct  320  YSAMLLSGW-TSTSESSDLIDVGWTSVWVRIGTEWVTAGLYIWSLLAPLLFPDREF  374



>gb|KDO74827.1| hypothetical protein CISIN_1g039061mg [Citrus sinensis]
Length=399

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 142/178 (80%), Gaps = 4/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+AL+SEP DY CN LH  SK+V+  TL LG+LTTVLSV+YS
Sbjct  222  NGSLLPASVISVYCAYVCYTALSSEPHDYVCNGLHNKSKAVTISTLVLGMLTTVLSVLYS  281

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHIIFSLA  340
            A+RAGSSTT LSPPSSP++ G K LL  +  +E  E +K    + V+YSYSFFH+IF+LA
Sbjct  282  ALRAGSSTTFLSPPSSPKSAGKKLLLEGEDVEEGTENKKDIEGRPVSYSYSFFHLIFALA  341

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLL+GW TS  ES  L+DVGW SVWVR+ + WVTA L++W+LVAP+LFPDR+F
Sbjct  342  SMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICSQWVTAGLYIWTLVAPLLFPDREF  398



>emb|CDY24707.1| BnaA05g31060D [Brassica napus]
Length=408

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 2/175 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++  +   L T +  +  +
Sbjct  235  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNRSKAVTASTLILGMLTTVLSVLYSA  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
              RAGSSTT LSPPSSPRAGG + LL   +  +     +++ V+YSYSFFHIIF+LASMY
Sbjct  295  L-RAGSSTTFLSPPSSPRAGGKEALLEDPEDGKKNGEAEARPVSYSYSFFHIIFALASMY  353

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            +AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  354  AAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAALYIWTLIAPLILPDREF  407



>gb|ACJ84561.1| unknown [Medicago truncatula]
 gb|AFK35204.1| unknown [Medicago truncatula]
 gb|KEH36756.1| TMS membrane protein/tumor differentially protein [Medicago truncatula]
Length=409

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC Y+CY+ L+SEPR YECN L+K     +   +   L T +  +  +
Sbjct  235  NGSLLPASVISLYCAYVCYTGLSSEPRGYECNGLNKSRAVSTGTLVLGMLTTVLSVLYSA  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLASM  334
              RAGSSTT LSPPSSP+AG  KPLL   +  + ++ EK ++ V+YSYSFFH+IF+LASM
Sbjct  295  L-RAGSSTTFLSPPSSPKAGESKPLLEEVEEGKSKKEEKEARPVSYSYSFFHLIFALASM  353

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L+LWSL+AP+LFPDR+F
Sbjct  354  YSAMLLSGW-TSTSESSDLIDVGWTSVWVRIGTEWVTAGLYLWSLLAPLLFPDREF  408



>gb|KHN37564.1| Putative serine incorporator [Glycine soja]
Length=407

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PA+V+SLYC Y+CY+ L+SEP DYECN L+K     +   +   L T +  +  +
Sbjct  233  NGSLLPAAVVSLYCAYVCYTGLSSEPHDYECNGLNKSRAVSTGTLVLGMLTTVLSVLYSA  292

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS-KAVTYSYSFFHIIFSLASM  334
              RAGSSTT LSPPSSPR GG KPLL   +  + ++ EK  + V+YSYSFFH+IF+LASM
Sbjct  293  L-RAGSSTTFLSPPSSPRLGGSKPLLEEAEEGKAKKEEKEARPVSYSYSFFHLIFALASM  351

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSL+AP+LFPDR+F
Sbjct  352  YSAMLLSGW-TSTSESSDLIDVGWTSVWVRIGTEWVTAGLYIWSLLAPLLFPDREF  406



>ref|XP_010464184.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=409

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 2/175 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  +  +
Sbjct  236  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLYSA  295

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
              RAGSSTT LSPPSSPR+GG + LL   +  +     +++ V+YSYSFFHIIF+LASMY
Sbjct  296  L-RAGSSTTFLSPPSSPRSGGKEALLEDPEDGKKGSEAEARPVSYSYSFFHIIFALASMY  354

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            +AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  355  AAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAALYIWTLIAPLILPDREF  408



>ref|XP_010486107.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 129/177 (73%), Gaps = 5/177 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  +  +
Sbjct  236  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLYSA  295

Query  510  aVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
              RAGSSTT LSPPSSPRAGG + LL  P D   +  E E ++ V+YSYSFFHIIF+LAS
Sbjct  296  L-RAGSSTTFLSPPSSPRAGGREALLEDPEDGKKKGGEAE-ARPVSYSYSFFHIIFALAS  353

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  354  MYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAVLYIWTLIAPLILPDREF  409



>gb|KJB28193.1| hypothetical protein B456_005G040500 [Gossypium raimondii]
Length=410

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  + +VS  TL LG+LTTVLSV+YS
Sbjct  234  NGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLHNKASAVSLSTLILGMLTTVLSVIYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHIIFSLAS  337
            A+RAGSSTT LSPPSSP+AG  KPLL  D  +E +E ++  ++ V+YSYSFFH+IF+LAS
Sbjct  294  ALRAGSSTTFLSPPSSPKAGTKKPLLEGDDVEEGKETKEKEARPVSYSYSFFHLIFALAS  353

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW TS  +S  LVDVGW SVWVR+ T WVTAAL++W+LVAP++ PDR+F
Sbjct  354  MYSAMLLSGW-TSSSDSSDLVDVGWTSVWVRICTEWVTAALYVWTLVAPLIIPDREF  409



>ref|XP_009129653.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=408

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 2/175 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++      L T +  +  +
Sbjct  235  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNRSKAVTASTLTLGMLTTVLSVLYSA  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
              RAGSSTT LSPPSSPRAGG + LL   +  +     +++ V+YSYSFFHIIF+LASMY
Sbjct  295  L-RAGSSTTFLSPPSSPRAGGKEALLEDPEDGKKNGEAEARPVSYSYSFFHIIFALASMY  353

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            +AMLL+GW+ S  ES  L+DVGW SVWV++ TGW TAAL++W+L+AP++ PDR+F
Sbjct  354  AAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWATAALYIWTLIAPLILPDREF  407



>ref|XP_009799680.1| PREDICTED: probable serine incorporator [Nicotiana sylvestris]
Length=408

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPRDY CN L+K     ++  +   L T +  +  +
Sbjct  235  NGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLNKSKAVTTSTLVLGMLTTVLSVLYSA  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
              RAGSSTT LSPPSSPR+G  K LL  ++ +  +   +++ V+YSYSFFH+IF+LASMY
Sbjct  295  L-RAGSSTTFLSPPSSPRSGEKKSLLASEELESGKGSAEARPVSYSYSFFHLIFALASMY  353

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLL+GW TS  ES  L+DVGW S+WVR+ T WVTA L++WSLVAP+LFPDR+F
Sbjct  354  SAMLLSGW-TSSSESSDLIDVGWTSLWVRICTEWVTAGLYIWSLVAPLLFPDREF  407



>ref|XP_006297798.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
 gb|EOA30696.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
Length=410

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 129/177 (73%), Gaps = 5/177 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  +  +
Sbjct  236  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLYSA  295

Query  510  aVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
              RAGSSTT LSPPSSPR+GG + LL  P D   +  E E ++ V+YSYSFFHIIF+LAS
Sbjct  296  L-RAGSSTTFLSPPSSPRSGGREALLEDPEDGKKKGGEAE-ARPVSYSYSFFHIIFALAS  353

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  354  MYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAGLYIWTLIAPLILPDREF  409



>ref|XP_010436570.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 129/177 (73%), Gaps = 5/177 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  +  +
Sbjct  236  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLYSA  295

Query  510  aVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
              RAGSSTT LSPPSSPR+GG + LL  P D   +  E E ++ V+YSYSFFHIIF+LAS
Sbjct  296  L-RAGSSTTFLSPPSSPRSGGREALLEDPEDGKKKGGEAE-ARPVSYSYSFFHIIFALAS  353

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  354  MYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAVLYIWTLIAPLILPDREF  409



>ref|XP_010322266.1| PREDICTED: serine incorporator 3 [Solanum lycopersicum]
Length=411

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CYS L+SEPRDY CN LH  SK+V+T TL LG+LTTVLSV+YS
Sbjct  235  NGSLLPASVISVYCAYVCYSGLSSEPRDYVCNGLHNKSKAVTTSTLVLGMLTTVLSVLYS  294

Query  510  aVRAGssttllsppssPRA--GGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
            A+RAGS+TT +SPPSSPR+  G  K LL  ++ +  +   +++ V+YSY+FFH+IF+LAS
Sbjct  295  ALRAGSATTFMSPPSSPRSVVGEKKSLLASEELESGKGSPEARPVSYSYTFFHLIFALAS  354

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW TS  ES +L+DVGW S+WVR+ T WVTA L++WSLVAP+L PDR+F
Sbjct  355  MYSAMLLSGW-TSSSESSELIDVGWTSLWVRICTEWVTAGLYVWSLVAPLLLPDREF  410



>gb|AAF30310.1|AC018907_10 hypothetical protein [Arabidopsis thaliana]
Length=315

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K SK+V+  TL LG+LTTVLSV+YS
Sbjct  142  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNK-SKAVNASTLILGMLTTVLSVLYS  200

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            A+RAGSSTT LSPPSSPR+G    LL   +  +     +++ V+YSYSFFHIIF+LASMY
Sbjct  201  ALRAGSSTTFLSPPSSPRSGVKDALLGDPEDGKKSGEAEARPVSYSYSFFHIIFALASMY  260

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            +AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  261  AAMLLSGWTDS-SESATLIDVGWTSVWVKICTGWVTAGLYIWTLIAPLILPDREF  314



>ref|XP_007147778.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
 gb|ESW19772.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
Length=409

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASV+SLYC Y+CY+ L+SEPRDYECN L+K     ++  +   L T +  +  +
Sbjct  235  NGSLLPASVMSLYCAYVCYTGLSSEPRDYECNGLNKSRAVSTSTLVLGMLTTVLSVLYSA  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS-KAVTYSYSFFHIIFSLASM  334
              RAGSS T LSPPSSP+ G  KPLL   +  + ++ EK  + V+YSYSFFH+IF+LASM
Sbjct  295  L-RAGSSKTFLSPPSSPKLGESKPLLEEAEEGKAKKEEKEARPVSYSYSFFHLIFALASM  353

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSL AP+ FPDR+F
Sbjct  354  YSAMLLSGW-TSTYESSDLIDVGWTSVWVRIGTEWVTAVLYIWSLTAPLFFPDREF  408



>ref|XP_002882452.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58711.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 127/177 (72%), Gaps = 5/177 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  +  +
Sbjct  236  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLYSA  295

Query  510  aVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
              RAGSSTT LSPPSSPR+G    LL  P D   +  E E ++ V+YSYSFFHIIF+LAS
Sbjct  296  L-RAGSSTTFLSPPSSPRSGVKDSLLEDPEDGKKKSGEAE-ARPVSYSYSFFHIIFALAS  353

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  354  MYAAMLLSGWTDS-SESATLIDVGWTSVWVKICTGWVTAVLYIWTLIAPLILPDREF  409



>ref|XP_001765634.1| predicted protein [Physcomitrella patens]
 gb|EDQ69473.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 132/178 (74%), Gaps = 5/178 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PA VI+ YCTYLCYSAL+SEPR+YECN LHKH  +VS GTL LG+LTT+LSVVYS
Sbjct  239  NGSLLPAGVIAAYCTYLCYSALSSEPRNYECNGLHKHVNAVSKGTLGLGMLTTLLSVVYS  298

Query  510  aVRAGssttllsppssPRAGG---GKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
            AVRAGSSTT LSPP+SPR G         P+ +   H +  + + VTY YSFFH+IF+LA
Sbjct  299  AVRAGSSTTFLSPPNSPREGNLLFDDDDKPIRRGGRHSK--EPRPVTYVYSFFHLIFALA  356

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SMYSAMLLTGW  +      ++DVGW S WVR  T  +TA L++WSLVAP LFPDRDF
Sbjct  357  SMYSAMLLTGWGNANMAEKDIIDVGWPSFWVRFSTEMITAGLYIWSLVAPQLFPDRDF  414



>ref|NP_187268.2| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAZ23918.1| At3g06170 [Arabidopsis thaliana]
 gb|AEE74356.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  +  +
Sbjct  236  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLYSA  295

