BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF020L18

Length=201
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    96.7    9e-22   Nicotiana sylvestris
ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    95.1    2e-21   Nicotiana tomentosiformis
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    92.4    3e-20   Solanum tuberosum [potatoes]
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    91.7    6e-20   Solanum tuberosum [potatoes]
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    91.3    7e-20   Nicotiana sylvestris
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    91.3    7e-20   Nicotiana tomentosiformis
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    89.4    3e-19   Solanum lycopersicum
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative            88.6    5e-19   
gb|AFK49564.1|  unknown                                               88.2    9e-19   Medicago truncatula
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                88.2    9e-19   Medicago truncatula
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    87.8    1e-18   Solanum tuberosum [potatoes]
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         87.8    1e-18   Solanum lycopersicum
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    87.0    3e-18   Cicer arietinum [garbanzo]
dbj|BAE71216.1|  putative NAD dependent epimerase                     87.0    3e-18   Trifolium pratense [peavine clover]
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g           86.3    5e-18   Populus trichocarpa [western balsam poplar]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                       86.3    5e-18   Jatropha curcas
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         85.9    6e-18   Populus euphratica
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein   85.1    2e-17   Populus trichocarpa [western balsam poplar]
emb|CDX77481.1|  BnaA07g06190D                                        84.7    2e-17   
emb|CDP21869.1|  unnamed protein product                              84.7    2e-17   Coffea canephora [robusta coffee]
emb|CDX85133.1|  BnaC07g07730D                                        84.7    2e-17   
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         84.7    2e-17   Brassica rapa
emb|CDX92990.1|  BnaA03g37120D                                        84.3    2e-17   
emb|CAN83418.1|  hypothetical protein VITISV_041351                   84.3    3e-17   Vitis vinifera
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    84.3    3e-17   Brassica rapa
ref|XP_002511693.1|  UDP-glucuronate 5-epimerase, putative            80.9    3e-17   
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         84.3    3e-17   Vitis vinifera
emb|CDY67756.1|  BnaA03g56770D                                        84.0    3e-17   Brassica napus [oilseed rape]
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    84.0    3e-17   Cicer arietinum [garbanzo]
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         84.3    3e-17   Sesamum indicum [beniseed]
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         84.0    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    84.0    3e-17   Populus euphratica
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         83.6    4e-17   Brassica rapa
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g           83.6    5e-17   
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630        83.2    5e-17   Amborella trichopoda
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg           83.6    5e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    83.6    6e-17   Nelumbo nucifera [Indian lotus]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    83.6    6e-17   Citrus sinensis [apfelsine]
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein   83.2    6e-17   Populus trichocarpa [western balsam poplar]
emb|CDX95646.1|  BnaC03g25270D                                        83.2    6e-17   
ref|XP_006386474.1|  hypothetical protein POPTR_0002s11750g           80.9    7e-17   
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg           83.2    7e-17   Prunus persica
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    83.2    7e-17   Populus euphratica
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    83.2    7e-17   
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         83.2    7e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                    83.2    7e-17   Morus notabilis
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g           82.8    7e-17   Phaseolus vulgaris [French bean]
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         83.2    8e-17   Camelina sativa [gold-of-pleasure]
emb|CDY63064.1|  BnaAnng18570D                                        82.8    8e-17   Brassica napus [oilseed rape]
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         83.2    9e-17   Brassica rapa
gb|KHN25558.1|  UDP-glucuronate 4-epimerase 3                         80.9    1e-16   Glycine soja [wild soybean]
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         82.4    1e-16   Brassica rapa
emb|CDY64583.1|  BnaCnng44170D                                        82.8    1e-16   Brassica napus [oilseed rape]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    82.8    1e-16   Nelumbo nucifera [Indian lotus]
emb|CDY18087.1|  BnaA01g23480D                                        82.8    1e-16   Brassica napus [oilseed rape]
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    82.8    1e-16   Cucumis sativus [cucumbers]
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         82.8    1e-16   Fragaria vesca subsp. vesca
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         82.8    1e-16   Cucumis melo [Oriental melon]
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         82.8    1e-16   Malus domestica [apple tree]
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg           82.4    1e-16   Prunus persica
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  82.8    1e-16   Tarenaya hassleriana [spider flower]
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                  82.4    1e-16   Arabis alpina [alpine rockcress]
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                     82.4    1e-16   Gossypium hirsutum [American cotton]
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg           82.4    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    82.4    1e-16   Solanum lycopersicum
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                     82.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                         82.0    2e-16   Phaseolus vulgaris [French bean]
ref|XP_001761086.1|  predicted protein                                82.0    2e-16   
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                  82.0    2e-16   Arabidopsis lyrata subsp. lyrata
gb|KJB28115.1|  hypothetical protein B456_005G028000                  81.6    2e-16   Gossypium raimondii
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                     81.6    2e-16   Phaseolus vulgaris [French bean]
dbj|BAF00333.1|  putative nucleotide sugar epimerase                  80.1    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         81.6    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg           81.6    2e-16   Capsella rubella
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    81.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         81.6    3e-16   Camelina sativa [gold-of-pleasure]
gb|AAM61323.1|  nucleotide sugar epimerase, putative                  81.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                  81.3    3e-16   Arabis alpina [alpine rockcress]
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         81.3    3e-16   Cucumis melo [Oriental melon]
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    81.3    3e-16   Camelina sativa [gold-of-pleasure]
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                  81.3    3e-16   Arabis alpina [alpine rockcress]
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                     81.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    81.3    3e-16   Populus euphratica
emb|CDY53207.1|  BnaC03g74010D                                        81.3    3e-16   Brassica napus [oilseed rape]
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    81.3    3e-16   Solanum tuberosum [potatoes]
emb|CAN73017.1|  hypothetical protein VITISV_004389                   78.2    3e-16   Vitis vinifera
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    81.3    4e-16   
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    80.9    4e-16   
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    81.3    4e-16   Glycine max [soybeans]
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    80.9    5e-16   Glycine max [soybeans]
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         80.9    5e-16   Tarenaya hassleriana [spider flower]
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    80.9    5e-16   Cicer arietinum [garbanzo]
emb|CAN83831.1|  hypothetical protein VITISV_003974                   77.4    5e-16   Vitis vinifera
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg           80.9    6e-16   Capsella rubella
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg           80.5    7e-16   Citrus clementina [clementine]
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg           80.1    7e-16   Capsella rubella
gb|AAN60250.1|  unknown                                               80.5    7e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    80.5    7e-16   Vitis vinifera
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                     80.5    7e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170        80.5    7e-16   Amborella trichopoda
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         80.5    7e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    80.1    7e-16   Nicotiana sylvestris
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926           80.5    7e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         80.1    8e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         80.1    8e-16   
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         80.1    8e-16   Eucalyptus grandis [rose gum]
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    79.7    1e-15   Nicotiana tomentosiformis
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         79.7    1e-15   
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    79.7    1e-15   Glycine max [soybeans]
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    79.7    1e-15   Vitis vinifera
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    79.7    1e-15   Camelina sativa [gold-of-pleasure]
emb|CAN73016.1|  hypothetical protein VITISV_004388                   79.3    1e-15   Vitis vinifera
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                    79.7    1e-15   Morus notabilis
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g           79.3    1e-15   Phaseolus vulgaris [French bean]
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                      79.3    2e-15   Medicago truncatula
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                     79.3    2e-15   Gossypium hirsutum [American cotton]
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                         79.3    2e-15   Medicago truncatula
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg           79.3    2e-15   Eutrema salsugineum [saltwater cress]
emb|CDO97699.1|  unnamed protein product                              79.3    2e-15   Coffea canephora [robusta coffee]
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                  79.3    2e-15   Arabidopsis lyrata subsp. lyrata
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                     79.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KDP28767.1|  hypothetical protein JCGZ_14538                       79.3    2e-15   Jatropha curcas
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                  79.0    2e-15   Arabidopsis lyrata subsp. lyrata
gb|ABR16292.1|  unknown                                               79.0    2e-15   Picea sitchensis
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         79.0    2e-15   
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         79.0    2e-15   Pyrus x bretschneideri [bai li]
gb|ABK25339.1|  unknown                                               78.6    2e-15   Picea sitchensis
gb|KJB72008.1|  hypothetical protein B456_011G153500                  79.0    2e-15   Gossypium raimondii
gb|KJB09908.1|  hypothetical protein B456_001G174300                  78.6    3e-15   Gossypium raimondii
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                  78.6    3e-15   Theobroma cacao [chocolate]
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                  78.6    3e-15   
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  78.6    3e-15   Phoenix dactylifera
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    78.2    4e-15   Solanum lycopersicum
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg           78.2    4e-15   Citrus clementina [clementine]
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    77.8    5e-15   Nicotiana tomentosiformis
gb|EYU31982.1|  hypothetical protein MIMGU_mgv1a012102mg              76.3    5e-15   Erythranthe guttata [common monkey flower]
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    77.8    5e-15   Solanum tuberosum [potatoes]
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    77.8    6e-15   Nicotiana sylvestris
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...  77.8    7e-15   Tarenaya hassleriana [spider flower]
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         77.4    8e-15   Fragaria vesca subsp. vesca
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684           77.4    8e-15   
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174            77.4    8e-15   
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    77.4    9e-15   Sesamum indicum [beniseed]
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    77.0    1e-14   Solanum tuberosum [potatoes]
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         77.0    1e-14   Nicotiana tomentosiformis
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836           77.0    1e-14   
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    77.4    1e-14   Glycine max [soybeans]
ref|XP_010540291.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    76.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    77.0    1e-14   Nicotiana sylvestris
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         77.0    1e-14   Eucalyptus grandis [rose gum]
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    77.0    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268            76.6    1e-14   Selaginella moellendorffii
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         76.6    1e-14   
ref|XP_001751991.1|  predicted protein                                76.6    2e-14   
gb|KJB41101.1|  hypothetical protein B456_007G090500                  76.6    2e-14   Gossypium raimondii
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    76.6    2e-14   Elaeis guineensis
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    76.3    2e-14   Sesamum indicum [beniseed]
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         76.3    2e-14   Solanum lycopersicum
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg           76.3    2e-14   
ref|XP_001754001.1|  predicted protein                                76.3    2e-14   
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    75.9    2e-14   Solanum tuberosum [potatoes]
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                     75.9    3e-14   Gossypium hirsutum [American cotton]
gb|KJB24820.1|  hypothetical protein B456_004G162700                  75.9    3e-14   Gossypium raimondii
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    75.9    3e-14   Phoenix dactylifera
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg              75.5    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_001777338.1|  predicted protein                                75.9    3e-14   
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         75.5    4e-14   Nicotiana tomentosiformis
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         75.5    4e-14   Prunus mume [ume]
gb|EPS72617.1|  hypothetical protein M569_02133                       75.5    4e-14   Genlisea aurea
gb|KGN57287.1|  hypothetical protein Csa_3G176330                     73.6    4e-14   
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         75.1    5e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    75.1    6e-14   
ref|XP_001759693.1|  predicted protein                                75.1    6e-14   
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         74.7    7e-14   Elaeis guineensis
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    74.7    7e-14   Elaeis guineensis
emb|CDY04398.1|  BnaC02g28500D                                        74.7    8e-14   
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    74.3    9e-14   Phoenix dactylifera
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    74.3    1e-13   Brassica rapa
emb|CDX97356.1|  BnaA02g21470D                                        74.3    1e-13   
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    73.9    1e-13   Solanum lycopersicum
ref|XP_001769370.1|  predicted protein                                73.9    1e-13   
ref|XP_004171294.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    73.9    1e-13   
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    73.9    1e-13   Populus euphratica
ref|NP_001049561.1|  Os03g0249500                                     73.9    1e-13   
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         73.9    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         73.9    1e-13   Sesamum indicum [beniseed]
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         73.9    2e-13   Elaeis guineensis
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    73.9    2e-13   Oryza brachyantha
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    73.6    2e-13   Glycine max [soybeans]
ref|NP_001048359.1|  Os02g0791500                                     73.6    2e-13   
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    73.6    2e-13   Setaria italica
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g           73.6    2e-13   Phaseolus vulgaris [French bean]
gb|EPS60141.1|  hypothetical protein M569_14661                       73.6    2e-13   Genlisea aurea
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative            73.6    2e-13   Ricinus communis
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    73.2    2e-13   Glycine max [soybeans]
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    73.6    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001142515.1|  hypothetical protein                             73.2    2e-13   Zea mays [maize]
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         73.2    2e-13   Phoenix dactylifera
gb|KHN17533.1|  UDP-glucuronate 4-epimerase 1                         71.2    3e-13   Glycine soja [wild soybean]
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    73.2    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg           72.8    4e-13   Prunus persica
gb|EMT26004.1|  UDP-glucuronate 4-epimerase 4                         70.5    4e-13   
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg           72.8    4e-13   Citrus clementina [clementine]
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    72.4    4e-13   Prunus mume [ume]
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                         72.4    4e-13   Medicago truncatula
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    72.8    4e-13   Phoenix dactylifera
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         72.4    5e-13   Fragaria vesca subsp. vesca
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    72.0    5e-13   Cucumis sativus [cucumbers]
gb|AFK41785.1|  unknown                                               69.7    6e-13   Medicago truncatula
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110        72.0    6e-13   Amborella trichopoda
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         72.0    6e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         72.0    6e-13   Nelumbo nucifera [Indian lotus]
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920        72.0    7e-13   Sorghum bicolor [broomcorn]
emb|CDP09891.1|  unnamed protein product                              72.0    7e-13   Coffea canephora [robusta coffee]
ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6         72.0    8e-13   Prunus mume [ume]
ref|XP_006651218.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    72.0    8e-13   
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         71.6    9e-13   Cucumis melo [Oriental melon]
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         71.6    9e-13   Fragaria vesca subsp. vesca
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         71.6    1e-12   
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein   71.6    1e-12   Populus trichocarpa [western balsam poplar]
emb|CDP21367.1|  unnamed protein product                              71.6    1e-12   Coffea canephora [robusta coffee]
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    71.6    1e-12   Zea mays [maize]
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg              71.2    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  71.6    1e-12   Elaeis guineensis
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630        71.2    1e-12   Sorghum bicolor [broomcorn]
emb|CBI22155.3|  unnamed protein product                              69.3    1e-12   Vitis vinifera
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    71.2    1e-12   Solanum lycopersicum
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         71.2    1e-12   Populus euphratica
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    71.2    1e-12   Solanum tuberosum [potatoes]
ref|XP_010662214.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         70.5    1e-12   Vitis vinifera
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         71.2    1e-12   Nicotiana sylvestris
emb|CBI18845.3|  unnamed protein product                              69.3    1e-12   Vitis vinifera
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         70.9    1e-12   Nicotiana tomentosiformis
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    71.2    1e-12   Setaria italica
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    71.2    1e-12   Brachypodium distachyon [annual false brome]
dbj|BAJ88176.1|  predicted protein                                    71.2    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                 71.2    2e-12   Citrus sinensis [apfelsine]
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    70.9    2e-12   Nelumbo nucifera [Indian lotus]
gb|KDP38751.1|  hypothetical protein JCGZ_04104                       70.9    2e-12   Jatropha curcas
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    70.5    2e-12   Cucumis melo [Oriental melon]
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    70.9    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP25603.1|  hypothetical protein JCGZ_20759                       70.9    2e-12   Jatropha curcas
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                  70.5    2e-12   
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg           70.5    2e-12   Prunus persica
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         70.5    2e-12   Prunus mume [ume]
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    70.9    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g           70.5    2e-12   Populus trichocarpa [western balsam poplar]
dbj|BAJ85817.1|  predicted protein                                    70.5    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                    70.5    3e-12   Morus notabilis
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                         69.7    3e-12   Glycine soja [wild soybean]
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         70.1    3e-12   Brachypodium distachyon [annual false brome]
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    70.1    3e-12   Brachypodium distachyon [annual false brome]
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         70.1    4e-12   Eucalyptus grandis [rose gum]
ref|XP_008776445.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    67.4    4e-12   Phoenix dactylifera
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    69.7    4e-12   Cicer arietinum [garbanzo]
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    69.7    4e-12   Cucumis melo [Oriental melon]
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    69.7    4e-12   
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                    69.7    4e-12   Morus notabilis
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    69.7    4e-12   Eucalyptus grandis [rose gum]
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    69.7    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                         69.7    5e-12   Medicago truncatula
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         69.3    5e-12   Solanum lycopersicum
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    69.3    5e-12   Solanum tuberosum [potatoes]
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                  69.3    5e-12   Zea mays [maize]
ref|NP_001105911.1|  LOC732831                                        69.3    6e-12   Zea mays [maize]
emb|CBI24539.3|  unnamed protein product                              68.2    6e-12   Vitis vinifera
emb|CAN60968.1|  hypothetical protein VITISV_008097                   69.3    6e-12   Vitis vinifera
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    69.3    6e-12   Tarenaya hassleriana [spider flower]
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                  69.3    6e-12   
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    68.9    7e-12   Vitis vinifera
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    68.9    8e-12   Vitis vinifera
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    68.9    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    68.9    9e-12   Sesamum indicum [beniseed]
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    68.6    1e-11   Cucumis sativus [cucumbers]
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    68.6    1e-11   
ref|XP_010092236.1|  UDP-glucuronate 4-epimerase 3                    66.6    1e-11   
dbj|BAK06545.1|  predicted protein                                    68.6    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         68.6    1e-11   Malus domestica [apple tree]
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg              68.2    1e-11   Erythranthe guttata [common monkey flower]
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    68.2    1e-11   
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg           68.2    2e-11   
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         67.8    2e-11   
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                     67.8    2e-11   
gb|KJB76605.1|  hypothetical protein B456_012G096800                  67.8    2e-11   
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         67.4    3e-11   
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    67.4    3e-11   
gb|KGN65261.1|  hypothetical protein Csa_1G277970                     67.0    3e-11   
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g           67.0    3e-11   
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    67.0    3e-11   
gb|EMS53276.1|  UDP-glucuronate 4-epimerase 1                         67.4    4e-11   
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    66.2    5e-11   
gb|AEW08737.1|  hypothetical protein CL1437Contig1_03                 62.8    5e-11   
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...  66.6    5e-11   
gb|AEW08736.1|  hypothetical protein CL1437Contig1_03                 62.8    5e-11   
gb|EMS47781.1|  UDP-glucuronate 4-epimerase 6                         66.2    5e-11   
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    66.2    5e-11   
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         66.6    5e-11   
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...  66.6    6e-11   
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    66.2    7e-11   
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    66.2    7e-11   
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    66.2    7e-11   
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160        66.2    7e-11   
ref|NP_001147328.1|  protein capI                                     66.2    7e-11   
ref|XP_001767292.1|  predicted protein                                66.2    8e-11   
gb|EEC83913.1|  hypothetical protein OsI_29968                        64.3    8e-11   
gb|KJB27035.1|  hypothetical protein B456_004G273500                  65.9    9e-11   
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    66.2    9e-11   
ref|XP_001761984.1|  predicted protein                                65.9    1e-10   
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130        65.9    1e-10   
gb|EEC83914.1|  hypothetical protein OsI_29969                        65.9    1e-10   
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  65.5    1e-10   
gb|KJB27036.1|  hypothetical protein B456_004G273500                  65.5    1e-10   
ref|NP_001062295.1|  Os08g0526100                                     65.5    1e-10   
gb|EMT23409.1|  UDP-glucuronate 4-epimerase 1                         65.5    2e-10   
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)         65.5    2e-10   
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         65.1    2e-10   
gb|EAZ43405.1|  hypothetical protein OsJ_28010                        65.5    2e-10   
ref|XP_006660306.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    63.5    2e-10   
dbj|BAJ86203.1|  predicted protein                                    65.5    2e-10   
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                         65.5    2e-10   
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    64.7    3e-10   
gb|EMT33438.1|  UDP-glucuronate 4-epimerase 6                         62.8    3e-10   
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    64.3    3e-10   
dbj|BAJ99315.1|  predicted protein                                    64.7    3e-10   
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                  64.3    3e-10   
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520        64.3    4e-10   
gb|KJB43946.1|  hypothetical protein B456_007G225300                  63.9    5e-10   
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    63.9    5e-10   
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg           63.5    5e-10   
gb|EPS64795.1|  hypothetical protein M569_09984                       63.5    5e-10   
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...  63.9    6e-10   
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    63.9    6e-10   
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein    63.5    7e-10   
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like    63.2    1e-09   
ref|XP_009114689.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    61.6    1e-09   
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                 62.8    1e-09   
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                  62.8    1e-09   
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                      62.0    2e-09   
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         62.0    2e-09   
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         62.0    3e-09   
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         61.6    4e-09   
gb|KJB25649.1|  hypothetical protein B456_004G202200                  61.2    4e-09   
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    60.8    6e-09   
gb|AEW07796.1|  hypothetical protein 0_11781_01                       58.2    7e-09   
gb|AFG68267.1|  hypothetical protein 0_11781_01                       58.2    7e-09   
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg           60.1    1e-08   
gb|AAK93670.1|  putative nucleotide sugar epimerase                   60.1    1e-08   
emb|CDX86716.1|  BnaA09g21060D                                        60.1    1e-08   
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg           60.1    1e-08   
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                     60.1    1e-08   
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    60.1    1e-08   
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  59.7    1e-08   
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                  59.7    1e-08   
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  59.7    1e-08   
gb|AFG68265.1|  hypothetical protein 0_11781_01                       57.4    2e-08   
emb|CDX94504.1|  BnaC09g23320D                                        58.9    2e-08   
gb|KDP22397.1|  hypothetical protein JCGZ_26228                       58.9    3e-08   
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    58.9    3e-08   
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                  58.5    4e-08   
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030        58.5    4e-08   
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    58.5    5e-08   
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    58.2    5e-08   
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                 57.0    1e-07   
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    57.0    1e-07   
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  56.6    2e-07   
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                       56.2    3e-07   
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         55.8    3e-07   
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    55.8    4e-07   
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         55.5    4e-07   
ref|XP_001781238.1|  predicted protein                                55.5    5e-07   
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    55.5    5e-07   
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    55.5    5e-07   
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g           55.1    6e-07   
gb|EMT09376.1|  UDP-glucuronate 4-epimerase 1                         54.7    7e-07   
gb|EPS73152.1|  hypothetical protein M569_01604                       54.7    7e-07   
gb|KJB23560.1|  hypothetical protein B456_004G105200                  54.7    7e-07   
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         54.7    8e-07   
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    54.7    8e-07   
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg              53.9    1e-06   
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    53.9    2e-06   
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    53.9    2e-06   
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative            53.9    2e-06   
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         53.5    2e-06   
emb|CDY70926.1|  BnaCnng70410D                                        53.5    2e-06   
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    53.5    2e-06   
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                     53.5    2e-06   
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         53.5    2e-06   
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  53.5    2e-06   
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  53.5    2e-06   
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         53.5    2e-06   
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                  53.5    2e-06   
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  53.5    2e-06   
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  53.5    2e-06   
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg           53.5    2e-06   
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg           53.5    2e-06   
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  53.5    2e-06   
emb|CDY39205.1|  BnaA03g50170D                                        53.5    2e-06   
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  53.1    3e-06   
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    53.1    3e-06   
emb|CDX72242.1|  BnaC07g42640D                                        53.1    3e-06   
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         53.1    3e-06   
dbj|BAH20281.1|  AT4G30440                                            52.0    3e-06   
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g           52.8    4e-06   
gb|EEC84839.1|  hypothetical protein OsI_31939                        52.4    5e-06   
ref|NP_001063595.1|  Os09g0504000                                     52.4    6e-06   
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         52.0    7e-06   
gb|EMS48913.1|  UDP-glucuronate 4-epimerase 2                         51.2    9e-06   
ref|XP_010113442.1|  UDP-glucuronate 4-epimerase 3                    51.2    9e-06   
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938            47.8    2e-04   
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183            47.4    2e-04   
ref|NP_001057015.1|  Os06g0187200                                     47.0    3e-04   
gb|EAY99954.1|  hypothetical protein OsI_21957                        47.4    3e-04   
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...  47.4    3e-04   
gb|EAZ36080.1|  hypothetical protein OsJ_20391                        47.0    4e-04   