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
              RAGSSTT LSPPSSPR+G    LL   +  +     +++ V+YSYSFFHIIF+LASMY
Sbjct  296  L-RAGSSTTFLSPPSSPRSGVKDALLGDPEDGKKSGEAEARPVSYSYSFFHIIFALASMY  354

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            +AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  355  AAMLLSGWTDS-SESATLIDVGWTSVWVKICTGWVTAGLYIWTLIAPLILPDREF  408



>ref|XP_009623079.1| PREDICTED: probable serine incorporator [Nicotiana tomentosiformis]
Length=408

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 127/175 (73%), Gaps = 2/175 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEPRDY CN L+K     ++  +   L T +  +  +
Sbjct  235  NGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLNKSKAVTTSTLVLGMLTTVLSVLYSA  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
              RAGSSTT LSPPSSPR+G  K LL  ++ +  +   + + V+YSYSFFH+IF+LASMY
Sbjct  295  L-RAGSSTTFLSPPSSPRSGEKKSLLASEELESGKGSTEPRPVSYSYSFFHLIFALASMY  353

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLL+GW TS  ES  L+DVGW S+WVR+ T  VTA L++WSLVAP+LFPDR+F
Sbjct  354  SAMLLSGW-TSSSESSDLIDVGWTSLWVRICTELVTAGLYIWSLVAPLLFPDREF  407



>emb|CAN71158.1| hypothetical protein VITISV_036762 [Vitis vinifera]
Length=309

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 136/180 (76%), Gaps = 18/180 (10%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC Y+CY+ L+SEPRDY CN LH  SK+VST TL LG+LTTVLSV+YS
Sbjct  142  NGSLLPASVISLYCAYVCYTGLSSEPRDYACNGLHNKSKAVSTSTLILGMLTTVLSVLYS  201

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEE-----MEKSKAVTYSYSFFHIIFS  346
            AVRAGSSTT L            P  P  K+++ E       E++K V+YSY+FFH+IF+
Sbjct  202  AVRAGSSTTFL----------SPPSSP--KSEDTESGKEKKEEEAKPVSYSYTFFHLIFA  249

Query  345  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            LASMYSAMLL+GW++S  +S  ++DVGW SVWVR+ T WVTA L++WSL+APILFPDR+F
Sbjct  250  LASMYSAMLLSGWTSS-NDSSDMIDVGWTSVWVRICTEWVTALLYVWSLLAPILFPDREF  308



>ref|XP_007034589.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
 gb|EOY05515.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
Length=410

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+C++ L+SEPRDY CN LH  S +VST TL LG+LTTVLSV+YS
Sbjct  234  NGSLLPASVISIYCAYVCFTGLSSEPRDYVCNGLHNKSSAVSTSTLILGMLTTVLSVLYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLAS  337
            A+RAGSSTT LSPPSSP++GG KPLL  +  +E +E ++ +A  V+YSYSFFH+IF+LAS
Sbjct  294  ALRAGSSTTFLSPPSSPKSGGKKPLLEGEDVEEGKEKKEKEARPVSYSYSFFHLIFALAS  353

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW TS  ES  LVDVGW SVWVR+ T WVTAAL++W+LVAP +  DR+F
Sbjct  354  MYSAMLLSGW-TSSSESSVLVDVGWTSVWVRICTEWVTAALYVWTLVAPTILHDREF  409



>gb|AFK47365.1| unknown [Lotus japonicus]
Length=234

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PA+VISLYC YLCY+ L+SEPR+YECN L+K  K+V+T TL LG++TTVLSV+YS
Sbjct  61   NGSLLPAAVISLYCAYLCYTGLSSEPRNYECNGLNKS-KAVTTSTLVLGMVTTVLSVLYS  119

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            A+RAGSSTT LSPPS PR+G    L  +++    +E +++K V+YSYSFFH IF+LASMY
Sbjct  120  ALRAGSSTTFLSPPSLPRSGSKPLLEEVEEGKTKKEEKEAKPVSYSYSFFHQIFALASMY  179

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLL+GW TS  +S  L+DVGW SVWVR+ T WVTA L+ W+L+AP+  PDR+F
Sbjct  180  SAMLLSGW-TSTSDSSDLIDVGWTSVWVRIGTEWVTAGLYAWTLLAPVFLPDREF  233



>ref|XP_010255869.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=416

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 150/180 (83%), Gaps = 5/180 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC YLCY+ L+SEPRDY CN LHK+SK+VSTGTL LG+LTTVLSV+YS
Sbjct  236  NGSLLPASVISVYCAYLCYTGLSSEPRDYICNGLHKNSKAVSTGTLILGMLTTVLSVLYS  295

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-----SKAVTYSYSFFHIIFS  346
            AVRAGSSTT LSPPSSP++GG +PLL  D+ +  +E ++     ++ V+Y+Y+FFH+IF+
Sbjct  296  AVRAGSSTTFLSPPSSPKSGGKQPLLESDELEAGKEKKEKKETEAQPVSYNYTFFHLIFA  355

Query  345  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            LASMYSAMLLTGW++S   S  L+DVGW SVWVR+ T WVTAAL++W+LVA ++FPDR+F
Sbjct  356  LASMYSAMLLTGWTSSTSGSSDLIDVGWTSVWVRICTEWVTAALYVWTLVASLIFPDREF  415



>gb|EPS68630.1| hypothetical protein M569_06136 [Genlisea aurea]
Length=410

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 134/177 (76%), Gaps = 4/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASV+S+YC Y+CY+ L+SEPRDY CN L+K SK+V+  TL +G+LTTV SV+YS
Sbjct  235  NGSLLPASVVSIYCAYVCYTGLSSEPRDYVCNGLNK-SKAVTISTLVVGMLTTVFSVLYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLAS  337
            A RAGSSTT LSPPSSPRA G   LL     D      +S+   V YSYSFFH+IF+LA+
Sbjct  294  AFRAGSSTTFLSPPSSPRAAGKLSLLLGGDGDVESGKGESEGEPVRYSYSFFHLIFALAT  353

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW TS  E+  L+DVGW SVWVR+ T W TA L++WSLVAP+L PDRDF
Sbjct  354  MYSAMLLSGW-TSNSENPDLIDVGWTSVWVRIGTEWATAGLYVWSLVAPVLLPDRDF  409



>ref|XP_004486156.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=409

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC Y+CY+ L+SEPR YECN L+K     +   +   L T +  +  +
Sbjct  235  NGSLLPASVISLYCAYVCYTGLSSEPRGYECNGLNKSRAVNTGTLILGMLTTVLSVLYSA  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME-KSKAVTYSYSFFHIIFSLASM  334
              RAGSSTT LSPPSSP+AG  KPLL   +  + ++ E +++ V+YSYSFFH+IF+LA+M
Sbjct  295  L-RAGSSTTFLSPPSSPKAGESKPLLEEMEEGKTKKEEKQARPVSYSYSFFHLIFALATM  353

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            YSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L+LW+L+AP++FPDR+F
Sbjct  354  YSAMLLSGW-TSSSESSDLIDVGWTSVWVRIGTEWVTAGLYLWTLLAPLMFPDREF  408



>ref|XP_008340909.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=409

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 142/177 (80%), Gaps = 4/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+Y  Y+C++AL+SEPRDY CN LH HSK+VS  TL LG+ TTVLSV+YS
Sbjct  235  NGSLLPASVISVYSAYVCFTALSSEPRDYACNGLH-HSKAVSVSTLLLGMATTVLSVLYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLP--LDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
            A+RAGSSTT LSPP+SPR     PLL     +  + +E +++K V+YSY+FFH+IF+LAS
Sbjct  294  ALRAGSSTTFLSPPTSPRGAEKTPLLDGKKLEEGKEKEDKEAKPVSYSYTFFHLIFALAS  353

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTAAL++WSL+AP+LFPDR+F
Sbjct  354  MYSAMLLSGWTDS-SESSDLIDVGWTSVWVRICTEWVTAALYVWSLLAPLLFPDREF  409



>ref|XP_010103434.1| putative serine incorporator [Morus notabilis]
 gb|EXB95837.1| putative serine incorporator [Morus notabilis]
Length=409

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC Y+CY+ L+SEP DY+CN L+K      +  +   L T +  +  +
Sbjct  235  NGSLLPASVISLYCAYVCYTGLSSEPHDYKCNGLNKSKAVSLSTLILGMLTTVLSVLYSA  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLASM  334
              RAGSSTT LSPPSSP++G  KPLL  +  +  E+ EK ++ V+YSYSFFH+IF+LASM
Sbjct  295  L-RAGSSTTFLSPPSSPKSGAKKPLLEEELEEGKEKKEKETRPVSYSYSFFHLIFALASM  353

Query  333  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            Y+AMLL+GW+ S  ES  L+D+GW +VWVR+ TGWVTAALF+WS+VAP+ FPDR+F
Sbjct  354  YAAMLLSGWTNS-SESSDLIDIGWTTVWVRICTGWVTAALFVWSIVAPLFFPDREF  408



>ref|XP_008223013.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=411

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 142/179 (79%), Gaps = 6/179 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+Y  Y+ Y+AL+SEPRDY CN LH HSK+VS  TL LG++TTVLSV+YS
Sbjct  235  NGSLLPASVISVYSAYVLYTALSSEPRDYACNGLH-HSKAVSVSTLLLGMVTTVLSVLYS  293

Query  510  aVRAGssttllsppssPRAGGG--KPLLP--LDKADEHEEMEKSKAVTYSYSFFHIIFSL  343
            A+RAGSSTT LSPPSSPRAG    KPLL     +  +  + +++K V+YSY+FFH+IF+L
Sbjct  294  ALRAGSSTTFLSPPSSPRAGAAEKKPLLDGKELEEGKETKEKEAKPVSYSYTFFHLIFAL  353

Query  342  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            ASMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTA L++WSLVAP LFPDR+F
Sbjct  354  ASMYSAMLLSGWTNS-SESSDLIDVGWTSVWVRICTEWVTAGLYVWSLVAPFLFPDREF  411



>ref|XP_008390818.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=411

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 6/179 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+Y  Y+CY+AL+SEP  Y CN LH HSK+VS  TL LG+  TVLSV+YS
Sbjct  235  NGSLLPASVISVYSAYVCYTALSSEPHGYACNGLH-HSKAVSLSTLLLGMAMTVLSVLYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFHIIFSL  343
            A+RAGSST  LSPPSSPR G  +     D  +  E  EK+    K V YSY+FFH+IF+L
Sbjct  294  ALRAGSSTNFLSPPSSPRGGAAEKTPLFDGKELEEGKEKNDKEVKPVXYSYTFFHLIFAL  353

Query  342  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            ASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTAAL++WSL+APIL PDR+F
Sbjct  354  ASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILIPDREF  411



>ref|XP_011010290.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=417

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 138/179 (77%), Gaps = 5/179 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN LH  SK+VST TL LG+LTTVLSV+YS
Sbjct  239  NGSLLPASVISIYCAYVCYTGLSSEPHDYACNGLHNKSKAVSTSTLVLGMLTTVLSVLYS  298

Query  510  aVRAGssttllsppssPRAGGGKP----LLPLDKADEHEEMEKSKAVTYSYSFFHIIFSL  343
            AVRAGSSTT LSPPSSP+A  GK        L++  E ++  + + V+YSY+FFH+IF+L
Sbjct  299  AVRAGSSTTFLSPPSSPKASAGKKPLLEAEELEEGKEKKKEAEGQPVSYSYTFFHLIFAL  358

Query  342  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            ASMYSAMLL+GW T   ES  L+DVGW SVWVR+ T W+T  L++W+L+AP+ FPDR+F
Sbjct  359  ASMYSAMLLSGW-TDTSESSSLIDVGWTSVWVRICTEWITGLLYIWTLLAPLFFPDREF  416



>ref|XP_006407969.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49422.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=313

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 140/177 (79%), Gaps = 8/177 (5%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++ SK+V+  TL LG+LTTVLSV+YS
Sbjct  142  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNR-SKAVTASTLILGMLTTVLSVLYS  200

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME--KSKAVTYSYSFFHIIFSLAS  337
            A+RAGSSTT LSPPSSPR+      L  D  D  ++    +++ V+YSYSFFHIIF+LAS
Sbjct  201  ALRAGSSTTFLSPPSSPRSEA----LLEDPEDGKKKSGGGEARPVSYSYSFFHIIFALAS  256

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  257  MYAAMLLSGWTDS-SESASLIDVGWTSVWVKLCTGWVTAALYIWTLIAPLILPDREF  312