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  KGPA LRV NLGN  PV VR LV+I ENLL IK KKNVVK PR
Sbjct  335  VGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVRKLVVILENLLNIKAKKNVVKMPR  394

Query  17   NGDVP  3
            NGDVP
Sbjct  395  NGDVP  399



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 48/65 (74%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  KGPA LRV NLGN  PV VR LV I ENLL +K KKNVVK PR
Sbjct  335  VGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVRKLVSILENLLSVKAKKNVVKMPR  394

Query  17   NGDVP  3
            NGDVP
Sbjct  395  NGDVP  399



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/65 (69%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V+ LV I ENLL +K KKNV+K PR
Sbjct  334  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVSVKKLVAILENLLNLKAKKNVIKMPR  393

Query  17   NGDVP  3
            NGDVP
Sbjct  394  NGDVP  398



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD AEKS G GG  KGPA LRV NLGN  PV V  LV I ENLL +K KKNV+K PR
Sbjct  338  IGSLDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVNKLVTILENLLNVKAKKNVIKMPR  397

Query  17   NGDVP  3
            NGDVP
Sbjct  398  NGDVP  402



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V+ LV I E+LL +K KKNV+K PR
Sbjct  334  LGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPR  393

Query  17   NGDVP  3
            NGDVP
Sbjct  394  NGDVP  398



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V+ LV I E+LL +K KKNV+K PR
Sbjct  334  LGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPR  393

Query  17   NGDVP  3
            NGDVP
Sbjct  394  NGDVP  398



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GA+D AEKS G GG  +GPA LRV NLGN  PV V+ LV I ENLL IK KKN+++ PR
Sbjct  326  LGAIDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVSVKKLVAILENLLNIKAKKNLIRMPR  385

Query  17   NGDVP  3
            NGDVP
Sbjct  386  NGDVP  390



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 45/65 (69%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  KGPA LRV NLGN  PV V  LV I ENLL  K KK+V+K PR
Sbjct  282  VGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGKLVSILENLLNTKAKKHVIKMPR  341

Query  17   NGDVP  3
            NGDVP
Sbjct  342  NGDVP  346



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  KGPA LR+ NLGN  PV V  LV I ENLL  K KK+++K PR
Sbjct  330  VGALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPR  389

Query  17   NGDVP  3
            NGDVP
Sbjct  390  NGDVP  394



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  KGPA LR+ NLGN  PV V  LV I ENLL  K KK+++K PR
Sbjct  330  VGALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPR  389

Query  17   NGDVP  3
            NGDVP
Sbjct  390  NGDVP  394



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GA+D AEKS G GG  +GPA LRV NLGN  PV V+ LV I ENLL IK KKN+++ P+
Sbjct  327  LGAIDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVSVKKLVAILENLLNIKAKKNLIRMPQ  386

Query  17   NGDVP  3
            NGDVP
Sbjct  387  NGDVP  391



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V+ LV I ENLL +K KK  +K PR
Sbjct  338  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVSVKKLVAILENLLNLKAKKFFIKMPR  397

Query  17   NGDVP  3
            NGDVP
Sbjct  398  NGDVP  402



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LR+ NLGN  PV V  LV I ENLL  K KK+++K PR
Sbjct  330  VGALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPR  389

Query  17   NGDVP  3
            NGDVP
Sbjct  390  NGDVP  394



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  KGPA LR+ NLGN  PV V  LV I ENLL  K KK+V+K PR
Sbjct  330  VGALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVTILENLLTTKAKKHVIKMPR  389

Query  17   NGDVP  3
            NGDVP
Sbjct  390  NGDVP  394



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+NV+K PR
Sbjct  327  LGSLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPR  386

Query  17   NGDVP  3
            NGDVP
Sbjct  387  NGDVP  391



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E+LL  K KK+++K PR
Sbjct  338  VGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGKLVAILESLLNTKAKKHIIKMPR  397

Query  17   NGDVP  3
            NGDVP
Sbjct  398  NGDVP  402



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  323  LGSLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNIMKLPR  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL  K KK+V+K PR
Sbjct  336  LGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVANLVSILEGLLSTKAKKHVIKMPR  395

Query  17   NGDVP  3
            NGDVP
Sbjct  396  NGDVP  400



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  336  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  395

Query  17   NGDVP  3
            NGDVP
Sbjct  396  NGDVP  400



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  + PA LRV NLGN  PV V  LV I E LL +K KK+V+K PR
Sbjct  333  VGALDTAEKSTGSGGKKRAPAQLRVYNLGNTSPVSVGKLVSILEGLLNVKAKKHVIKMPR  392

Query  17   NGDVP  3
            NGDVP
Sbjct  393  NGDVP  397



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  339  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  398

Query  17   NGDVP  3
            NGDVP
Sbjct  399  NGDVP  403



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  337  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  396

Query  17   NGDVP  3
            NGDVP
Sbjct  397  NGDVP  401



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  339  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  398

Query  17   NGDVP  3
            NGDVP
Sbjct  399  NGDVP  403



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LR+ NLGN  PV V  LV I E LL +K KK+V+K PR
Sbjct  330  LGALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPR  389

Query  17   NGDVP  3
            NGDVP
Sbjct  390  NGDVP  394



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  339  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  398

Query  17   NGDVP  3
            NGDVP
Sbjct  399  NGDVP  403



>ref|XP_002511693.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF50362.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=152

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  42   LGALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPR  101

Query  17   NGDV  6
            NGDV
Sbjct  102  NGDV  105



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LR+ NLGN  PV V  LV I E LL +K KK+V+K PR
Sbjct  330  LGALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPR  389

Query  17   NGDVP  3
            NGDVP
Sbjct  390  NGDVP  394



>emb|CDY67756.1| BnaA03g56770D [Brassica napus]
Length=435

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E  L +K KKNV+K PR
Sbjct  326  LGALDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPR  385

Query  17   NGDVP  3
            NGDVP
Sbjct  386  NGDVP  390



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL +K K+NV+K PR
Sbjct  319  LGALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVTELVSILERLLKVKAKRNVMKMPR  378

Query  17   NGDV  6
            NGDV
Sbjct  379  NGDV  382



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  + PA LRV NLGN  PV V  LV I E+LL +K KK+V+K PR
Sbjct  339  LGALDTAEKSTGSGGKKRAPAQLRVYNLGNTAPVTVGKLVGILESLLNVKAKKHVIKMPR  398

Query  17   NGDVP  3
            NGDVP
Sbjct  399  NGDVP  403



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 44/65 (68%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL  K KK+V+K PR
Sbjct  340  VGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGKLVGILEGLLGTKAKKHVIKMPR  399

Query  17   NGDVP  3
            NGDVP
Sbjct  400  NGDVP  404



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL  K KK+V+K PR
Sbjct  335  LGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGNLVSILEGLLSTKAKKHVIKMPR  394

Query  17   NGDVP  3
            NGDVP
Sbjct  395  NGDVP  399



>ref|XP_009133725.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Brassica rapa]
Length=435

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E  L +K KKNV+K PR
Sbjct  326  LGALDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPR  385

Query  17   NGDVP  3
            NGDVP
Sbjct  386  NGDVP  390



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL  K +K+V+K PR
Sbjct  335  LGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGKLVSILEGLLRTKARKHVIKMPR  394

Query  17   NGDVP  3
            NGDVP
Sbjct  395  NGDVP  399



>ref|XP_006837081.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
 gb|ERM99934.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
Length=434

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD AEKS G GG  +GPA LR+ NLGN  PV V+ LV I E LL +K KK ++K PR
Sbjct  325  LGSLDTAEKSTGTGGKKRGPAQLRIFNLGNTSPVPVKDLVSILERLLKVKAKKTIIKMPR  384

Query  17   NGDVP  3
            NGDVP
Sbjct  385  NGDVP  389



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  344  VGALDTAEKSTGSGGKKRGPAMLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  403

Query  17   NGDVP  3
            NGDVP
Sbjct  404  NGDVP  408



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LR+ NLGN  PV V  LV I E  L +K KKNVVK PR
Sbjct  333  LGALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVSVGKLVSILEGHLSMKAKKNVVKMPR  392

Query  17   NGDVP  3
            NGDVP
Sbjct  393  NGDVP  397



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD A KS G GG  +GPA LRV NLGN  PV V  LV I ENLL  K KK+V++ PR
Sbjct  350  VGALDTAGKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPR  409

Query  17   NGDVP  3
            NGDVP
Sbjct  410  NGDVP  414



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  323  LGSLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRKIMKLPR  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>emb|CDX95646.1| BnaC03g25270D [Brassica napus]
Length=435

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E  L +K K+NV+K PR
Sbjct  326  LGALDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPR  385