>gb|KDP40096.1| hypothetical protein JCGZ_02094 [Jatropha curcas]
Length=401

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN LHK +K+VST TL LG+LTTVLSV+YS
Sbjct  225  NGSLLPASVISVYCAYVCYTGLSSEPLDYACNGLHKSTKAVSTSTLVLGVLTTVLSVLYS  284

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLAS  337
            AVRAGSSTT LSPPSSP+A   K  L  ++ +E +E ++ +A  V+YSY+FFH+IF+LAS
Sbjct  285  AVRAGSSTTFLSPPSSPKASDAKKPLLEEQLEEGKEKKEKEAKPVSYSYTFFHLIFALAS  344

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW+ S  E+  L+DVGW SVWVR+ T WVTA L++W+LVAP++ PDR+F
Sbjct  345  MYSAMLLSGWTNS-SENSDLIDVGWISVWVRICTEWVTAGLYVWTLVAPVILPDREF  400



>ref|XP_002312742.1| TMS membrane family protein [Populus trichocarpa]
 gb|EEE90109.1| TMS membrane family protein [Populus trichocarpa]
Length=417

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 5/179 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN LH  SK+VST TL LG+LTT+LSV+YS
Sbjct  239  NGSLLPASVISIYCAYVCYTGLSSEPHDYACNGLHNKSKAVSTSTLVLGMLTTILSVLYS  298

Query  510  aVRAGssttllsppssPRAGGGKP----LLPLDKADEHEEMEKSKAVTYSYSFFHIIFSL  343
            AVRAGSSTT LSPPSSP+A  GK        L++  E ++  + + V+YSY+FFH+IF+L
Sbjct  299  AVRAGSSTTFLSPPSSPKASAGKKPLLEAEELEEGKEKKKEAEGQPVSYSYTFFHLIFAL  358

Query  342  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            ASMYSAMLL+GW T   ES  L+DVGW SVWVR+ T W+T  L+ W+L+AP+ FPDR+F
Sbjct  359  ASMYSAMLLSGW-TDTSESSSLIDVGWTSVWVRICTEWITGLLYTWTLLAPLFFPDREF  416



>ref|XP_006407970.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49423.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=406

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 128/177 (72%), Gaps = 8/177 (5%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++  +   L T +  +  +
Sbjct  235  NGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNRSKAVTASTLILGMLTTVLSVLYSA  294

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME--KSKAVTYSYSFFHIIFSLAS  337
              RAGSSTT LSPPSSPR+   + LL  D  D  ++    +++ V+YSYSFFHIIF+LAS
Sbjct  295  L-RAGSSTTFLSPPSSPRS---EALLE-DPEDGKKKSGGGEARPVSYSYSFFHIIFALAS  349

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  350  MYAAMLLSGWTDS-SESASLIDVGWTSVWVKLCTGWVTAALYIWTLIAPLILPDREF  405



>ref|XP_007222705.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
 gb|EMJ23904.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
Length=411

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 139/179 (78%), Gaps = 6/179 (3%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+Y  Y+ Y+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVLSV+YS
Sbjct  235  NGSLLPASVISVYSAYVLYTALSSEPRGYACNGLH-HSKAVSVSTLLLGMATTVLSVLYS  293

Query  510  aVRAGssttllsppssPRAGGG--KPLLP--LDKADEHEEMEKSKAVTYSYSFFHIIFSL  343
            A+RAGSSTT LSPPSSPRAG    KPLL     +  +  + +++K V+YSY+FFH+IF+L
Sbjct  294  ALRAGSSTTFLSPPSSPRAGAAEKKPLLDGKELEEGKETKEKEAKPVSYSYTFFHLIFAL  353

Query  342  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            ASMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTA L++WSLVAP L PDR+F
Sbjct  354  ASMYSAMLLSGWTDS-SESSDLIDVGWTSVWVRICTEWVTAGLYVWSLVAPFLLPDREF  411



>ref|XP_002516786.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF45400.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=414

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 3/177 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC Y+CY+ L+SEP DY CN LH  +K+VST TL LG+LTT+LSV+YS
Sbjct  238  NGSLLPASVISIYCAYVCYTGLSSEPHDYVCNGLHNKTKAVSTSTLILGMLTTILSVLYS  297

Query  510  aVRAGssttllsppssPRAGGGKP--LLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
            AVRAGSSTT LSPPSSP+A   K   L    +  + ++  +++ V+YSY+FFH+IF+LAS
Sbjct  298  AVRAGSSTTFLSPPSSPKASDAKKPLLEEQLEEGKEKKETEARPVSYSYTFFHLIFALAS  357

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++W+L+AP+LFPDR+F
Sbjct  358  MYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICTEWVTAGLYVWTLLAPLLFPDREF  413



>ref|XP_010024424.1| PREDICTED: serine incorporator 3 [Eucalyptus grandis]
 gb|KCW60868.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=416

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 139/183 (76%), Gaps = 9/183 (5%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASV+S+Y  Y+CY+AL+ EPR+Y CN LH  S +VST TL LG+LTTVLSV+YS
Sbjct  234  NGSLLPASVVSVYGAYVCYTALSCEPRNYVCNGLHNKSHAVSTSTLILGMLTTVLSVLYS  293

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM--------EKSKAVTYSYSFFHI  355
            A RAGSSTT LSPPSSP++G  KPLL  D  +E ++          + + VTYSYSFFH+
Sbjct  294  ACRAGSSTTFLSPPSSPKSGAKKPLLDGDDVEEGKDKKDKKDKKEAEPQPVTYSYSFFHL  353

Query  354  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  175
            IF+LASMYSAMLL+   TS  +S  LVDVGW SVWVR+ T WVT+AL++W+LVAP++ PD
Sbjct  354  IFALASMYSAMLLSD-WTSSSDSSDLVDVGWTSVWVRIATEWVTSALYIWTLVAPLILPD  412

Query  174  RDF  166
            R+F
Sbjct  413  REF  415



>ref|XP_009117775.1| PREDICTED: wall-associated receptor kinase-like 5 isoform X1 
[Brassica rapa]
Length=796

 Score =   147 bits (372),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  384  VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLW  205
            VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+W
Sbjct  724  VTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIW  783

Query  204  SLVAPILFPDRDF  166
            SLVAPILFPDR+F
Sbjct  784  SLVAPILFPDREF  796



>ref|XP_002956760.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
 gb|EFJ42217.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
Length=415

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 115/180 (64%), Gaps = 21/180 (12%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSIFP+S+I+LY  YLC+SAL SEPR+Y CN L     + S GTL LG++ T+ SVVY+A
Sbjct  250  GSIFPSSMIALYAAYLCFSALQSEPREYACNGLGHRLTAASGGTLALGMVVTLASVVYAA  309

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA------VTYSYSFFHIIFS  346
             RAGS                  L  L+ ++E E +  + A      VTY+YSFFH+IF+
Sbjct  310  FRAGS---------------NTALFTLEGSEEGEPLPSTAAATSLTPVTYNYSFFHLIFA  354

Query  345  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            LASMY AML+TGW T        +DVGWASVWV+    WVT  L++W+LVAP LFP+RDF
Sbjct  355  LASMYIAMLMTGWGTVAQVRKDRIDVGWASVWVKPAAEWVTGLLYMWTLVAPALFPERDF  414



>ref|XP_005651318.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
 gb|EIE26774.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
Length=429

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 124/206 (60%), Gaps = 32/206 (16%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+FP+++ + YCTYLCYSAL SEP DY+CN L +   + S  TL  G+L T++SVVYS
Sbjct  224  NGSLFPSAIFTFYCTYLCYSALVSEPHDYQCNGLGQRLNAASATTLATGMLLTLVSVVYS  283

Query  510  aVRAGssttllsppssPRAGG-GKPLLPLDK--------------------------ADE  412
            A+RAGS+T L    S   +    +PLL  DK                          ADE
Sbjct  284  ALRAGSNTALFRLNSEEDSDPVEQPLLDDDKGRAYIAEEGTSAGLDGEVGMSRTARTADE  343

Query  411  HEEMEKS----KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  244
             E  +++      VTY+Y+FFH IF++ASMY AML+TGW T   E   L+DVGW SVWV+
Sbjct  344  AERAKQTADEFTPVTYNYAFFHFIFAVASMYLAMLMTGWGTG-AEERDLIDVGWFSVWVK  402

Query  243  VVTGWVTAALFLWSLVAPILFPDRDF  166
             VT W TAA + W LVAP LFPDR+F
Sbjct  403  FVTQWATAATYCWMLVAPTLFPDREF  428



>gb|KJB67012.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=374

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = -2

Query  684  SIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaV  505
            SI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGT+T+GLLTT+LSVVYSAV
Sbjct  241  SILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTVTVGLLTTILSVVYSAV  300

Query  504  RAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSA  325
            RAGSSTTLLSPPSSPRAGGGKPLLPLDKADE EE EK+KAVTYSY+FFHIIFSL S+   
Sbjct  301  RAGSSTTLLSPPSSPRAGGGKPLLPLDKADE-EEKEKNKAVTYSYAFFHIIFSLLSICGL  359

Query  324  MLLTGWSTSVGESGKL  277
             LL  +S+  G S  L
Sbjct  360  SLLL-FSSQTGTSKSL  374



>ref|XP_002979274.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
 gb|EFJ19682.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
Length=376

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 117/175 (67%), Gaps = 38/175 (22%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI++YCTY+CYSAL+SEPR+YECN LHKH   VSTGTL LG+LTT+LSVVYS
Sbjct  239  NGSLLPASVIAVYCTYICYSALSSEPRNYECNGLHKHENVVSTGTLVLGMLTTLLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSSTT LSPPSSPRAG                                      MY
Sbjct  299  AVRAGSSTTFLSPPSSPRAG-------------------------------------LMY  321

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGW  S  E    +DVGW SVWVR+ T W+TA L++WSLVAP+LFPDRDF
Sbjct  322  SAMLLTGWGNS-AEGKDTIDVGWPSVWVRICTQWLTAILYVWSLVAPLLFPDRDF  375



>gb|KIZ05916.1| putative serine incorporator [Monoraphidium neglectum]
Length=447

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 119/196 (61%), Gaps = 25/196 (13%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GS+FP+++ SLY  YLCYSAL SEP+DY CN L     + S  TL +G+L T+LSVVYSA
Sbjct  251  GSLFPSAITSLYVMYLCYSALQSEPKDYACNGLAHRINAASGSTLVIGMLVTLLSVVYSA  310

Query  507  VRAGssttllspps----sPRAGGGKPLLPLDK--------------------ADEHEEM  400
            +RAGS++ L +             G+PLL  +                     AD    +
Sbjct  311  LRAGSNSQLFTLADDNDDIAATSAGRPLLDAEAVGDSADGAAPAAVSASRAPGADATAAL  370

Query  399  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  220
            +    V+Y+YSFFH+IF+LASMY AML+TGW  +V +    VDVGW SVWV+    WVTA
Sbjct  371  DDYTPVSYNYSFFHLIFALASMYIAMLMTGWG-AVEQEKDRVDVGWTSVWVKTGAEWVTA  429

Query  219  ALFLWSLVAPILFPDR  172
             L+ W+LVAP+LFP+R
Sbjct  430  LLYSWTLVAPVLFPER  445



>ref|XP_002506090.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67348.1| predicted protein [Micromonas sp. RCC299]
Length=433

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 106/190 (56%), Gaps = 16/190 (8%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
            +GS+ P++V++ YC YLCYSALASEP +Y CN    ++       +   +LT       +
Sbjct  244  EGSLLPSAVVTSYCVYLCYSALASEPTEYRCNPRGAYAGDGKASEVASTVLTLASVAYSA  303

Query  510  aVRAGssttllsppssPRAG----------GGKPLLPLDKADEHEEME-----KSKAVTY  376
              RAGSS            G          GG        AD  +++       S  V+Y
Sbjct  304  V-RAGSSDFFGGVNLGDGDGDYAALSGAEMGGGTDADAGDADSEDDVGGAASYPSGPVSY  362

Query  375  SYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLV  196
            SYSFFH IF+LASM+ AML+TGW     +  + VDVGWASVWV++ + WVTA L+ WSL+
Sbjct  363  SYSFFHFIFALASMFLAMLMTGWGRDDYKGAERVDVGWASVWVKMCSVWVTAGLYTWSLI  422

Query  195  APILFPDRDF  166
            AP LFPDR+F
Sbjct  423  APALFPDREF  432



>ref|XP_001416509.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94802.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=393

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 106/177 (60%), Gaps = 2/177 (1%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECN--ALHKHsksvstgtltlgllttvlsvv  517
            +G + P++ ++LYCTYLCYSAL SEP  Y C   +    ++ +      +    T++SVV
Sbjct  217  EGCLLPSAAVTLYCTYLCYSALTSEPSTYACRPRSFIDANEELKKPANLVTTAFTLVSVV  276

Query  516  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  337
            Y+A+RAG S               +  L     +E  E + S  V Y+YSFFH++F+LA+
Sbjct  277  YAAMRAGESNFWDMEVDESFQSELREALNDGDEEEASEGDASGPVKYNYSFFHLMFALAA  336

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MY++MLLTGW T   +  + +  GWASVWV+  + W T A++LW L+AP LFPDR+F
Sbjct  337  MYTSMLLTGWGTRHEDDTEAIGSGWASVWVKFFSVWATGAIYLWCLIAPALFPDREF  393



>gb|ABF97020.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=372

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 114/175 (65%), Gaps = 42/175 (24%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVIS+YC YLCY++L+SEP DY CN LH+HSK VS   L LG+LTTVLSVVYS
Sbjct  239  NGSVMPASVISVYCAYLCYTSLSSEPDDYACNGLHRHSKQVSMSALILGMLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSSTT LSPPSSPR                                          
Sbjct  299  AVRAGSSTTFLSPPSSPR------------------------------------------  316

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            SAMLLTGW+++  +S +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  317  SAMLLTGWTSAASDSSELMDVGWTTVWVRICTEWATAALYIWTLVAPLLFPDRDF  371



>ref|XP_002988580.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
 gb|EFJ10376.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
Length=371

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 113/175 (65%), Gaps = 43/175 (25%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVI++YCTY+CYSAL+SEPR+YECN LHKH   VSTGTL LG+LTT+LSVVYS
Sbjct  239  NGSLLPASVIAVYCTYICYSALSSEPRNYECNGLHKHENVVSTGTLVLGMLTTLLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
            AVRAGSSTT LSPPSSPRA                                         
Sbjct  299  AVRAGSSTTFLSPPSSPRA-----------------------------------------  317

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
             AMLLTGW  S  E    +DVGW SVWVR+ T W+TA L++WSLVAP+LFPDRDF
Sbjct  318  -AMLLTGWGNS-AEGKDTIDVGWPSVWVRICTQWLTAILYVWSLVAPLLFPDRDF  370



>ref|XP_011397622.1| putative serine incorporator [Auxenochlorella protothecoides]
 gb|KFM24734.1| putative serine incorporator [Auxenochlorella protothecoides]
Length=435

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 112/184 (61%), Gaps = 10/184 (5%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GS+FPA+ + LY +Y+ YSAL SEPRDY CN L     + S  TL  G+L T+LSVVYSA
Sbjct  251  GSLFPAAAVGLYVSYMGYSALQSEPRDYACNGLGARLGAASGATLAGGMLLTLLSVVYSA  310

Query  507  VRAGssttl-lsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIFSLASM  334
             RAGS+T       +     G +PLL  D       ++   A V Y Y+ F+ +F+LASM
Sbjct  311  FRAGSNTQTFAGAWAGGNGAGAEPLLAGDAELTSAGLDGEDAPVPYCYAQFYAVFALASM  370

Query  333  YSAMLLTGW--------STSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  178
            Y AML+TGW        S +       VDVGW SVWV++VT WV AAL+ W+L+AP LFP
Sbjct  371  YIAMLMTGWGATGQPKASDAAAGCSDAVDVGWTSVWVKIVTQWVAAALYCWTLLAPSLFP  430

Query  177  DRDF  166
            DR F
Sbjct  431  DRVF  434



>gb|AEW08633.1| hypothetical protein CL976Contig1_02, partial [Pinus radiata]
 gb|AFG57497.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57498.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57499.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57500.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57501.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57502.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57503.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57504.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57505.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57506.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57507.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57508.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57509.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57510.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57511.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57512.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57513.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
Length=84

 Score =   112 bits (281),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  429  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  250
            +++  ++ + ++ + VTYSY+FFH+IF+LASMYSAMLLTGW++S  +  KL+ VGW +VW
Sbjct  1    IEEGQKNAQKDEERPVTYSYTFFHVIFALASMYSAMLLTGWTSSTPDGEKLIGVGWHTVW  60

Query  249  VRVVTGWVTAALFLWSLVAPILFP  178
            VR+ T W+TAAL++WSLVAP+LFP
Sbjct  61   VRICTEWITAALYIWSLVAPLLFP  84



>dbj|BAD94992.1| hypothetical protein [Arabidopsis thaliana]
Length=57

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  1    MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  57



>ref|XP_003075128.1| OJ1249_F12.26 gene product (ISS), partial [Ostreococcus tauri]
Length=423

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 106/178 (60%), Gaps = 3/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYEC--NALHKHsksvstgtltlgllttvlsvv  517
            +G + P S ++LYC YLCYSAL+SEP  Y C   +    ++++      +  + T++SVV
Sbjct  246  EGCLLPTSAVTLYCAYLCYSALSSEPSTYACRPQSFIDANEALRKPATLVQTVFTLVSVV  305

Query  516  ysaVRAGssttllsppssPRAGG-GKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
            Y+A+RAG S            G  G  L   +  +  +E   S  V Y+YSFFH+IF+LA
Sbjct  306  YAAMRAGESNFWHMDVDEEFIGELGDVLNDEEDEEAEDESSPSGPVRYNYSFFHLIFALA  365

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            +MY++MLLTGW T   +  + +  GWASVWV+  + W T  ++ W LVAP LFP+R+F
Sbjct  366  AMYTSMLLTGWGTRRPDDSEAIGSGWASVWVKYFSVWATGTIYAWCLVAPALFPEREF  423



>emb|CEG01070.1| TMS membrane protein/tumour differentially expressed protein 
[Ostreococcus tauri]
Length=422

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 106/178 (60%), Gaps = 3/178 (2%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYEC--NALHKHsksvstgtltlgllttvlsvv  517
            +G + P S ++LYC YLCYSAL+SEP  Y C   +    ++++      +  + T++SVV
Sbjct  245  EGCLLPTSAVTLYCAYLCYSALSSEPSTYACRPQSFIDANEALRKPATLVQTVFTLVSVV  304

Query  516  ysaVRAGssttllsppssPRAGG-GKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
            Y+A+RAG S            G  G  L   +  +  +E   S  V Y+YSFFH+IF+LA
Sbjct  305  YAAMRAGESNFWHMDVDEEFIGELGDVLNDEEDEEAEDESSPSGPVRYNYSFFHLIFALA  364

Query  339  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            +MY++MLLTGW T   +  + +  GWASVWV+  + W T  ++ W LVAP LFP+R+F
Sbjct  365  AMYTSMLLTGWGTRRPDDSEAIGSGWASVWVKYFSVWATGTIYAWCLVAPALFPEREF  422



>emb|CAN80334.1| hypothetical protein VITISV_009413 [Vitis vinifera]
Length=57

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  1    MYSAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  57



>gb|ACG35592.1| hypothetical protein [Zea mays]
Length=57

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  336  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  1    MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPVLFPDREF  57



>ref|XP_004302121.1| PREDICTED: serine incorporator 3-like [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGLLTTVLSVVYSA
Sbjct  144  GSILPASVISVYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYSA  203

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA  385
            VRAGSSTTLLSPPSSPRAG GKPLLPLDK +E EE EK+K+
Sbjct  204  VRAGSSTTLLSPPSSPRAGAGKPLLPLDKPEEREENEKAKS  244



>gb|EFA77480.1| TMS membrane protein [Polysphondylium pallidum PN500]
Length=419

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 98/181 (54%), Gaps = 19/181 (10%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPR-DYECNALHKHsksvstgtltlgllttvlsvvysaV  505
            +F + V+ LY  YL +SA+ SEP  D   N+  + + ++  G++   +            
Sbjct  246  LFQSGVVMLYSAYLVFSAIMSEPSMDNNSNSGKQKTWTIIIGSMFTIISVC---------  296

Query  504  RAGssttllsppssPRAGGGKPLLPL-----DKADEHEEMEKSKAVTYSYSFFHIIFSLA  340
             +    +  +      +GGG   LP      + AD+  E ++S  V Y+Y+FFHI F+L 
Sbjct  297  YSAFRASDSNEILGSSSGGGFDKLPTVASDDEAADDKMEDDESGGVAYNYTFFHITFALG  356

Query  339  SMYSAMLLTGWSTSVGESGK----LVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
            +MY  MLLT W+T  G SG      VD G  SVWV++V+GW+   L+LW+LVAP+L P+R
Sbjct  357  AMYIGMLLTNWATISGTSGSNGDLNVDSGMVSVWVKIVSGWLVHLLYLWTLVAPVLMPNR  416

Query  171  D  169
            +
Sbjct  417  E  417



>emb|CEG74958.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=320

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  493
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  128  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  186

Query  492  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  349
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  187  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  246

Query  348  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  190
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  247  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  306

Query  189  ILFPDR  172
            +L PDR
Sbjct  307  VLMPDR  312



>emb|CEG74957.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=317

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  493
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  128  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  186

Query  492  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  349
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  187  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  246

Query  348  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  190
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  247  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  306

Query  189  ILFPDR  172
            +L PDR
Sbjct  307  VLMPDR  312



>emb|CEG74956.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=396

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 107/186 (58%), Gaps = 20/186 (11%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  493
            +S++ +YCTYL  SA+A+EP D ECN L K S+   T ++ LG L T L++ YS  RA +
Sbjct  204  SSIVVIYCTYLVLSAVANEPNDKECNPLRK-SQGPQTTSIVLGALFTFLAIAYSTSRAAT  262

Query  492  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  349
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  263  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  322

Query  348  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  190
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  323  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  382

Query  189  ILFPDR  172
            +L PDR
Sbjct  383  VLMPDR  388



>emb|CEG74955.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=393

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 107/186 (58%), Gaps = 20/186 (11%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  493
            +S++ +YCTYL  SA+A+EP D ECN L K S+   T ++ LG L T L++ YS  RA +
Sbjct  204  SSIVVIYCTYLVLSAVANEPNDKECNPLRK-SQGPQTTSIVLGALFTFLAIAYSTSRAAT  262

Query  492  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  349
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  263  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  322

Query  348  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  190
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  323  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  382

Query  189  ILFPDR  172
            +L PDR
Sbjct  383  VLMPDR  388



>emb|CEG67769.1| hypothetical protein RMATCC62417_04149 [Rhizopus microsporus]
Length=393

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 108/186 (58%), Gaps = 20/186 (11%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  493
            +S++ +YCTYL  SA+A+EP D ECN L K S+   T ++ LG L T L++ YS  RA +
Sbjct  204  SSIVVIYCTYLVLSAVANEPNDKECNPLRK-SQGPQTTSIVLGALFTFLAIAYSTSRAAT  262

Query  492  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  349
                 +  SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  263  QGVEGATESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  322

Query  348  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  190
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSL+AP
Sbjct  323  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYIWSLIAP  382

Query  189  ILFPDR  172
            +L PDR
Sbjct  383  VLMPDR  388



>emb|CEG74954.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=457

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  493
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  265  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  323

Query  492  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  349
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  324  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  383

Query  348  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  190
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  384  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  443

Query  189  ILFPDR  172
            +L PDR
Sbjct  444  VLMPDR  449



>emb|CEG74953.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=454

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  493
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  265  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  323

Query  492  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  349
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  324  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  383

Query  348  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  190
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  384  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  443

Query  189  ILFPDR  172
            +L PDR
Sbjct  444  VLMPDR  449



>emb|CEJ00743.1| hypothetical protein RMCBS344292_14792 [Rhizopus microsporus]
Length=453

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 100/182 (55%), Gaps = 16/182 (9%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRA--  499
            +S++ +YCTYL  SA+A+EP D ECN L +     +T  +   L T +     ++  A  
Sbjct  265  SSIVVIYCTYLVLSAVANEPNDKECNPLRRSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  324

Query  498  ---GssttllsppssPRAGGGKPLLPLDKADEHEEM---EKSKAVTYSYSFFHIIFSLAS  337
               G + +            G  L   D  D+ ++    E+  AV Y+YSFFH  F++A+
Sbjct  325  GVEGVTESSSREHLIAAVENGSALYKDDDQDDDDDEHDDERYGAV-YNYSFFHFTFAIAA  383