Query  17   NGDVP  3
            NGDVP
Sbjct  386  NGDVP  390



>ref|XP_006386474.1| hypothetical protein POPTR_0002s11750g [Populus trichocarpa]
 gb|ERP64271.1| hypothetical protein POPTR_0002s11750g [Populus trichocarpa]
Length=193

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD AEKS G GG  KGPA LRV NLGN   V V  LV I E LL +K K+NV+K PR
Sbjct  85   LGSLDTAEKSTGSGGKKKGPAQLRVFNLGNTSSVPVTDLVSILERLLKVKAKRNVMKFPR  144

Query  17   NGDVP  3
            NGDVP
Sbjct  145  NGDVP  149



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LR+ NLGN  PV V  LV I E LL  K KK+V+K PR
Sbjct  337  LGALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILEGLLGTKAKKHVIKMPR  396

Query  17   NGDVP  3
            NGDVP
Sbjct  397  NGDVP  401



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD AEKS G GG  K PA LRV NLGN  PV V  LV I E LL +K K+NV+K PR
Sbjct  327  LGSLDTAEKSTGSGGKKKRPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPR  386

Query  17   NGDVP  3
            NGDVP
Sbjct  387  NGDVP  391



>ref|XP_010506473.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=442

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD AEKS G GG  +GPA LRV NLGN  PV V  LV I E  L +K KKNV+K PR
Sbjct  331  LASLDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPR  390

Query  17   NGDVP  3
            NGDVP
Sbjct  391  NGDVP  395



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL +K KK+++  PR
Sbjct  333  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVARLVSILEGLLNVKAKKHLITMPR  392

Query  17   NGDVP  3
            NGDVP
Sbjct  393  NGDVP  397



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LR+ NLGN  PV V  LV I E+LL  K KK+V++ PR
Sbjct  336  LGALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGKLVGILESLLTTKAKKHVIRMPR  395

Query  17   NGDVP  3
            NGDVP
Sbjct  396  NGDVP  400



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LR+ NLGN  PV V  LV I ENLL  K K++V+K P 
Sbjct  323  LGALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPS  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>ref|XP_010506472.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Camelina sativa]
Length=444

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD AEKS G GG  +GPA LRV NLGN  PV V  LV I E  L +K KKNV+K PR
Sbjct  333  LASLDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPR  392

Query  17   NGDVP  3
            NGDVP
Sbjct  393  NGDVP  397



>emb|CDY63064.1| BnaAnng18570D [Brassica napus]
Length=430

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N+VK PR
Sbjct  322  LGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPR  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  343  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPR  402

Query  17   NGDVP  3
            NGDVP
Sbjct  403  NGDVP  407



>gb|KHN25558.1| UDP-glucuronate 4-epimerase 3 [Glycine soja]
Length=261

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LR+ NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  153  LGALDTAEKSTGSGGKKRGPAQLRIFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPR  212

Query  17   NGDV  6
            NGDV
Sbjct  213  NGDV  216



>ref|XP_009111519.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica rapa]
Length=430

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N+VK PR
Sbjct  322  LGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPR  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  343  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPR  402

Query  17   NGDVP  3
            NGDVP
Sbjct  403  NGDVP  407



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LR+ NLGN  PV V  LV I E LL +  KKN++K PR
Sbjct  332  LGALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVSVGKLVSILEGLLNVNAKKNILKMPR  391

Query  17   NGDVP  3
            NGDVP
Sbjct  392  NGDVP  396



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  343  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPR  402

Query  17   NGDVP  3
            NGDVP
Sbjct  403  NGDVP  407



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LR+ NLGN  PV V  LV + ENLL  K KK+++  PR
Sbjct  341  LGALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPR  400

Query  17   NGDVP  3
            NGDVP
Sbjct  401  NGDVP  405



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LR+ NLGN  PV V  LV I E LL  K KK+V+K PR
Sbjct  339  LGALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGRLVSILEALLNSKAKKHVIKMPR  398

Query  17   NGDVP  3
            NGDVP
Sbjct  399  NGDVP  403



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LR+ NLGN  PV V  LV + ENLL  K KK+++  PR
Sbjct  341  LGALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPR  400

Query  17   NGDVP  3
            NGDVP
Sbjct  401  NGDVP  405



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LR+ NLGN  PV V  LV I E LL  K KK+V+K PR
Sbjct  341  LGALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPR  400

Query  17   NGDVP  3
            NGDVP
Sbjct  401  NGDVP  405



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  327  LASLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVTILERLLKVKAKRNIMKLPR  386

Query  17   NGDVP  3
            NGDVP
Sbjct  387  NGDVP  391



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K KK+V+K PR
Sbjct  343  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVGILEGLLGTKAKKHVIKMPR  402

Query  17   NGDVP  3
            NGDVP
Sbjct  403  NGDVP  407



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K +K+++K PR
Sbjct  341  VGALDTAEKSTGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKARKHLIKMPR  400

Query  17   NGDVP  3
            NGDVP
Sbjct  401  NGDVP  405



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL  K KK+VV  PR
Sbjct  336  LGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGRLVSILEGLLNTKAKKHVVTLPR  395

Query  17   NGDVP  3
            NGDVP
Sbjct  396  NGDVP  400



>ref|XP_006397710.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
 gb|ESQ39163.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
Length=435

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E  L +K K+NV+K PR
Sbjct  326  LAALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPR  385

Query  17   NGDVP  3
            NGDVP
Sbjct  386  NGDVP  390



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ V+K PR
Sbjct  327  LGALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVTILERLLKVKAKRAVMKLPR  386

Query  17   NGDV  6
            NGDV
Sbjct  387  NGDV  390



>ref|NP_182056.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
 sp|O22141.1|GAE4_ARATH RecName: Full=UDP-glucuronate 4-epimerase 4; AltName: Full=UDP-glucuronic 
acid epimerase 4; Short=AtUGlcAE1 [Arabidopsis 
thaliana]
 gb|AAB82632.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO42241.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO64072.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAT06796.1| UDP-glucuronic acid epimerase 1 [Arabidopsis thaliana]
 gb|AEC10537.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
Length=437

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E  L +K KKN++K PR
Sbjct  328  LAALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPR  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LR+ NLGN  PV V  LV I ENLL  K K++V+K P 
Sbjct  323  LGALDTAEKSTGSGGKKRGPAQLRIYNLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPS  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>ref|XP_001761086.1| predicted protein [Physcomitrella patens]
 gb|EDQ74153.1| predicted protein [Physcomitrella patens]
Length=450

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG   GPA LRV NLGN  PV V  LV I E  L  K K+N++K PR
Sbjct  333  VGALDTAEKSTGSGGKKTGPAQLRVFNLGNTSPVTVPTLVDILEKYLKQKAKRNIIKMPR  392

Query  17   NGDVP  3
            NGDVP
Sbjct  393  NGDVP  397



>ref|XP_002880171.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56430.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E  L +K KKN++K PR
Sbjct  328  LAALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPR  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL  K KK+VV  PR
Sbjct  292  LGALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVGRLVSILEGLLNTKAKKHVVTLPR  351

Query  17   NGDVP  3
            NGDVP
Sbjct  352  NGDVP  356



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA  R+ NLGN  PV V  LV I ENLL  K K++V+K P 
Sbjct  323  LGALDTAEKSTGSGGKKRGPAQFRIYNLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPS  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>dbj|BAF00333.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=292

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  181  LGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPR  240

Query  17   NGDVP  3
            NGDVP
Sbjct  241  NGDVP  245



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A+KS G GG  KGPA LR+ NLGN  PV V  LV I E LL  K KK+V+K PR
Sbjct  341  LGALDTAQKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPR  400

Query  17   NGDVP  3
            NGDVP
Sbjct  401  NGDVP  405



>ref|XP_006295696.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
 gb|EOA28594.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
Length=436

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD AEKS G GG  +GPA LRV NLGN  PV V  LV I E  L +K KKN++K PR
Sbjct  327  LASLDTAEKSTGTGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERQLKVKAKKNLIKMPR  386

Query  17   NGDVP  3
            NGDVP
Sbjct  387  NGDVP  391



>ref|XP_010508183.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=443

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD AEKS G GG  +GPA LRV NLGN  PV V  LV I E  L +K KKN++K PR
Sbjct  332  LASLDTAEKSTGTGGKKRGPAMLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPR  391

Query  17   NGDVP  3
            NGDVP
Sbjct  392  NGDVP  396



>ref|XP_010426564.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
 ref|XP_010456322.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
Length=428

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  320  LGALDTAEKSTGTGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPR  379

Query  17   NGDVP  3
            NGDVP
Sbjct  380  NGDVP  384



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  308  LGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPR  367

Query  17   NGDVP  3
            NGDVP
Sbjct  368  NGDVP  372



>gb|KFK42571.1| hypothetical protein AALP_AA1G012900 [Arabis alpina]
Length=436

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K KKN++K PR
Sbjct  328  LGALDTAEKSTGSGGKKRGQAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPR  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  324  LAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRNIMKLPR  383

Query  17   NGDV  6
            NGDV
Sbjct  384  NGDV  387



>ref|XP_010419541.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Camelina sativa]
Length=428

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  320  LGALDTAEKSTGTGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPR  379

Query  17   NGDVP  3
            NGDVP
Sbjct  380  NGDVP  384



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K KKN++K PR
Sbjct  324  LGALDTAEKSTGSGGKKRGQAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPR  383

Query  17   NGDVP  3
            NGDVP
Sbjct  384  NGDVP  388



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  323  LGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPR  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G  G  KGPA LRV NLGN  PV V  LV I E LL  K +K+V+K PR
Sbjct  335  LGALDTAEKSTGSSGKKKGPAQLRVYNLGNTSPVPVGKLVSILEGLLSTKARKHVIKMPR  394

Query  17   NGDVP  3
            NGDVP
Sbjct  395  NGDVP  399



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G G   +GPA LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  338  VGALDTAEKSTGSGRKKRGPAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  397

Query  17   NGDVP  3
            NGDVP
Sbjct  398  NGDVP  402



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  327  LGALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVTILERLLKVKAKRALMKLPR  386

Query  17   NGDV  6
            NGDV
Sbjct  387  NGDV  390



>emb|CAN73017.1| hypothetical protein VITISV_004389 [Vitis vinifera]
Length=149

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD AEKS G GG  KGPA LR+ NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  42   VAALDTAEKSTGSGGKKKGPAQLRIFNLGNTSPVPVTDLVSILERLLKVKAKRKMIKMPR  101

Query  17   NGDV  6
            NGDV
Sbjct  102  NGDV  105



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  330  LAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPR  389

Query  17   NGDV  6
            NGDV
Sbjct  390  NGDV  393



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  324  LAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPR  383

Query  17   NGDV  6
            NGDV
Sbjct  384  NGDV  387



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A+KS G GG  KGPA LRV NLGN  PV V  LV I E LL  K KK+V+K P 
Sbjct  347  LGALDTAQKSTGSGGKKKGPAQLRVYNLGNTSPVPVGTLVSILEGLLSTKAKKHVIKMPS  406

Query  17   NGDVP  3
            NGDVP
Sbjct  407  NGDVP  411



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LR+ NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  330  LGALDTAEKSTGSGGKKRGPAQLRIFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPR  389

Query  17   NGDV  6
            NGDV
Sbjct  390  NGDV  393



>ref|XP_010544649.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Tarenaya hassleriana]
Length=436

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G  G  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  325  LAALDTAEKSTGSRGKKKGPAQLRVFNLGNTSPVPVSDLVGILERLLKVKAKRNIMKMPR  384

Query  17   NGDVP  3
            NGDVP
Sbjct  385  NGDVP  389



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 42/64 (66%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL  K K+NV+K PR
Sbjct  332  LGALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKTKAKRNVMKLPR  391

Query  17   NGDV  6
            NGDV
Sbjct  392  NGDV  395



>emb|CAN83831.1| hypothetical protein VITISV_003974 [Vitis vinifera]
Length=150

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  42   VAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVNILERLLKVKAKRKMIKMPR  101

Query  17   NGDV  6
            NGDV
Sbjct  102  NGDV  105



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  345  VGALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  404

Query  17   NGDVP  3
            NGDVP
Sbjct  405  NGDVP  409



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD A KS G  G  +GPA LRV NLGN  PV V  LV I ENLL  K KK+V++ PR
Sbjct  350  VGALDTAGKSTGSRGKKRGPAQLRVYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPR  409

Query  17   NGDVP  3
            NGDVP
Sbjct  410  NGDVP  414



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N +K PR
Sbjct  318  LGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNTMKLPR  377

Query  17   NGDVP  3
            NGDVP
Sbjct  378  NGDVP  382



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  343  VGALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  402

Query  17   NGDVP  3
            NGDVP
Sbjct  403  NGDVP  407



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  325  VAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVNILERLLKVKAKRKMIKMPR  384

Query  17   NGDV  6
            NGDV
Sbjct  385  NGDV  388



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  343  VGALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  402

Query  17   NGDVP  3
            NGDVP
Sbjct  403  NGDVP  407



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A++S G GG  +GPA LRV NLGN  PV V+ LV I E LL +  KKNVV+ P 
Sbjct  326  IGALDTAQRSTGSGGRKRGPAQLRVYNLGNTSPVTVKGLVGILEGLLGLTAKKNVVRMPG  385

Query  17   NGDVP  3
            NGDVP
Sbjct  386  NGDVP  390



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  345  VGALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  404

Query  17   NGDVP  3
            NGDVP
Sbjct  405  NGDVP  409



>ref|XP_009781927.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=408

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KG A LRV NLGN  PV V  LV I E LL +K KKNV+  PR
Sbjct  298  LGALDTAEKSTGSGGKKKGNAQLRVFNLGNTSPVPVTKLVSILEKLLKVKAKKNVLPLPR  357

Query  17   NGDV  6
            NGDV
Sbjct  358  NGDV  361



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  344  VGALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  403

Query  17   NGDVP  3
            NGDVP
Sbjct  404  NGDVP  408



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A+KS G GG  KGPA LRV NLGN  PV V  LV I E+LL +K K+ V+K PR
Sbjct  341  LGALDTAQKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILESLLKVKAKRTVMKLPR  400

Query  17   NGDV  6
            NGDV
Sbjct  401  NGDV  404



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  324  LASLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPR  383

Query  17   NGDV  6
            NGDV
Sbjct  384  NGDV  387



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N+++ PR
Sbjct  328  LAALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILERLLKLKAKRNILRLPR  387

Query  17   NGDV  6
            NGDV
Sbjct  388  NGDV  391



>ref|XP_009614886.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=434

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K++V+K PR
Sbjct  328  LAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPR  387

Query  17   NGDV  6
            NGDV
Sbjct  388  NGDV  391



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  325  VAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPR  384

Query  17   NGDV  6
            NGDV
Sbjct  385  NGDV  388



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  330  LGALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPR  389

Query  17   NGDV  6
            NGDV
Sbjct  390  NGDV  393



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD AEKS G GG  KGPA LR+ NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  319  VAALDTAEKSTGSGGKKKGPAQLRIFNLGNTSPVPVTDLVSILERLLKVKAKRKMIKMPR  378

Query  17   NGDV  6
            NGDV
Sbjct  379  NGDV  382



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL  K KK+++K PR
Sbjct  345  VGALDTAEKSTGSGGKKRGQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPR  404

Query  17   NGDVP  3
            NGDVP
Sbjct  405  NGDVP  409



>emb|CAN73016.1| hypothetical protein VITISV_004388 [Vitis vinifera]
Length=427

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  319  VAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPR  378

Query  17   NGDV  6
            NGDV
Sbjct  379  NGDV  382



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K++++K PR
Sbjct  337  LAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRHIMKLPR  396

Query  17   NGDV  6
            NGDV
Sbjct  397  NGDV  400



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL IK K+N++K PR
Sbjct  324  LGALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVGILERLLKIKAKRNIMKLPR  383

Query  17   NGDV  6
            NGDV
Sbjct  384  NGDV  387



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +GPA LRV NLGN  PV V  LV I E LL  K K+N++K PR
Sbjct  332  LGALDTAEKSTGSGGKKRGPAQLRVFNLGNTSPVPVSDLVGILERLLKTKAKRNIMKLPR  391

Query  17   NGDV  6
            NGDV
Sbjct  392  NGDV  395



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  327  LAALDTAEKSTGTGGKKKGPAQLRVYNLGNTSPVPVSTLVSILERLLKVKVKRNIMKLPR  386

Query  17   NGDV  6
            NGDV
Sbjct  387  NGDV  390



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+NV+K PR
Sbjct  313  LGALDTAEKSTGSGGKKRGTAQLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKMPR  372

Query  17   NGDV  6
            NGDV
Sbjct  373  NGDV  376



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  + PA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  329  LGALDTAEKSTGSGGKKRRPAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPR  388

Query  17   NGDV  6
            NGDV
Sbjct  389  NGDV  392



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  329  LAALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILERLLKVKAKRTIMKLPR  388

Query  17   NGDV  6
            NGDV
Sbjct  389  NGDV  392



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  323  LGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTELVSILERLLKVKAKRNMMKLPR  382

Query  17   NGDV  6
            NGDV
Sbjct  383  NGDV  386



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  322  LGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPR  381

Query  17   NGDV  6
            NGDV
Sbjct  382  NGDV  385



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL  K K+N++K PR
Sbjct  326  LAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVSILERLLKAKAKRNIMKLPR  385

Query  17   NGDV  6
            NGDV
Sbjct  386  NGDV  389



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  321  LGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPR  380

Query  17   NGDV  6
            NGDV
Sbjct  381  NGDV  384



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD A+KS G GG  KGPA LR+ NLGN  PV V  LV I E LL +K KKN++  P 
Sbjct  328  VAALDTAKKSTGSGGKKKGPAQLRIYNLGNTSPVSVPDLVNILERLLKVKAKKNIISMPS  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  330  LASLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVMDLVTILERLLKVKAKRNIMKLPR  389

Query  17   NGDV  6
            NGDV
Sbjct  390  NGDV  393



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  330  LASLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPR  389

Query  17   NGDV  6
            NGDV
Sbjct  390  NGDV  393



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G G   KGPA LR+ NLGN  PV V  LV I E LL +K KKNV++ P 
Sbjct  321  VGALDTAEKSTGSGEKKKGPAQLRIYNLGNTSPVSVPELVRILEELLKVKAKKNVLRMPS  380

Query  17   NGDVP  3
            NGDVP
Sbjct  381  NGDVP  385



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KG A LRV NLGN  PV V  LV I E LL  K KK+V+  PR
Sbjct  337  LGALDTAEKSTGSGGKKKGAAQLRVYNLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPR  396

Query  17   NGDVP  3
            NGDVP
Sbjct  397  NGDVP  401



>gb|KJB09908.1| hypothetical protein B456_001G174300 [Gossypium raimondii]
Length=437

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +  K+N++K PR
Sbjct  329  LAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPR  388

Query  17   NGDV  6
            NGDV
Sbjct  389  NGDV  392



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A KS G GG  KGPA LRV NLGN  PV V  LV I E LL  K KK+V+  PR
Sbjct  336  LGALDTAGKSTGSGGKKKGPAQLRVYNLGNTSPVPVGRLVSILEGLLNTKAKKHVITMPR  395

Query  17   NGDVP  3
            NGDVP
Sbjct  396  NGDVP  400



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +  K+N++K PR
Sbjct  329  LAALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPR  388

Query  17   NGDV  6
            NGDV
Sbjct  389  NGDV  392



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A KS G GG  +GPA LRV NLGN  PV V  +V I E LL  K KKNVV  PR
Sbjct  335  LGALDTAGKSTGTGGKKRGPAQLRVYNLGNTSPVPVGKMVAILEELLGKKAKKNVVTMPR  394

Query  17   NGDVP  3
            NGDVP
Sbjct  395  NGDVP  399



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A+KS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  327  LGALDTAKKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPR  386

Query  17   NGDV  6
            NGDV
Sbjct  387  NGDV  390



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  +G A LRV NLGN  PV V  LV I E LL +K K+N++K PR
Sbjct  331  LAALDTAEKSTGSGGKKRGRAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPR  390

Query  17   NGDVP  3
            NGDVP
Sbjct  391  NGDVP  395



>ref|XP_009621323.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=408

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KG A LRV NLGN  PV V  LV + E LL +K +KNV+  PR
Sbjct  298  LGALDTAEKSTGSGGKKKGNAQLRVFNLGNTSPVPVTKLVSLLEKLLKVKARKNVLPLPR  357

Query  17   NGDV  6
            NGDV
Sbjct  358  NGDV  361



>gb|EYU31982.1| hypothetical protein MIMGU_mgv1a012102mg [Erythranthe guttata]
Length=261

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KG A LRV NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  153  LGALDTAEKSTGSGGKKKGAAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRLIMKLPR  212

Query  17   NGDV  6
            NGDV
Sbjct  213  NGDV  216



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A+KS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ ++K PR
Sbjct  327  LGALDTAKKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPR  386

Query  17   NGDV  6
            NGDV
Sbjct  387  NGDV  390



>ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=436

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD  EKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K++V+K PR
Sbjct  328  LAALDTGEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPR  387

Query  17   NGDV  6
            NGDV
Sbjct  388  NGDV  391



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD AEKS G GG  +G A LRV NLGN  PV V  LV I E  L +K K+N++K PR
Sbjct  327  VGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVSELVSILERHLKVKAKRNIMKLPR  386

Query  17   NGDV  6
            NGDV
Sbjct  387  NGDV  390



>ref|XP_004306933.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Fragaria vesca subsp. 
vesca]
Length=434

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K++++K PR
Sbjct  326  LASLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVTILERLLKVKAKRSILKLPR  385

Query  17   NGDV  6
            NGDV
Sbjct  386  NGDV  389



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  GALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPRN  15
            GALD A  S G GG  +GPA LRV NLGN  PV V  LV I E  L +K K+NVV+ PRN
Sbjct  338  GALDTATPSTGTGGKKRGPAQLRVYNLGNTSPVTVPTLVAILEKHLKVKAKRNVVRMPRN  397