Query  336  MYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAPILFP  178
            MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSL+AP+L P
Sbjct  384  MYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYIWSLIAPVLMP  443

Query  177  DR  172
            DR
Sbjct  444  DR  445



>emb|CEJ03265.1| hypothetical protein RMCBS344292_17253 [Rhizopus microsporus]
Length=316

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 97/181 (54%), Gaps = 14/181 (8%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRA--  499
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++  A  
Sbjct  128  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  187

Query  498  ---GssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK--AVTYSYSFFHIIFSLASM  334
               G++ +            G  L   D  D+ ++    +     Y+YSFFH  F++A+M
Sbjct  188  GVEGATESSSREHLIAAVENGSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTFAIAAM  247

Query  333  YSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAPILFPD  175
            Y AMLLT W+T + E        L+ +G  + +VWV+ V+GW+   L++WSL+AP+L PD
Sbjct  248  YVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKAVSGWICYGLYIWSLIAPVLMPD  307

Query  174  R  172
            R
Sbjct  308  R  308



>ref|XP_002982341.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
 gb|EFJ16586.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
Length=382

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 82/169 (49%), Gaps = 16/169 (9%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  493
            + +ISLY  +LC+SA+ SEPR   CN   + +      T+    +  V  V  +      
Sbjct  229  SGLISLYIVFLCWSAIMSEPRSEVCNTRPRQTGKADLLTVLSFFMGLVAIVFATFSTGA-  287

Query  492  sttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLT  313
                             P +P +   + E  E  K V YSY FFH +F++ SMY AML  
Sbjct  288  --------------DSNPFVPANPTPDPENQEI-KRVPYSYGFFHFVFAVGSMYFAMLFV  332

Query  312  GWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            GW+         +DVGWASVWV++   W+ A +++W++V+ ++   R F
Sbjct  333  GWNLHQTMLKWSIDVGWASVWVKITNEWLAAGVYIWTMVSSVVSNIRQF  381



>ref|XP_001770496.1| predicted protein [Physcomitrella patens]
 gb|EDQ64665.1| predicted protein [Physcomitrella patens]
Length=387

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 82/175 (47%), Gaps = 19/175 (11%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
               +  + V+SLY  +LC+SA+ SEP    CN   + +      T+              
Sbjct  230  NAGLLTSGVMSLYLIFLCWSAIMSEPLSASCNTRERQTGKADWLTII-------------  276

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
               +     L    ++   G         K DE ++     ++ YSY FFH +F+L +MY
Sbjct  277  ---SFLIAFLAIVFATYTTGIDSEAFSFKKKDESKD---DGSLPYSYGFFHFVFALGAMY  330

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
             AML  GW+         +D+GWASVWV++V  W+ A ++ W+++ P +  +RDF
Sbjct  331  LAMLFVGWNLHQTMHKWSIDIGWASVWVKIVNQWLAAIIYGWTMIGPFVLKNRDF  385



>gb|EXX70672.1| Tms1p [Rhizophagus irregularis DAOM 197198w]
Length=240

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = -2

Query  444  KPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWST-SVGESGKL  277
            K +LP   LD+  ++   ++   V Y+Y+FFH IF++A+MY AMLLT W+T ++  + KL
Sbjct  138  KEILPPSALDEEADYPMDDEDYDVNYNYTFFHFIFAIAAMYVAMLLTDWNTFTMTGNEKL  197

Query  276  VDVGWAS--VWVRVVTGWVTAALFLWSLVAPILFPDR  172
            V +G +   VWV+V++GWV   L+ WSLVAP LFP+R
Sbjct  198  VVIGRSHTIVWVKVISGWVCFLLYYWSLVAPALFPER  234



>ref|XP_004366977.1| TMS membrane protein [Dictyostelium fasciculatum]
 gb|EGG19994.1| TMS membrane protein [Dictyostelium fasciculatum]
Length=420

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 89/174 (51%), Gaps = 8/174 (5%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + V+ LY TYL YSA+ SEP    C+ +        T  +        +       R
Sbjct  248  LLQSGVVMLYSTYLVYSAIMSEPAS-TCSTMANQDPKNYTVIMGAIFTIISVCYSAF--R  304

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLASMYS  328
            A  ST LL    SP+          D  D  ++ME  +   V YSY+FFHI F+  +MY 
Sbjct  305  ASDSTELLGKSDSPQYSSLNAFSD-DDDDVPQQMEDDEKHEVAYSYTFFHITFAFGAMYI  363

Query  327  AMLLTGWSTSVGESGKLVDV--GWASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
             MLLT WST  G S   ++V  G  SVWV++V+GW+   L+LW+LV P LFP+R
Sbjct  364  GMLLTNWSTIGGLSSASINVDSGLVSVWVKIVSGWLVHLLYLWTLVGPALFPNR  417



>ref|XP_003062471.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53290.1| predicted protein [Micromonas pusilla CCMP1545]
Length=442

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query  393  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL-VDVGWASVWVRVVTGWVTAA  217
            S  V+Y+Y+FFH IF+LAS Y AML+TGW     E G   VDVGWASV+V+  + WVT  
Sbjct  365  SGPVSYNYAFFHFIFALASAYLAMLMTGWGDRAFEDGGAPVDVGWASVYVKYASLWVTGL  424

Query  216  LFLWSLVAPILFPDRD  169
            L+ WSLVAP + PDRD
Sbjct  425  LYTWSLVAPAVMPDRD  440


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECN  595
             GS+ P++V++ YCTYL YSALASEP +YECN
Sbjct  241  DGSLLPSAVVTSYCTYLLYSALASEPSEYECN  272



>ref|XP_001625531.1| predicted protein [Nematostella vectensis]
 gb|EDO33431.1| predicted protein [Nematostella vectensis]
Length=446

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -2

Query  414  EHEEM--EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRV  241
            +H+++  ++S +V+Y+YSFFH  F LAS+Y  M LT W +  G     +   WA+VWV++
Sbjct  359  KHQKVYDDESTSVSYNYSFFHFTFFLASLYIMMTLTNWYSPQGSDFSKLTSNWATVWVKI  418

Query  240  VTGWVTAALFLWSLVAPILFPDRDF  166
             T WV  AL+ W+L+AP+L PDRDF
Sbjct  419  STSWVCLALYAWTLLAPVLMPDRDF  443



>ref|XP_009493459.1| hypothetical protein H696_01290 [Fonticula alba]
 gb|KCV71881.1| hypothetical protein H696_01290 [Fonticula alba]
Length=116

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -2

Query  426  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVG--WASV  253
            D AD     +++++  YSYS FH IF+LA++Y +MLL+ W  ++  SG  + +G  W  +
Sbjct  27   DDADAEHTGDEAESCQYSYSTFHFIFALAALYMSMLLSDWG-AINLSGAPIFIGHEWLGI  85

Query  252  WVRVVTGWVTAALFLWSLVAPILFPDR  172
            W+R+VT W+   LF W+LVAPI  PDR
Sbjct  86   WIRIVTSWIGYGLFSWTLVAPIFLPDR  112



>gb|KDD71727.1| hypothetical protein H632_c4498p0 [Helicosporidium sp. ATCC 50920]
Length=169

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (58%), Gaps = 8/104 (8%)
 Frame = -2

Query  456  AGGGKPLLPLDKADEHEEMEKSKA-------VTYSYSFFHIIFSLASMYSAMLLTGWSTS  298
            +G  +PL  + +A+  E      A       + YSY+ F+ + +LAS Y +ML+TGW   
Sbjct  66   SGAPRPLRAMSRAEAAEPGSYGAASAAPRAPIPYSYAQFYAVLALASAYVSMLMTGWGAG  125

Query  297  VGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            +   G LVDVGW SV+V+  T W    L+LW L AP LFPDRDF
Sbjct  126  MMAPG-LVDVGWTSVYVKCATQWGAGVLYLWMLFAPALFPDRDF  168



>ref|XP_002304839.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
 gb|EEE79818.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
Length=364

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             GS+ PASVISLYC YLCYS LASEPR+YECN LH+HSK+VSTGTL++GLLTTVLSVVYS
Sbjct  239  NGSVLPASVISLYCMYLCYSGLASEPREYECNGLHRHSKAVSTGTLSIGLLTTVLSVVYS  298

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK  394
            AVRAGSST LLSPPSSPRAG  KPLLPL     +++  +
Sbjct  299  AVRAGSSTALLSPPSSPRAGADKPLLPLTTRQTNKKKRR  337



>ref|XP_009336936.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Pyrus x bretschneideri]
Length=272

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  414  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  235
              +E E    V Y Y FFH +F++ +MY AMLL GW+T        +DVGWA+ WVR+V 
Sbjct  186  RKDETESKDDVPYGYGFFHFVFAMGAMYFAMLLIGWNTHQSMRRFTIDVGWANTWVRIVN  245

Query  234  GWVTAALFLWSLVAPILFPDRD  169
             W+   ++LW LVAPI++  R 
Sbjct  246  EWIAVCVYLWMLVAPIVWESRQ  267



>ref|XP_002157067.2| PREDICTED: probable serine incorporator-like, partial [Hydra 
vulgaris]
Length=423

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 9/97 (9%)
 Frame = -2

Query  429  LDKADEHEEMEK---------SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL  277
            +   DE+EE EK            V Y+YS+FH  F LAS+Y  M+LT W +      K 
Sbjct  326  IASGDENEESEKIGQNVYDNEKVQVAYNYSYFHFTFMLASLYIMMMLTNWYSPENSDSKT  385

Query  276  VDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            +   W++VW++VV+ W   A+F+W+L+AP+L+PDR+F
Sbjct  386  LISSWSTVWIKVVSCWACFAIFMWTLLAPVLWPDRNF  422



>ref|XP_007202140.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
 gb|EMJ03339.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
Length=389

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -2

Query  414  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  235
              +E E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  303  RKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTIDVGWASTWVRIVN  362

Query  234  GWVTAALFLWSLVAPILFPDRD  169
             W+   ++LW LVAPI++  R 
Sbjct  363  EWIAVCVYLWMLVAPIIWKSRQ  384



>ref|XP_002965853.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
 ref|XP_002983103.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ15912.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ33273.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
Length=365

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 80/175 (46%), Gaps = 19/175 (11%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
               +  + +ISLY  +LC+SA+ SEP    CN   + +      T+              
Sbjct  209  NAGLLTSGLISLYLVFLCWSAIMSEPASELCNTRSRQTGKADWLTVL-------------  255

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
               +          ++   G     L L  +   EE      + YSY FFH +F++ +MY
Sbjct  256  ---SFLIAFFAIILATFSTGIDSKSLALPHS---EEETSENDIPYSYGFFHFVFAMGAMY  309

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
             AML  GW+         +DVGWASVWV+V+  W+ AA+++W++V   +   RDF
Sbjct  310  FAMLFVGWNLHQTMHRWSIDVGWASVWVKVINEWLAAAVYIWTMVCVFVLKGRDF  364



>ref|XP_008242601.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=389

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -2

Query  414  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  235
              +E E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  303  RKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTIDVGWASTWVRIVN  362

Query  234  GWVTAALFLWSLVAPILFPDRD  169
             W+   ++LW LVAPI++  R 
Sbjct  363  EWIAVCVYLWMLVAPIIWKSRQ  384



>gb|ESA19644.1| hypothetical protein GLOINDRAFT_19362 [Rhizophagus irregularis 
DAOM 181602]
Length=485

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = -2

Query  444  KPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWST-SVGESGKL  277
            K +LP   LD+  ++   ++   V Y+Y+FFH IF++A+MY AMLLT W+T ++  + KL
Sbjct  383  KEILPPSALDEEADYPMDDEDYDVNYNYTFFHFIFAIAAMYVAMLLTDWNTFTMTGNEKL  442

Query  276  VDVGWAS--VWVRVVTGWVTAALFLWSLVAPILFPDR  172
            V +G +   VWV+V++GWV   L+ WSLVAP LFP+R
Sbjct  443  VVIGRSHTIVWVKVISGWVCFLLYYWSLVAPALFPER  479



>ref|XP_009352478.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  414  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  235
             ++E E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  312  RNDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTLDVGWASTWVRIVN  371

Query  234  GWVTAALFLWSLVAPILFPDRD  169
             W+   ++LW LVAPI++  R 
Sbjct  372  EWIAVCVYLWMLVAPIIWKSRQ  393



>ref|NP_741562.1| Protein Y57E12AL.1, isoform b [Caenorhabditis elegans]
 emb|CCD69747.1| Y57E12AL.1, isoform b [Caenorhabditis elegans]
Length=389