Query  14   GDVP  3
            GDVP
Sbjct  398  GDVP  401



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  194  GALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPRN  15
            GALD A  S G GG  +GPA LRV NLGN  PV V  LV I E  L +K K+NVV+ PRN
Sbjct  338  GALDTATPSTGTGGKKRGPAQLRVYNLGNTSPVTVPTLVAILEKHLKVKAKRNVVRMPRN  397

Query  14   GDVP  3
            GDVP
Sbjct  398  GDVP  401



>ref|XP_011093361.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=434

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ V+K PR
Sbjct  326  LAALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPR  385

Query  17   NGDV  6
            NGDV
Sbjct  386  NGDV  389



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KG A LRV NLGN  PV V  LV I E LL +K K+ V+K PR
Sbjct  327  LAALDTAEKSTGSGGKKKGAAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPR  386

Query  17   NGDVP  3
            NGDVP
Sbjct  387  NGDVP  391



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ V+K PR
Sbjct  327  LAALDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPR  386

Query  17   NGDV  6
            NGDV
Sbjct  387  NGDV  390



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A  S G GG  +GPA LRV NLGN  PV V  LV I E  L +K KKN VK PR
Sbjct  327  LGALDTALLSTGTGGKKRGPAQLRVYNLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPR  386

Query  17   NGDVP  3
            NGDVP
Sbjct  387  NGDVP  391



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/66 (61%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -2

Query  197  VGALDPAEKSPG-XGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXP  21
            +GALD AEKS G   G  +GPA LRV NLGN  PV V  LV + E LL +K KK+V+K P
Sbjct  377  LGALDTAEKSTGGVVGKKRGPAQLRVYNLGNTSPVPVGKLVSVLETLLGVKAKKHVIKMP  436

Query  20   RNGDVP  3
            RNGDVP
Sbjct  437  RNGDVP  442



>ref|XP_010540291.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Tarenaya hassleriana]
Length=393

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  +G A LRV NLGN  PV V  LV I E  L +K K+NV+K PR
Sbjct  285  LGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVSELVSILERHLKVKAKRNVMKLPR  344

Query  17   NGDV  6
            NGDV
Sbjct  345  NGDV  348



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD A+KS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ V+K PR
Sbjct  327  VGALDTAKKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPR  386

Query  17   NGDV  6
            NGDV
Sbjct  387  NGDV  390



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A+KS G GG  K PA LRV NLGN  PV V  LV I E+LL  K K++V+  PR
Sbjct  333  LGALDTAQKSTGSGGRKKAPAQLRVYNLGNTSPVPVGRLVGILESLLGTKAKRHVITMPR  392

Query  17   NGDVP  3
            NGDVP
Sbjct  393  NGDVP  397



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AE+S G GG  +GPA LRV NLGN  PV V  +V I E LL  K KK+VV  P+
Sbjct  337  LGALDTAERSTGSGGKKRGPAQLRVYNLGNTSPVPVAKMVGILEELLGKKAKKHVVTLPQ  396

Query  17   NGDVP  3
            NGDVP
Sbjct  397  NGDVP  401



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A  S G GG  +GPA LRV NLGN  PV V  LV I E  L +K KKN VK PR
Sbjct  332  LGALDTALLSTGTGGKKRGPAQLRVYNLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPR  391

Query  17   NGDVP  3
            NGDVP
Sbjct  392  NGDVP  396



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ + K PR
Sbjct  330  LASLDTAEKSTGSGGKKKGPAQLRVFNLGNTSPVPVTDLVTILERLLKVKAKRKITKLPR  389

Query  17   NGDV  6
            NGDV
Sbjct  390  NGDV  393



>ref|XP_001751991.1| predicted protein [Physcomitrella patens]
 gb|EDQ83426.1| predicted protein [Physcomitrella patens]
Length=446

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD AEKS G GG   GPA LRV NLGN  PV V  LV I E  L +K K+  +K PR
Sbjct  329  VASLDTAEKSTGSGGKKSGPAMLRVFNLGNTSPVTVPTLVDILEKYLKVKAKRETIKMPR  388

Query  17   NGDVP  3
            NGDVP
Sbjct  389  NGDVP  393



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +  K++++K PR
Sbjct  329  LAALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILERLLKVNAKRDIMKLPR  388

Query  17   NGDV  6
            NGDV
Sbjct  389  NGDV  392



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A KS G GG  +GPA LRV NLGN  PV V  +V I E LL  K KKNVV  P 
Sbjct  333  LGALDTAGKSTGSGGKKRGPAQLRVYNLGNKSPVPVSKMVAILEELLGKKAKKNVVTMPM  392

Query  17   NGDVP  3
            NGDVP
Sbjct  393  NGDVP  397



>ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
 ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=432

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL  K K+ V+K PR
Sbjct  324  LAALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVSILERLLKTKAKRLVMKLPR  383

Query  17   NGDV  6
            NGDV
Sbjct  384  NGDV  387



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KG A LRV NLGN  PV V  LV I E LL +K K+ V+K PR
Sbjct  327  LAALDTAEKSTGSGGKKKGAAQLRVFNLGNTSPVPVSDLVGILERLLKVKAKRLVMKLPR  386

Query  17   NGDVP  3
            NGDVP
Sbjct  387  NGDVP  391



>ref|XP_007209167.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
 gb|EMJ10366.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
Length=425

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD A+KS G GG  KGPA LR+ NLGN  PV V  LV I E LL +K K+ V+  PR
Sbjct  316  VAALDTAKKSTGSGGKKKGPAQLRIFNLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPR  375

Query  17   NGDV  6
            NGDV
Sbjct  376  NGDV  379



>ref|XP_001754001.1| predicted protein [Physcomitrella patens]
 gb|EDQ81323.1| predicted protein [Physcomitrella patens]
Length=446

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD AEKS G GG   GPA LRV NLGN  PV V  LV I E  L +K K+ ++  PR
Sbjct  329  VASLDTAEKSTGSGGKKTGPAMLRVFNLGNTSPVTVPALVDILEKYLNVKAKREIINMPR  388

Query  17   NGDVP  3
            NGDVP
Sbjct  389  NGDVP  393



>ref|XP_006365249.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum tuberosum]
Length=406

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  K  A LRV NLGN  PV V  LV I E LL +K K+NV+  PR
Sbjct  298  LGALDTAEKSTGSGGKKKKNAQLRVFNLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPR  357

Query  17   NGDV  6
            NGDV
Sbjct  358  NGDV  361



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G G   KG A LRV NLGN  PV V  LV I E LL  K KK+V+  PR
Sbjct  337  LGALDTAEKSTGSGEKKKGAAQLRVYNLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPR  396

Query  17   NGDVP  3
            NGDVP
Sbjct  397  NGDVP  401



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA  RV NLGN  PV V  LV I E LL +  K+NV+K P+
Sbjct  325  LAALDTAEKSTGSGGKKKGPAQFRVYNLGNTSPVPVSDLVSILERLLKVDAKRNVMKLPQ  384

Query  17   NGDV  6
            NGDV
Sbjct  385  NGDV  388



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = -2

Query  197  VGALDPAEKSPGX-GGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXP  21
            +GALD A+KS G  GG   GPA LRV NLGN  PV V  +V I E LL  K KKNVV  P
Sbjct  333  LGALDTAQKSTGSRGGKKHGPAQLRVYNLGNTSPVSVGKMVAILEELLGKKAKKNVVTMP  392

Query  20   RNGDVP  3
            RNGDVP
Sbjct  393  RNGDVP  398



>gb|EYU30554.1| hypothetical protein MIMGU_mgv1a006591mg [Erythranthe guttata]
Length=438

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KG A LRV NLGN  PV V  LV I E LL +K K+ V+K PR
Sbjct  330  LGALDTAEKSTGSGGKKKGVAQLRVFNLGNTSPVPVSDLVGILEKLLKVKAKRLVMKLPR  389

Query  17   NGDV  6
            NGDV
Sbjct  390  NGDV  393



>ref|XP_001777338.1| predicted protein [Physcomitrella patens]
 gb|EDQ57868.1| predicted protein [Physcomitrella patens]
Length=450

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  191  ALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPRNG  12
            ALD AEKS G GG   GPA LRV NLGN  PV V  LV I E  L  K  +N+VK PRNG
Sbjct  335  ALDTAEKSTGSGGKKTGPAQLRVFNLGNTSPVTVPILVDILEKHLKQKAIRNIVKMPRNG  394

Query  11   DVP  3
            DVP
Sbjct  395  DVP  397



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A+KS G GG  KGPA LRV NLGN  PV V  LV I E LL +K K+ V+K PR
Sbjct  327  LGALDTAKKSTGSGGKKKGPAQLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPR  386

Query  17   NGDV  6
            NGDV
Sbjct  387  NGDV  390



>ref|XP_008238641.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Prunus mume]
Length=434

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD A+KS G GG  KGPA LR+ NLGN  PV V  LV I E LL +K K+ V+  PR
Sbjct  325  VAALDTAKKSTGSGGKKKGPAQLRIFNLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPR  384

Query  17   NGDV  6
            NGDV
Sbjct  385  NGDV  388



>gb|EPS72617.1| hypothetical protein M569_02133, partial [Genlisea aurea]
Length=435

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 40/64 (63%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL  K  + V+K PR
Sbjct  324  VSALDTAEKSTGSGGKKKGPAQLRVYNLGNTSPVPVSDLVTILEKLLKKKANRMVMKLPR  383

Query  17   NGDV  6
            NGDV
Sbjct  384  NGDV  387



>gb|KGN57287.1| hypothetical protein Csa_3G176330 [Cucumis sativus]
Length=262

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KG A LRV NLGN  PV V  LV   E LL +K K+ V+  PR
Sbjct  153  LGALDTAEKSTGSGGRKKGKAQLRVFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPR  212

Query  17   NGDVP  3
            NGDVP
Sbjct  213  NGDVP  217



>ref|XP_010676680.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A+KS G GG  KGPA  R+ NLGN  PV V  LV I E LL +K  K V+  PR
Sbjct  340  LGALDTAKKSTGTGGKKKGPAQFRIFNLGNTSPVSVNQLVSILEKLLKVKSNKKVLPLPR  399

Query  17   NGDV  6
            NGDV
Sbjct  400  NGDV  403



>ref|XP_009390535.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD AEKS G GG  +GPA  R+ NLGN  PV V  LV I E+ L +K K+NVV+ P 
Sbjct  322  VASLDTAEKSTGTGGRKRGPAQYRIYNLGNTSPVTVPALVGILEHHLKMKAKRNVVEMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_001759693.1| predicted protein [Physcomitrella patens]
 gb|EDQ75605.1| predicted protein [Physcomitrella patens]
Length=441

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD AEKS G GG   GPA LRV NLGN  PV V  LV I E  L  K K+ ++K PR
Sbjct  324  VASLDTAEKSTGSGGKKTGPAMLRVFNLGNTSPVTVPTLVDILEKHLNTKAKRQIIKMPR  383