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (58%), Gaps = 9/104 (9%)
 Frame = -2

Query  453  GGGKPLLPLDKADEHEEMEKSK--------AVTYSYSFFHIIFSLASMYSAMLLTGWSTS  298
            GGG       +  +  E + SK         V YSYSFFH +F+LAS+Y  M LT W   
Sbjct  287  GGGNTSDEAIQLTDDAESQNSKRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKP  346

Query  297  VGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
              +   L +   ASVWV++V+ WV  AL+ W+LVAPI++PDR+F
Sbjct  347  SNDLSHL-NSNMASVWVKIVSSWVCVALYCWTLVAPIIYPDREF  389



>ref|NP_741561.1| Protein Y57E12AL.1, isoform a [Caenorhabditis elegans]
 emb|CCD69746.1| Y57E12AL.1, isoform a [Caenorhabditis elegans]
Length=459

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 8/95 (8%)
 Frame = -2

Query  429  LDKADEHEEMEKSK-------AVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVD  271
            L+ AD+ E     +        V YSYSFFH +F+LAS+Y  M LT W     +   L +
Sbjct  366  LNGADDAESQNSKRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKPSNDLSHL-N  424

Query  270  VGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
               ASVWV++V+ WV  AL+ W+LVAPI++PDR+F
Sbjct  425  SNMASVWVKIVSSWVCVALYCWTLVAPIIYPDREF  459



>ref|XP_004336528.1| serine incorporator 3, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14515.1| serine incorporator 3, putative [Acanthamoeba castellanii str. 
Neff]
Length=429

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 95/199 (48%), Gaps = 30/199 (15%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRD--YECNALHKHsksvstgtltlgllttvlsvvysa  508
            +  + V++LYCTYL YSA++SEP    ++CN       SVS+           +      
Sbjct  231  LLQSGVVTLYCTYLVYSAVSSEPNSGSFQCNPFDNMGGSVSSVLTGAAFTIVAVCWSTIR  290

Query  507  VRAGss------ttllsppssPRAGGGKPLLPLDKADEH-----------------EEME  397
            +    +      +   +  S   A  G  LLP +  DE+                 E+ E
Sbjct  291  MSTKGNDLLEGGSGATTDSSIQAAEEGDKLLP-ELNDENIPGSDSHHDDDHHEGKVEDDE  349

Query  396  KSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGK---LVDVGWASVWVRVVTGWV  226
            K + V Y+YSFFHI F L  MY  M++T W    G S      VD G+ +VWV++ T W+
Sbjct  350  KDE-VAYNYSFFHITFMLGVMYVYMIMTDWQIVSGASHSDDFKVDHGFTAVWVKLSTSWL  408

Query  225  TAALFLWSLVAPILFPDRD  169
             A L++W+L+API+ P RD
Sbjct  409  AALLYIWTLIAPIVLPGRD  427



>ref|XP_010469509.1| PREDICTED: probable serine incorporator isoform X4 [Camelina 
sativa]
Length=311

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 19/170 (11%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +             
Sbjct  147  LLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI-------------  193

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  322
            A  +  + +  +   +   +     D+A E E+      + YSY FFH++FSL +MY AM
Sbjct  194  AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVFSLGAMYFAM  247

Query  321  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
            L   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  248  LFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  297



>ref|NP_189089.3| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAL36053.1| AT3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AAQ89613.1| At3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AEE76900.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 75/172 (44%), Gaps = 17/172 (10%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            G + PA ++ LY  ++C+ A+ SEP    CN                          +  
Sbjct  248  GYLTPA-LMGLYVVFICWCAIRSEPVGESCNR----------------KAAASNRTDWLT  290

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
            + +     L    ++   G         K +  +E E    V Y Y FFH +F+  +MY 
Sbjct  291  IISFVVALLAMVIATFSTGIDSQCFQFKKDENDQEEEAEDDVPYGYGFFHFVFATGAMYF  350

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
            AMLL GW+T        +DVGW S WVRVV  W+   +++W LVAP++   R
Sbjct  351  AMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAVCVYIWMLVAPLILKSR  402



>ref|XP_011458210.1| PREDICTED: probable serine incorporator isoform X2 [Fragaria 
vesca subsp. vesca]
Length=403

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  414  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  235
            + +E E    V Y Y FFH +F+  +MY AMLL GW+T+       +DVGW S WVR+V 
Sbjct  316  KKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTNHSMKKWTIDVGWTSTWVRIVN  375

Query  234  GWVTAALFLWSLVAPILFPDRD  169
             W+   ++LW LVAPI++  R 
Sbjct  376  EWIAVCVYLWMLVAPIIWKSRQ  397



>ref|XP_004287083.1| PREDICTED: probable serine incorporator isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011458173.1| PREDICTED: probable serine incorporator isoform X1 [Fragaria 
vesca subsp. vesca]
Length=406

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  414  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  235
            + +E E    V Y Y FFH +F+  +MY AMLL GW+T+       +DVGW S WVR+V 
Sbjct  319  KKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTNHSMKKWTIDVGWTSTWVRIVN  378

Query  234  GWVTAALFLWSLVAPILFPDRD  169
             W+   ++LW LVAPI++  R 
Sbjct  379  EWIAVCVYLWMLVAPIIWKSRQ  400



>dbj|GAM29010.1| hypothetical protein SAMD00019534_121860, partial [Acytostelium 
subglobosum LB1]
Length=339

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 4/84 (5%)
 Frame = -2

Query  414  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVG--ESGKL-VDVGWASVWVR  244
            E ++ EK   V Y+YSFFHI F+L +MY  MLLT WST  G   +G L VD G  SVWV+
Sbjct  254  EMDDDEK-DGVAYNYSFFHITFALGAMYIGMLLTNWSTISGLDNNGNLNVDSGMVSVWVK  312

Query  243  VVTGWVTAALFLWSLVAPILFPDR  172
            +V+ W    L+ W+LV P LFP+R
Sbjct  313  IVSCWCVHILYFWTLVGPTLFPNR  336



>gb|KIH42470.1| TMS membrane protein/tumor differentially expressed protein, 
partial [Ancylostoma duodenale]
Length=91

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = -2

Query  399  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  220
             +++ V YSYSFFH +F LAS+Y  M LT W     +   L +   ASVWV++V+ W+  
Sbjct  15   NETEGVAYSYSFFHFMFGLASLYVMMTLTSWYNPDNDLTHL-NSNMASVWVKIVSSWLCV  73

Query  219  ALFLWSLVAPILFPDRDF  166
            AL+ W+LVAP LFPDR+F
Sbjct  74   ALYGWTLVAPALFPDREF  91



>ref|XP_010440599.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=101

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 4/95 (4%)
 Frame = -2

Query  456  AGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL  277
             G         K + HEE     A+ Y Y FFH +F+  +MY AMLL GW+         
Sbjct  8    TGVDSQCFQFRKEENHEE----DAIPYGYGFFHFVFATGAMYFAMLLVGWNIHHSMKKWT  63

Query  276  VDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
            +DVGW S WVR+V  W+   +++W LVAP++   R
Sbjct  64   IDVGWTSTWVRIVNEWLAVGVYIWMLVAPMVLKSR  98



>gb|EJW79555.1| serine incorporator 2 [Wuchereria bancrofti]
Length=414

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 89/196 (45%), Gaps = 23/196 (12%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECN-----ALHKHsksvstgtltlgllttvl  526
            +  +  +S I+LY  Y+ +SAL + P D ECN         H+           +    L
Sbjct  220  RSGLLQSSFITLYVMYITWSALINNP-DKECNPSLINVFTNHTTRYGQDVYGTPIPAESL  278

Query  525  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM----------------EK  394
              +          +  +  S  +  GG     +D AD   +                 ++
Sbjct  279  VSLLIWFICILYASFRTSSSFNKIAGGSSQGTVDDADNGSQQYIITSEDNLESGRVWDDE  338

Query  393  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAAL  214
            S AV+YSYSFFH +F LAS+Y  M LT W     +   L +   A+VWV++V+ W+  A+
Sbjct  339  SDAVSYSYSFFHFVFGLASLYVMMTLTCWYKPDSDLRHL-NSNMAAVWVKIVSSWLCLAI  397

Query  213  FLWSLVAPILFPDRDF  166
            + W+L AP LFPDRDF
Sbjct  398  YAWTLAAPALFPDRDF  413



>gb|EGT39434.1| hypothetical protein CAEBREN_08033 [Caenorhabditis brenneri]
Length=460

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = -2

Query  420  ADEHEEM-------EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW  262
            AD+ E          + + V YSYSFFH +F+LAS+Y  M LT W     +   L +   
Sbjct  370  ADDEESQSSRRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKPDNDLSHL-NSNM  428

Query  261  ASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
            ASVWV++V+ WV  AL+ W+L+AP++FPDRDF
Sbjct  429  ASVWVKIVSSWVCVALYCWTLLAPVVFPDRDF  460



>ref|NP_850202.4| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEC08798.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=422

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 81/170 (48%), Gaps = 21/170 (12%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++S +  T  L                 
Sbjct  260  LLSSGIMASYIVFLCWSAIRSEPSHTKCNAHTQNSHTDWTTIL-----------------  302

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  322
            +          ++   G         K +  EE +    + YSY FFH++FSL +MY AM
Sbjct  303  SFLIAIGAIVMATFSTGIDSESFRFRKDEAKEEDD----IPYSYGFFHLVFSLGAMYFAM  358

Query  321  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
            L   W+ S       +DVGW S WV++V  W  AA++LW L+API+   R
Sbjct  359  LFISWNLSHSTEKWSIDVGWTSTWVKIVNEWFAAAIYLWKLIAPIVRQHR  408



>gb|ESA13270.1| hypothetical protein GLOINDRAFT_347023 [Rhizophagus irregularis 
DAOM 181602]
Length=320

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 88/170 (52%), Gaps = 22/170 (13%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  493
            AS++++YCTY+  SA+A+EP D  CN L +   + +T  +                    
Sbjct  166  ASMVTIYCTYIILSAIANEPDDNMCNPLTRSRGTRTTTIVL----------------GTI  209

Query  492  sttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLT  313
             T L    S+ RA      L  D     +E      V Y+Y  FH IF++ASMY AMLLT
Sbjct  210  LTFLAIAYSTSRAATQTSALDDDDDGHDDE---KNGVAYNYGAFHFIFAVASMYVAMLLT  266

Query  312  GWST-SVGESGKLVDVGWA--SVWVRVVTGWVTAALFLWSLVAPILFPDR  172
             W+  +   S +LV +G +  +VWV+VV+ W+   L+ W+L+ P+L P+R
Sbjct  267  NWNNINTTGSEELVIIGQSIVAVWVKVVSSWICLLLYTWTLIGPVLMPER  316



>ref|XP_009336915.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009336916.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -2

Query  414  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  235
              +E E    V Y Y FFH +F+  +MY  MLL GW+T        +DVGWAS WVR+V 
Sbjct  312  RKDETESEDDVPYGYGFFHFVFATGAMYFGMLLIGWNTHQSMRRFTIDVGWASTWVRIVN  371

Query  234  GWVTAALFLWSLVAPILFPDRD  169
             W+   ++LW LVAPI+   R 
Sbjct  372  EWIAVCVYLWMLVAPIILESRQ  393



>ref|XP_004665239.1| PREDICTED: serine incorporator 2 [Jaculus jaculus]
Length=452

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = -2

Query  399  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  220
             +   VTYSYSFFH    LAS++  M LT W  S GESGKL+   W SVWV++   W   
Sbjct  376  NEQDGVTYSYSFFHFCLVLASLHIMMTLTNW-YSPGESGKLIS-KWTSVWVKICASWAGL  433

Query  219  ALFLWSLVAPILFPDRDF  166
             L+LW+LVAP+L P+RDF
Sbjct  434  LLYLWTLVAPLLLPNRDF  451



>ref|XP_003136987.1| hypothetical protein LOAG_01400 [Loa loa]
 gb|EFO27079.1| hypothetical protein LOAG_01400 [Loa loa]
Length=456

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 90/197 (46%), Gaps = 24/197 (12%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECN-----ALHKHsksvstgtltlgllttvl  526
            +  +  +S I+LY  Y+ +SAL + P D ECN         H+           L    +
Sbjct  261  RSGLLQSSFITLYVMYVTWSALINNP-DKECNPSLINIFTNHTTPYGQDIYGTPLPAESM  319