Query  17   NGDVP  3
            NGDVP
Sbjct  384  NGDVP  388



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD AEKS G GG  + PA  R+ NLGN  PV V  LV I E  L +K K+NVV+ P 
Sbjct  322  LGSLDTAEKSTGSGGKKRRPAQYRIYNLGNTSPVTVPTLVSILERYLKVKAKRNVVEMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = -2

Query  197  VGALDPAEKSPGX-GGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXP  21
            +GALD AEKS G  GG  +G A LRV NLGN  PV V  +V I E LL  K KKNVV  P
Sbjct  336  LGALDTAEKSTGSRGGKRRGAAQLRVYNLGNTSPVPVGKMVAILEELLGKKAKKNVVTMP  395

Query  20   RNGDVP  3
            RNGDVP
Sbjct  396  RNGDVP  401



>emb|CDY04398.1| BnaC02g28500D [Brassica napus]
Length=429

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA  R+ NLGN  PV V  LV I E LL +K K+ ++  PR
Sbjct  320  LGALDTAEKSTGSGGKKKGPAMFRIYNLGNTSPVPVSKLVTILEKLLKMKAKRKIMPLPR  379

Query  17   NGDV  6
            NGDV
Sbjct  380  NGDV  383



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD AEKS G GG  +GPA  R+ NLGN  PV V  LV I E  L  K K+NVV  P 
Sbjct  322  LGSLDTAEKSTGSGGKKRGPAQYRIYNLGNTSPVTVPMLVSILERHLKAKAKRNVVAMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_009128629.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Brassica rapa]
Length=429

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA  R+ NLGN  PV V  LV I E LL +K K+ ++  PR
Sbjct  320  LGALDTAEKSTGSGGKKKGPAMFRIYNLGNTSPVPVTKLVTILEKLLKMKAKRKIMPLPR  379

Query  17   NGDV  6
            NGDV
Sbjct  380  NGDV  383



>emb|CDX97356.1| BnaA02g21470D [Brassica napus]
Length=429

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA  R+ NLGN  PV V  LV I E LL +K K+ ++  PR
Sbjct  320  LGALDTAEKSTGSGGKKKGPAMFRIYNLGNTSPVPVTKLVTILEKLLKMKAKRKIMPLPR  379

Query  17   NGDV  6
            NGDV
Sbjct  380  NGDV  383



>ref|XP_004234942.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum lycopersicum]
Length=406

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  K  A LRV NLGN  PV V  LV I E LL +K K+NV+  P 
Sbjct  298  LGALDTAEKSTGSGGKKKKNAQLRVFNLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPT  357

Query  17   NGDV  6
            NGDV
Sbjct  358  NGDV  361



>ref|XP_001769370.1| predicted protein [Physcomitrella patens]
 gb|EDQ65739.1| predicted protein [Physcomitrella patens]
Length=450

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD A +S G GG  KGPA LR+ NLGN  PV V  LV + E  L +K  K  +K PR
Sbjct  338  VGALDTAGESTGSGGKKKGPAMLRLFNLGNTSPVTVPVLVELLEKHLKVKAVKQFIKMPR  397

Query  17   NGDVP  3
            NGDVP
Sbjct  398  NGDVP  402



>ref|XP_004171294.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KG A LRV NLGN  PV V  LV   E LL +K K+ V+  PR
Sbjct  299  LGALDTAEKSTGSGGRKKGKAQLRVFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPR  358

Query  17   NGDVP  3
            NGDVP
Sbjct  359  NGDVP  363



>ref|XP_011010511.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
 ref|XP_011014870.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
Length=431

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD + KSPG GG  +GPA  R+ NLGN  PV V  LV + E  L +K K+N V  P 
Sbjct  322  VGSLDTSGKSPGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSLLERHLKVKAKRNFVDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|NP_001049561.1| Os03g0249500 [Oryza sativa Japonica Group]
 gb|ABC59071.1| UDP-glucuronic acid 4-epimerase isoform 1 [Oryza sativa Japonica 
Group]
 gb|ABF94977.1| NAD dependent epimerase/dehydratase family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11475.1| Os03g0249500 [Oryza sativa Japonica Group]
 gb|EAZ26277.1| hypothetical protein OsJ_10146 [Oryza sativa Japonica Group]
 dbj|BAH00344.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VGALD A +S G GG  +GPA  R  NLGN  PV V  LV + E LL +K  + +VK PR
Sbjct  354  VGALDTAGRSTGSGGKKRGPAPFRTYNLGNTSPVPVTQLVDLLEKLLKVKAVRKIVKMPR  413

Query  17   NGDVP  3
            NGDVP
Sbjct  414  NGDVP  418



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KGPA LRV NLGN  PV V  LV I E LL +K  + ++K PR
Sbjct  329  LAALDTAEKSTGRGGKKKGPAQLRVFNLGNTSPVPVTELVSILERLLKVKANRLMLKMPR  388

Query  17   NGDV  6
            NGDV
Sbjct  389  NGDV  392



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD A+KS G GG  +GPA  R+ NLGN  P+ V  +V I E  L +K KKNV++ P 
Sbjct  323  VASLDTAKKSTGSGGKKRGPAQYRIFNLGNTSPITVPMMVGILEKHLKVKAKKNVIEMPG  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD A+KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+NV++ P 
Sbjct  322  LGSLDTAKKSTGSGGKKRGPAQYRIYNLGNTSPVTVPMLVSILERHLKVKAKRNVMEMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD A KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKNVV+ P 
Sbjct  328  LGSLDTAGKSTGTGGKKRGPAPYRIFNLGNTSPVTVPSLVSILEKHLRVKAKKNVVEMPG  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+N+V  P 
Sbjct  322  VGSLDTSAKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD A KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKNVV+ P 
Sbjct  328  LGSLDTAGKSTGTGGKKRGPAPYRIFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPG  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD A KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKNVV+ P 
Sbjct  328  LGSLDTAGKSTGTGGKKRGPAPYRIFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPG  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD A KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+N+V  P 
Sbjct  322  VGSLDTAGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD AEKS G GG  + PA  R+ NLGN  PV V  +V I E  L +K KKNVV  P 
Sbjct  321  VASLDTAEKSTGSGGKKRRPAQYRIFNLGNTSPVTVPMMVSILEKHLKVKAKKNVVDMPG  380

Query  17   NGDVP  3
            NGDVP
Sbjct  381  NGDVP  385



>ref|XP_002528222.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF34179.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=433

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD A KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+NVV  P 
Sbjct  324  VGSLDTAGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILEKHLKMKAKRNVVDMPG  383

Query  17   NGDVP  3
            NGDVP
Sbjct  384  NGDVP  388



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+N+V  P 
Sbjct  322  VGSLDTSAKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A+ S G G   +GPA LRV NLGN  PV V  +V I E LL  K KKNVV  P+
Sbjct  339  LGALDTAKPSTGSGSKKRGPAQLRVYNLGNTSPVPVAKMVGILEELLGKKAKKNVVTLPQ  398

Query  17   NGDVP  3
            NGDVP
Sbjct  399  NGDVP  403



>ref|NP_001142515.1| hypothetical protein [Zea mays]
 gb|ACG24575.1| hypothetical protein [Zea mays]
 gb|ACN27084.1| unknown [Zea mays]
 gb|AFW73831.1| hypothetical protein ZEAMMB73_770166 [Zea mays]
Length=439

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD A KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKNVV+ P 
Sbjct  328  LGSLDTAGKSTGTGGKKRGPAPYRIFNLGNTAPVTVPNLVSILEKHLRVKAKKNVVEMPG  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>ref|XP_008794398.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Phoenix dactylifera]
Length=432

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD AEKS G GG  + PA  R+ NLGN  PV V  LV I E  L +K K+NVV+ P 
Sbjct  322  LGSLDTAEKSTGSGGKKRRPAQYRIYNLGNTSPVTVPTLVSILERHLKVKAKRNVVEMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>gb|KHN17533.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=262

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+N+V  P 
Sbjct  153  VGSLDTSAKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPG  212

Query  17   NGDVP  3
            NGDVP
Sbjct  213  NGDVP  217



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  197  VGALDPAEKSPGX--GGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKX  24
            +GALD A+KS G   GG  +GPA LR+ NLGN  PV V  +V I E+LL  K KKNVV  
Sbjct  338  LGALDTAKKSTGVAGGGKKRGPAQLRIYNLGNTSPVPVAKMVSILEDLLRKKAKKNVVTL  397

Query  23   PRNGDVP  3
            P+NGDVP
Sbjct  398  PQNGDVP  404



>ref|XP_007221187.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
 gb|EMJ22386.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
Length=410

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  +GPA LRV NLGN  PV V  +V I E LL +K KK VV  PR
Sbjct  302  LAALDTAEKSTGSGGRVEGPAQLRVFNLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPR  361

Query  17   NGDV  6
            NGDV
Sbjct  362  NGDV  365



>gb|EMT26004.1| UDP-glucuronate 4-epimerase 4 [Aegilops tauschii]
Length=176

 Score = 70.5 bits (171),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A +S G GG  +GPA  R  NLGN  PV V  LV + E +L +K  + VVK PR
Sbjct  46   IGALDTAGRSTGSGGKKRGPAPFRTYNLGNTSPVPVTQLVDLLEKMLKVKAVRRVVKMPR  105

Query  17   NGDVP  3
            NGDVP
Sbjct  106  NGDVP  110



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKNV++ P 
Sbjct  322  LGSLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPKLVNILERHLKVKAKKNVIEMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_008234372.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Prunus mume]
Length=409

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  +GPA LRV NLGN  PV V  +V I E LL +K KK VV  PR
Sbjct  302  LAALDTAEKSTGSGGRVEGPAQLRVFNLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPR  361

Query  17   NGDV  6
            NGDV
Sbjct  362  NGDV  365



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD + KS G GG  +G A  R+ NLGN  PV V  LV I E LL +K KKN+V  P 
Sbjct  326  VGSLDTSGKSTGSGGKKRGAAPYRIFNLGNTSPVTVPTLVSILERLLKVKAKKNIVDMPG  385

Query  17   NGDVP  3
            NGDVP
Sbjct  386  NGDVP  390



>ref|XP_008794557.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Phoenix dactylifera]
Length=462

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD A KS G GG  +GPA LRV NLGN  PV V  LV I ENLL +K  +  VK PR
Sbjct  345  VAALDTAGKSTGSGGKKRGPAPLRVYNLGNTSPVPVADLVSILENLLGVKAVRKAVKMPR  404

Query  17   NGDV  6
            NGDV
Sbjct  405  NGDV  408



>ref|XP_004298689.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Fragaria vesca subsp. 
vesca]
Length=437

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD A+KS G GG  KGPA LRV NLGN  PV V  LV I E  L +K K+ V+  PR
Sbjct  327  VASLDTAKKSTGSGGKKKGPAQLRVINLGNTSPVPVSNLVSILEKHLKVKAKRKVLPMPR  386