Query  525  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM-----------------E  397
              +          +  +  S  +  GG P   +D AD   +                  +
Sbjct  320  ISLLIWFVCILYASFRTSSSFNKIAGGSPHGVVDDADNGSQQHIITPIEDNLERGRIWDD  379

Query  396  KSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAA  217
            +S AV+YSYSFFH +F LAS+Y  M LT W     +   L +   A+VWV++V+ W+  A
Sbjct  380  ESDAVSYSYSFFHFVFGLASLYVMMTLTCWYKPDSDLRHL-NSNMAAVWVKIVSSWLCLA  438

Query  216  LFLWSLVAPILFPDRDF  166
            ++ W+L AP +FPDRDF
Sbjct  439  IYAWTLAAPAIFPDRDF  455



>emb|CDX93013.1| BnaA03g37350D [Brassica napus]
Length=411

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  426  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWV  247
            D   + E  EK   V Y Y FFH +F+  +MY AMLL GW+T        +DVGW S WV
Sbjct  320  DANSQGEVEEKEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWV  379

Query  246  RVVTGWVTAALFLWSLVAPILFPDR  172
            R+V  W+   +++W LVAPI+   R
Sbjct  380  RIVNEWLAVCVYIWMLVAPIILKSR  404



>gb|EXX52304.1| Tms1p [Rhizophagus irregularis DAOM 197198w]
Length=435

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 101/174 (58%), Gaps = 10/174 (6%)
 Frame = -2

Query  672  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  493
            AS++++YCTY+  SA+A+EP D  CN L +   + +T  +   +LT +     ++  A  
Sbjct  266  ASMVTIYCTYIILSAIANEPDDNMCNPLTRSRGTRTTTIVLGTILTFLAIAYSTSRAATQ  325

Query  492  sttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLT  313
            S  L++  +        P   LD  D+  + EK+  V Y+Y  FH IF++ASMY AMLLT
Sbjct  326  SKILIAKYNFLI----MPASALDDDDDGHDDEKN-GVAYNYGAFHFIFAVASMYVAMLLT  380

Query  312  GWST-SVGESGKLVDVGWA--SVWVRVVTGWVTAALFLWSLVAPILFPDR--DF  166
             W+  +   S +LV +G +  +VWV+VV+ W+   L+ W+L+ P+L P+R  DF
Sbjct  381  NWNNINTTGSEELVIIGQSIVAVWVKVVSSWICLLLYTWTLIGPVLMPERFEDF  434



>ref|XP_010469504.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
 ref|XP_010469505.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
 ref|XP_010469506.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
Length=425

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 19/170 (11%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +             
Sbjct  261  LLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI-------------  307

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  322
            A  +  + +  +   +   +     D+A E E+      + YSY FFH++FSL +MY AM
Sbjct  308  AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVFSLGAMYFAM  361

Query  321  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
            L   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  362  LFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  411



>ref|XP_010469508.1| PREDICTED: probable serine incorporator isoform X3 [Camelina 
sativa]
Length=423

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 19/170 (11%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +             
Sbjct  259  LLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI-------------  305

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  322
            A  +  + +  +   +   +     D+A E E+      + YSY FFH++FSL +MY AM
Sbjct  306  AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVFSLGAMYFAM  359

Query  321  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
            L   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  360  LFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  409



>ref|XP_010469507.1| PREDICTED: probable serine incorporator isoform X2 [Camelina 
sativa]
Length=423

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 19/170 (11%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +             
Sbjct  259  LLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI-------------  305

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  322
            A  +  + +  +   +   +     D+A E E+      + YSY FFH++FSL +MY AM
Sbjct  306  AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVFSLGAMYFAM  359

Query  321  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
            L   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  360  LFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  409



>ref|XP_001901605.1| TDE2 protein [Brugia malayi]
 emb|CDP98608.1| Protein Bm6897, isoform d [Brugia malayi]
Length=455

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 89/196 (45%), Gaps = 23/196 (12%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECN-----ALHKHsksvstgtltlgllttvl  526
            +  +  +S I+LY  Y+ +SAL + P D ECN         H+           +    L
Sbjct  261  RSGLLQSSFITLYVMYITWSALINNP-DKECNPSLINIFSNHTTRYGQDVYGTPIPAESL  319

Query  525  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM----------------EK  394
              +          +  +  S  +  GG     +D AD   +                 ++
Sbjct  320  VSLLIWFICILYASFRTSSSFNKIAGGSSQGTVDDADNGSQQYIITSEDNLENGRVWDDE  379

Query  393  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAAL  214
            S AV+YSYSFFH +F LAS+Y  M LT W     +   L +   A+VWV++V+ W+  A+
Sbjct  380  SDAVSYSYSFFHFVFGLASLYVMMTLTCWYKPDSDLRHL-NSNMAAVWVKIVSSWLCLAI  438

Query  213  FLWSLVAPILFPDRDF  166
            + W+L AP LFPDRDF
Sbjct  439  YAWTLAAPALFPDRDF  454



>gb|ETN74193.1| TMS membrane protein/tumor differentially expressed protein [Necator 
americanus]
Length=459

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 8/104 (8%)
 Frame = -2

Query  456  AGGGKPLLPLDKADEHEEM-------EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTS  298
            +G   P++P++  +E            +++ V YSYSFFH +F LAS+Y  M LT W   
Sbjct  357  SGSRDPIVPVNDDEESGSSSSRRVWDNETEGVAYSYSFFHFMFGLASLYVMMTLTSWYNP  416

Query  297  VGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
              +   L +   ASVWV++V+ W+  AL+ W+LVAP LFPDR+F
Sbjct  417  DNDLTHL-NSNMASVWVKIVSSWLCLALYGWTLVAPALFPDREF  459



>gb|EGT35951.1| hypothetical protein CAEBREN_13181 [Caenorhabditis brenneri]
Length=445

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 5/86 (6%)
 Frame = -2

Query  423  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  244
            KA ++EE    +AV YSYSFFH +F LAS+Y  M LT W     +   L +   ASVW++
Sbjct  365  KAFDNEE----EAVAYSYSFFHFMFGLASLYVMMTLTSWYHPDSDLAHL-NSNMASVWIK  419

Query  243  VVTGWVTAALFLWSLVAPILFPDRDF  166
            +++ W+ A L+ W+LVAPI+FPDR+F
Sbjct  420  ILSSWICAGLYSWTLVAPIVFPDREF  445



>ref|XP_010542976.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
Length=420

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 85/166 (51%), Gaps = 19/166 (11%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + +++LY  +LC+SA+ SEP D +CNA  ++  +  T  L+  +             
Sbjct  251  LLSSGIMALYVVFLCWSAIRSEPPDVKCNAHTQNGHTDWTTVLSFLI-------------  297

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  322
            A  +    +  +   +   +     D+A E ++      + Y+Y FFH++FSL +MY AM
Sbjct  298  AIGTIVYATFSTGIDSESFQFQFRKDEAKEEDD------IPYNYGFFHLVFSLGAMYFAM  351

Query  321  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  184
            L   W+         +DVGW S WV++V  W  +A+++W L+API+
Sbjct  352  LFVSWNLEHSARKWSLDVGWTSTWVKIVNEWFASAIYIWKLIAPIV  397



>ref|XP_008224089.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=428

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 82/166 (49%), Gaps = 20/166 (12%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + +++ Y  +LC+SA+ SEP + ECN   K        +  LG L  + S+V +   
Sbjct  262  LLSSGIMASYIVFLCWSAIRSEPANEECNR-QKQGNVNGDWSTILGFLIAICSIVMATFS  320

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  322
             G  +                        + +E+++   + Y Y FFH+ FSL +MY AM
Sbjct  321  TGIDSESFQF-------------------QKDEVQEDDDIPYKYGFFHLTFSLGAMYFAM  361

Query  321  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  184
            L   W+ +       +DVGW S WV++V  W  A++FLW+L++P+L
Sbjct  362  LFISWNLNNSAKKWSIDVGWTSTWVKIVNEWFAASIFLWTLISPVL  407



>ref|XP_010049913.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049914.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049915.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049916.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049917.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049918.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049919.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049921.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 gb|KCW82744.1| hypothetical protein EUGRSUZ_C04122 [Eucalyptus grandis]
Length=402

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 75/175 (43%), Gaps = 20/175 (11%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             G      ++ LY  ++C+ A+ SEP    CN                          + 
Sbjct  244  NGGFLTPGLMGLYIVFICWCAIRSEPAGDRCNR----------------KAEASNHTDWL  287

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
             + +     L    ++   G         K D   E +    V Y Y FFH++F+  +MY
Sbjct  288  TIISFVIALLAMVIATFSTGIDSQCFQFRKNDSKSEDD----VPYGYGFFHLVFATGAMY  343

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
             AMLL GW+T        +DVGW S WVRVV  W+   ++LW LVAP+L+  R+F
Sbjct  344  FAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAVCVYLWMLVAPMLWKCREF  398



>gb|ESA09597.1| hypothetical protein GLOINDRAFT_80906 [Rhizophagus irregularis 
DAOM 181602]
Length=415

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = -2

Query  396  KSKAVTYSYSFFHIIFSLASMYSAMLLTGWS--TSVGESGKLVDVG--WASVWVRVVTGW  229
            +   V Y+Y+FFH+IF++ASMY AMLLT W+  T++    KLV +G  + +VWV+V++ W
Sbjct  332  EKNGVAYNYAFFHLIFAIASMYVAMLLTNWNNVTTINSDEKLVVIGQTYIAVWVKVISSW  391

Query  228  VTAALFLWSLVAPILFPDR  172
            +   L+ W+L+ P+L PDR
Sbjct  392  ICILLYSWTLIGPVLLPDR  410



>ref|XP_004301051.1| PREDICTED: probable serine incorporator [Fragaria vesca subsp. 
vesca]
Length=419

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 80/166 (48%), Gaps = 20/166 (12%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + +++ Y  +LC+SA+ SEP + ECN   K        T  LG L  + ++V +   
Sbjct  253  LLSSGIMASYIVFLCWSAIRSEPANEECNP-QKQENVNGDWTTILGFLIAICAIVMATFS  311

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  322
             G  +                         H E++    + Y Y FFH++FSL  MY AM
Sbjct  312  TGVDSQSFQF-------------------RHSEVQHEDDIPYKYGFFHLVFSLGGMYFAM  352

Query  321  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  184
            L   W+ +       +DVGWAS WV++V  W  A++++W+L +P+L
Sbjct  353  LFISWNLNNSAKKWSIDVGWASTWVKIVNEWFAASIYIWTLFSPVL  398



>ref|XP_006295917.1| hypothetical protein CARUB_v10025054mg [Capsella rubella]
 gb|EOA28815.1| hypothetical protein CARUB_v10025054mg [Capsella rubella]
Length=423

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 84/170 (49%), Gaps = 21/170 (12%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++S +     L+  +    + +   +  
Sbjct  261  LLSSGIMASYIVFLCWSAVRSEPSHTKCNAHTQNSHTDWITILSFLIAIGAIVMATFSTG  320

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  322
              S +                     + DE +E E    + YSY FFH++FSL +MY AM
Sbjct  321  IDSESFKF------------------RRDEGKEEED---IPYSYGFFHLVFSLGAMYFAM  359

Query  321  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
            L   W+ S       +DVGW S WV++V  W  AA++LW L+API+   R
Sbjct  360  LFISWNLSDSARKWSIDVGWTSTWVKIVNEWFAAAIYLWKLIAPIVRQPR  409



>gb|KDP32305.1| hypothetical protein JCGZ_13230 [Jatropha curcas]
Length=400

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 79/174 (45%), Gaps = 20/174 (11%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  511
             G I    ++ LY  +LC+ A+ SEP    CN   + SK     T+   ++  +  V+ +
Sbjct  242  NGGILTPGLMGLYVVFLCWCAIRSEPAGESCNRKAEASKRTDWLTIISFVVALLAIVIAT  301

Query  510  aVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMY  331
                               G         K+++  E +    V Y Y FFH +F+  +MY
Sbjct  302  FS----------------TGIDSQCFQFRKSEKEAEDD----VPYGYGFFHFVFATGAMY  341

Query  330  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  169
             AMLL GW+T        +DVGW S WVRVV  W+   ++LW LVAPI+   R 
Sbjct  342  FAMLLIGWNTHHAMQKWTIDVGWTSAWVRVVNEWLAVCVYLWMLVAPIILKWRQ  395



>gb|EGT34050.1| hypothetical protein CAEBREN_24071 [Caenorhabditis brenneri]
Length=445

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 5/86 (6%)
 Frame = -2

Query  423  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  244
            KA ++EE    +AV YSYSFFH +F LAS+Y  M LT W     +   L +   ASVW++
Sbjct  365  KAFDNEE----EAVAYSYSFFHFMFGLASLYVMMTLTSWYHPDSDLAHL-NSNMASVWIK  419

Query  243  VVTGWVTAALFLWSLVAPILFPDRDF  166
            +++ W+ A L+ W+LVAP++FPDR+F
Sbjct  420  ILSSWICAGLYSWTLVAPVVFPDREF  445



>ref|XP_010656350.1| PREDICTED: probable serine incorporator isoform X2 [Vitis vinifera]
Length=353

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 76/172 (44%), Gaps = 20/172 (12%)
 Frame = -2

Query  684  SIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaV  505
            S     ++ LY  +LC+ A+ SEP +  CN                  + +     +  +
Sbjct  197  SFLTPGLMGLYVVFLCWCAIRSEPPEDRCNQ----------------KVESATKADWLTI  240

Query  504  RAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSA  325
             +     L    ++   G         K D   E +    V Y Y FFH +F+  +MY +
Sbjct  241  ISFIVALLAMVIATFSTGIDSKCFQFRKDDTQAEDD----VPYGYGFFHFVFATGAMYFS  296

Query  324  MLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  169
            MLL GW+T        +DVGW S WVR+V  W+ A ++LW LVAPI++  R 
Sbjct  297  MLLIGWNTHHSIRKWTIDVGWTSTWVRIVNEWLAACVYLWMLVAPIIWKSRQ  348



>ref|XP_002602420.1| hypothetical protein BRAFLDRAFT_117027 [Branchiostoma floridae]
 gb|EEN58432.1| hypothetical protein BRAFLDRAFT_117027 [Branchiostoma floridae]
Length=483

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 1/88 (1%)
 Frame = -2

Query  426  DKADEHEEMEKSK-AVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  250
            D  D+   ++  K  V Y+YSFFH +F LASMY  M LT W +  G +   +     +VW
Sbjct  395  DLDDDAPTIDNEKDGVKYNYSFFHFMFMLASMYIMMTLTNWYSPDGSNFNNLQPNQPAVW  454

Query  249  VRVVTGWVTAALFLWSLVAPILFPDRDF  166
            V++V+ W+   L++W+LVAPI+ PDRDF
Sbjct  455  VKIVSSWLCILLYVWTLVAPIVLPDRDF  482



>ref|XP_010049722.1| PREDICTED: probable serine incorporator [Eucalyptus grandis]
 gb|KCW82479.1| hypothetical protein EUGRSUZ_C03867 [Eucalyptus grandis]
Length=402

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -2

Query  408  EEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGW  229
             +++    V Y Y FFH++F+  +MY AMLL GW+T        +DVGW S WVRVV  W
Sbjct  318  NDLKSEDDVPYGYGFFHLVFATGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEW  377

Query  228  VTAALFLWSLVAPILFPDRDF  166
            +   ++LW LVAP+L+  R+F
Sbjct  378  LAVCVYLWMLVAPMLWKCREF  398



>gb|ENN78699.1| hypothetical protein YQE_04871, partial [Dendroctonus ponderosae]
Length=456

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 102/196 (52%), Gaps = 27/196 (14%)
 Frame = -2

Query  690  KGSIFPASVISLYCTYLCYSALASEPRDYECN-----------ALHKHsksvstgtltlg  544
            +  +  +S+++LY TYL +SA+++ P+  ECN           + H          +   
Sbjct  265  RSGLLQSSIVTLYVTYLTWSAVSNSPK--ECNPGMWGIFGTKSSEHNFDIIGIFIWMCCV  322

Query  543  llttvlsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK-------A  385
            L +++ S   S+    S   L     + R  G   L+  +  D  E  ++SK       A
Sbjct  323  LYSSLRSASKSSKLTMSENMLAKDNGAVRGYGSDNLVLTEGNDGGESGDRSKVWDNEDDA  382

Query  384  VTYSYSFFHIIFSLASMYSAMLLTGW---STSVGESGKLVDVGWASVWVRVVTGWVTAAL  214
            V Y++SFFH++F+LA++Y  M LT W   ++++ E     +   AS+W++ ++GW+  AL
Sbjct  383  VAYNWSFFHVMFALATLYIMMTLTNWYKPNSNIEE----FNYNAASMWIKAISGWLCLAL  438

Query  213  FLWSLVAPILFPDRDF  166
            + W+LVAP+L PDRDF
Sbjct  439  YSWTLVAPVLLPDRDF  454



>emb|CEP13524.1| hypothetical protein [Parasitella parasitica]
Length=487

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 14/93 (15%)
 Frame = -2

Query  426  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWST-----SVG-ESGKLVDVG  265
            DK DE           YSYSFFH +F++A+MY +M+LT W+T      VG + G LV +G
Sbjct  397  DKDDER------FGSLYSYSFFHFVFAIAAMYVSMVLTNWNTIQFKDGVGNDGGDLVRIG  450

Query  264  --WASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
              + +VWV++V+GW+   +++WSLVAP+L PDR
Sbjct  451  QSYTAVWVKIVSGWICHIIYIWSLVAPVLMPDR  483



>ref|XP_011174068.1| PREDICTED: probable serine incorporator, partial [Solenopsis 
invicta]
Length=113

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -2

Query  399  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  220
             + + V Y++SFFH++F+LA++Y  M LT W      + + ++   AS+WV++++ W+  
Sbjct  35   NEEEKVAYNWSFFHLMFALATLYVMMTLTNWYKPNVSNLETLNANTASMWVKIISSWMCL  94

Query  219  ALFLWSLVAPILFPDRDF  166
             L++WSLVAP +FP+RDF
Sbjct  95   GLYVWSLVAPAIFPNRDF  112



>ref|XP_005665214.1| PREDICTED: serine incorporator 2-like, partial [Sus scrofa]
Length=135

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -2

Query  399  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  220
             +   VTYSYSFFH    LAS++  M LT W    GE+ K++   W +VWV++   W   
Sbjct  59   NEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYRP-GETRKMIST-WTAVWVKICASWAGL  116

Query  219  ALFLWSLVAPILFPDRDF  166
             L+LW+LVAP+L P+RDF
Sbjct  117  LLYLWTLVAPLLLPNRDF  134



>dbj|GAN07994.1| TMS membrane protein/tumor differentially expressed protein [Mucor 
ambiguus]
Length=495

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 14/93 (15%)
 Frame = -2

Query  426  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWST-----SVG-ESGKLVDVG  265
            DK DE           YSYSFFH +F++A+MY +M+LT W+T      VG + G LV +G
Sbjct  405  DKDDER------FGSLYSYSFFHFVFAIAAMYVSMVLTNWNTIQFKDGVGHDGGDLVRIG  458

Query  264  --WASVWVRVVTGWVTAALFLWSLVAPILFPDR  172
              + +VWV++V+GW+   +++WSLVAP+L PDR
Sbjct  459  QSYTAVWVKIVSGWICHLIYMWSLVAPVLMPDR  491



>ref|XP_007226418.1| hypothetical protein PRUPE_ppa023345mg [Prunus persica]
 gb|EMJ27617.1| hypothetical protein PRUPE_ppa023345mg [Prunus persica]
Length=417

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 82/166 (49%), Gaps = 20/166 (12%)
 Frame = -2

Query  681  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  502
            +  + +++ Y  +LC+SA+ SEP + ECN   K        +  LG L  + S+V +   
Sbjct  251  LLSSGIMASYIVFLCWSAIRSEPANEECNR-QKQGNGNGDWSTILGFLIAICSIVMATFS  309

Query  501  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  322
             G  +                        + +E+++   + Y Y FFH+ FSL +MY AM
Sbjct  310  TGIDSQSFQF-------------------QKDEVKEDDDIPYKYGFFHLTFSLGAMYFAM  350

Query  321  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  184
            L   W+ +       +DVGW S WV++V  W  A++FLW+L++P+L
Sbjct  351  LFISWNLNNSAKKWSIDVGWTSTWVKIVNEWFAASIFLWTLISPVL  396



>ref|XP_010656344.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656345.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656346.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656347.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656348.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656349.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 emb|CBI28099.3| unnamed protein product [Vitis vinifera]
Length=397

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 76/172 (44%), Gaps = 20/172 (12%)
 Frame = -2

Query  684  SIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaV  505
            S     ++ LY  +LC+ A+ SEP +  CN                  + +     +  +
Sbjct  241  SFLTPGLMGLYVVFLCWCAIRSEPPEDRCNQ----------------KVESATKADWLTI  284

Query  504  RAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSA  325
             +     L    ++   G         K D   E +    V Y Y FFH +F+  +MY +
Sbjct  285  ISFIVALLAMVIATFSTGIDSKCFQFRKDDTQAEDD----VPYGYGFFHFVFATGAMYFS  340

Query  324  MLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  169
            MLL GW+T        +DVGW S WVR+V  W+ A ++LW LVAPI++  R 
Sbjct  341  MLLIGWNTHHSIRKWTIDVGWTSTWVRIVNEWLAACVYLWMLVAPIIWKSRQ  392



>gb|EXX55775.1| Tms1p [Rhizophagus irregularis DAOM 197198w]
Length=476

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = -2

Query  396  KSKAVTYSYSFFHIIFSLASMYSAMLLTGWS--TSVGESGKLVDVG--WASVWVRVVTGW  229
            +   V Y+Y+FFH+IF++ASMY AMLLT W+  T++    KLV +G  + +VWV+V++ W
Sbjct  393  EKNGVAYNYAFFHLIFAIASMYVAMLLTNWNNVTTINSDEKLVVIGQTYIAVWVKVISSW  452

Query  228  VTAALFLWSLVAPILFPDR  172
            +   L+ W+L+ P+L PDR
Sbjct  453  ICILLYSWTLIGPVLLPDR  471



>gb|KHN74385.1| Serine incorporator 3 [Toxocara canis]
Length=570

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 60/100 (60%), Gaps = 5/100 (5%)
 Frame = -2

Query  453  GGGKPLLPLDKADEHEEM----EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGES  286
            G  +P++     ++ E +    ++  AV+YSYSFFH +F LAS+Y  M LT W     + 
Sbjct  471  GSQQPIVDASSGEDRESVRVWDDEKDAVSYSYSFFHFVFGLASLYVMMTLTSWYKPDNDL  530

Query  285  GKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  166
              L +   A+VWV+VV+ W+   ++ W+L AP +FPDRDF
Sbjct  531  SHL-NSNMAAVWVKVVSSWLCLIIYCWTLAAPAIFPDRDF  569



>gb|EPB88143.1| hypothetical protein HMPREF1544_05087 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=495

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 8/77 (10%)
 Frame = -2

Query  378  YSYSFFHIIFSLASMYSAMLLTGWST-----SVG-ESGKLVDVG--WASVWVRVVTGWVT  223
            YSYSFFH +F++A+MY +M+LT W+T      VG + G LV +G  + +VWV++V+GW+ 
Sbjct  415  YSYSFFHFVFAIAAMYVSMVLTNWNTIQFKDGVGHDGGDLVRIGQSYTAVWVKIVSGWIC  474

Query  222  AALFLWSLVAPILFPDR  172
              +++WSLVAP+L PDR
Sbjct  475  HLIYIWSLVAPVLMPDR  491



>ref|XP_006285723.1| hypothetical protein CARUB_v10007195mg [Capsella rubella]
 gb|EOA18621.1| hypothetical protein CARUB_v10007195mg [Capsella rubella]
Length=395

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 79/173 (46%), Gaps = 21/173 (12%)
 Frame = -2

Query  687  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  508
            G + PA ++ LY  ++C+ A+ SEP    CN   + S      T+   ++  +  V+ + 
Sbjct  242  GFLTPA-LMGLYVVFICWCAIRSEPLGETCNRKAEGSSKTDWLTIISFVVALLAMVIATF  300

Query  507  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  328
                              G         K + HEE     A+ Y Y FFH +F+  +MY 
Sbjct  301  ----------------STGVDSQCFQFRKDENHEE----DAIPYGYGFFHFVFATGAMYF  340

Query  327  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  169
            AMLL GW+         +DVGW S WVR+V  W+   +++W LVAP++   R 
Sbjct  341  AMLLVGWNIHHSMKKWTIDVGWTSTWVRIVNEWLAVGVYIWMLVAPMVLKSRQ  393



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520