Query  17   NGDV  6
            NGDV
Sbjct  387  NGDV  390



>ref|XP_004148129.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KG A LRV NLGN  PV V  LV   E LL +K K+ V+  PR
Sbjct  299  LGALDTAEKSTGSGGRKKGKAQLRVFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPR  358

Query  17   NGDVP  3
            NGDVP
Sbjct  359  NGDVP  363



>gb|AFK41785.1| unknown [Medicago truncatula]
Length=154

 Score = 69.7 bits (169),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A+KS G GG  KG A  RV NLGN  PV V  LV I E LL +  KK V+  PR
Sbjct  42   LGALDTAKKSTGSGGKKKGSAQFRVFNLGNTSPVPVSKLVAILEKLLKVNAKKRVLPMPR  101

Query  17   NGDV  6
            NGDV
Sbjct  102  NGDV  105



>ref|XP_006845469.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
 gb|ERN07144.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
Length=432

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD + KS G GG  KGPA  R+ NLGN  PV V  LV I E  L +K K+NVV+ P 
Sbjct  322  VASLDTSGKSTGSGGKKKGPAPYRIFNLGNTSPVTVPDLVGILEKHLKVKAKRNVVEMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD AEKS G GG    PA  R+ NLGN  PV V  LV I E  L +K KKNVV+ P 
Sbjct  323  VASLDTAEKSTGSGGRKGSPAQYRIYNLGNTSPVTVPALVGILERHLKVKAKKNVVEMPG  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD A KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKN+V  P 
Sbjct  322  LGSLDTAGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVGILERHLKMKAKKNIVDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_002437985.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
 gb|EER89352.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
Length=440

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD A +S G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKNVV+ P 
Sbjct  328  LASLDTAGRSTGTGGKKRGPAQYRIFNLGNTSPVTVPTLVAILERYLRVKAKKNVVEMPG  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>emb|CDP09891.1| unnamed protein product [Coffea canephora]
Length=454

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD A+KS G GG  +G A  R+ NLGN  PV +  LV I E LL +K KK V++ PR
Sbjct  346  LAALDTAKKSTGSGGKKRGAAQFRIYNLGNTTPVPIGRLVSILEKLLRVKAKKKVIQMPR  405

Query  17   NGDVP  3
            NGDVP
Sbjct  406  NGDVP  410



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 37/60 (62%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KGPA LR+ NLGN  PV V  LV I E LL  K KK+V+K PR
Sbjct  337  LGALDTAEKSTGSGGKKKGPAQLRIYNLGNTSPVPVGKLVSILEGLLGTKAKKHVIKMPR  396



>ref|XP_006651218.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Oryza brachyantha]
Length=516

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A +S G GG  +GPA  R  NLGN  PV V  LV + E LL +K  + +VK PR
Sbjct  386  IGALDTAGRSTGSGGKKRGPAPFRTYNLGNTSPVPVTQLVDLLEKLLKVKAVRRIVKMPR  445

Query  17   NGDVP  3
            NGDVP
Sbjct  446  NGDVP  450



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD + KS G GG   GPA  R+ NLGN  PV V  LV I E  L +K KKNVV+ P 
Sbjct  322  LGSLDTSGKSTGSGGKKTGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKKNVVEMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_004296420.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Fragaria vesca subsp. 
vesca]
Length=434

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+NVV+ P 
Sbjct  325  LGSLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVNILERHLKMKAKRNVVEMPG  384

Query  17   NGDVP  3
            NGDVP
Sbjct  385  NGDVP  389



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD A+KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K++VV+ P 
Sbjct  322  VASLDTAQKSTGSGGRKRGPAQYRIFNLGNTSPVTVPALVGILERHLKVKAKRHVVEMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+N+V  P 
Sbjct  322  VGSLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVNILERHLKVKAKRNIVDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>emb|CDP21367.1| unnamed protein product [Coffea canephora]
Length=433

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD A+KS G GG  +GPA  R+ NLGN  PV V  +V I E  L +K KKN V  P 
Sbjct  323  VASLDTAKKSTGSGGKKRGPAQYRIFNLGNTSPVTVPMMVGILERHLKVKAKKNYVDMPG  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>ref|XP_008649176.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Zea mays]
Length=440

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD A +S G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKNVV+ P 
Sbjct  328  LASLDTAGRSTGTGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERYLRVKAKKNVVEMPG  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>gb|EYU34305.1| hypothetical protein MIMGU_mgv1a006903mg [Erythranthe guttata]
Length=427

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V +LD A++S G GG  +GPA  R+ NLGN  PV V  +V I E  L  K  KNVV+ P 
Sbjct  323  VASLDTAKRSTGSGGKKRGPAQFRIFNLGNTSPVTVPMMVGILEKQLKTKAHKNVVEMPG  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>ref|XP_010909513.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 3-like 
[Elaeis guineensis]
Length=469

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD A KS G GG  +GPA LRV NLGN  PV V  LV I E LL +K  + VVK PR
Sbjct  352  VAALDTAGKSTGSGGKKRGPAPLRVYNLGNTSPVPVADLVSILEKLLGVKAIRRVVKMPR  411

Query  17   NGDV  6
            NGDV
Sbjct  412  NGDV  415



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD A KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KK+VV+ P 
Sbjct  328  LGSLDTAGKSTGTGGKKRGPAPYRIFNLGNTSPVTVPNLVSILEKHLRVKAKKHVVEMPG  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>emb|CBI22155.3| unnamed protein product [Vitis vinifera]
Length=234

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD A+KS G GG  KG A  R+ NLGN  PV V  LV I E LL +K K+ V+  PR
Sbjct  64   LASLDTAKKSTGTGGKKKGAAQFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPR  123

Query  17   NGDV  6
            NGDV
Sbjct  124  NGDV  127



>ref|XP_004251783.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum lycopersicum]
Length=432

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD A KS G GG  +GPA  R+ NLGN  PV V  +V + E  L +K KK+V+  P 
Sbjct  322  VGSLDTAGKSTGSGGKKRGPAMFRIFNLGNTSPVTVPMMVAMLEKHLKVKAKKHVLDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+N+V  P 
Sbjct  322  VGSLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVNILERHLRVKAKRNIVDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_006350062.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=431

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD A KS G GG  +GPA  R+ NLGN  PV V  +V + E  L +K KK+V+  P 
Sbjct  322  VGSLDTAGKSTGSGGKKRGPAMFRIFNLGNTSPVTVPMMVAMLEKHLKVKAKKHVLDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_010662214.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Vitis vinifera]
Length=341

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD A+KS G GG  KG A  R+ NLGN  PV V  LV I E LL +K K+ V+  PR
Sbjct  232  LASLDTAKKSTGTGGKKKGAAQFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPR  291

Query  17   NGDV  6
            NGDV
Sbjct  292  NGDV  295



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD + KS G GG  +GPA  R+ NLGN  PV V  +V I E  L +K KKN V+ P 
Sbjct  317  IGSLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPMMVGILEKHLKVKAKKNFVEMPG  376

Query  17   NGDVP  3
            NGDVP
Sbjct  377  NGDVP  381



>emb|CBI18845.3| unnamed protein product [Vitis vinifera]
Length=255

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD A+KS G GG  KG A  R+ NLGN  PV V  LV I E LL +K K+ V+  PR
Sbjct  146  LASLDTAKKSTGTGGKKKGAAQFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPR  205

Query  17   NGDV  6
            NGDV
Sbjct  206  NGDV  209



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD + KS G GG  +GPA  R+ NLGN  PV V  +V I E  L +K KKN V+ P 
Sbjct  317  IGSLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPMMVGILEKHLKVKAKKNFVEMPG  376

Query  17   NGDVP  3
            NGDVP
Sbjct  377  NGDVP  381



>ref|XP_004966666.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=440

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + +LD A +S G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKNV++ P 
Sbjct  328  LASLDTAGRSTGTGGKKRGPAPYRIFNLGNTSPVTVPTLVAILERYLRVKAKKNVIEMPG  387

Query  17   NGDVP  3
            NGDVP
Sbjct  388  NGDVP  392



>ref|XP_003558346.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Brachypodium distachyon]
Length=481

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD A +S G GG  +GPA  R  NLGN  PV V  LV + E +L +K  + VVK PR
Sbjct  351  VAALDTAGRSTGSGGKKRGPAPFRTYNLGNTSPVPVTQLVDLLEKMLKVKAVRRVVKMPR  410

Query  17   NGDVP  3
            NGDVP
Sbjct  411  NGDVP  415



>dbj|BAJ88176.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07524.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD A +S G GG  +GPA  R  NLGN  PV V  LV + E +L +K  + VVK PR
Sbjct  353  IGALDTAGRSTGSGGKKRGPAPFRTYNLGNTSPVPVTQLVDLLEKMLKVKAVRRVVKMPR  412

Query  17   NGDVP  3
            NGDVP
Sbjct  413  NGDVP  417



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -2

Query  170  SPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPRNGDVP  3
            + G GG  +GPA LRV NLGN  PV V  LV I ENLL  K KK+V++ PRNGDVP
Sbjct  352  ATGSGGKKRGPAQLRVYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVP  407



>ref|XP_010276827.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nelumbo nucifera]
Length=438

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD AEKS G GG  KG A LRV NLGN  PV V  LV I E LL +K  + ++K PR
Sbjct  329  LAALDTAEKSTGSGGKKKGSAQLRVFNLGNTSPVPVTQLVSILEKLLKVKANRLMLKMPR  388

Query  17   NGDV  6
            NGDV
Sbjct  389  NGDV  392



>gb|KDP38751.1| hypothetical protein JCGZ_04104 [Jatropha curcas]
Length=431

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD A KS G GG  +GPA  R+ NLGN  PV V  LV I E  L  K K+++V  P 
Sbjct  322  VGSLDTAGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILEKHLKTKAKRHIVDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>ref|XP_008439108.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis melo]
Length=408

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +GALD AEKS G GG  KG A LRV NLGN  PV V  LV   E LL +K K+ V+  P 
Sbjct  299  LGALDTAEKSTGSGGRKKGKAQLRVFNLGNTSPVTVSELVDNLEKLLNMKAKRLVLPMPM  358

Query  17   NGDVP  3
            NGDVP
Sbjct  359  NGDVP  363



>ref|XP_009409770.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            V ALD AE S G GG  + PA  R+ NLGN  PV V  LV I E  L +K KKNV + P 
Sbjct  324  VAALDTAEASTGSGGRKRSPAQYRIYNLGNTSPVTVPALVGILERHLKMKAKKNVAEMPG  383

Query  17   NGDVP  3
            NGDVP
Sbjct  384  NGDVP  388



>gb|KDP25603.1| hypothetical protein JCGZ_20759 [Jatropha curcas]
Length=436

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD A+KS G GG  +GPA  RV NLGN  PV V  LV I E+LL +K KK V+  PR
Sbjct  326  LAALDTAKKSTGSGGKKRGPAQFRVFNLGNTSPVPVSRLVGILESLLQVKAKKKVLPLPR  385

Query  17   NGDV  6
            NGDV
Sbjct  386  NGDV  389



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+N+V  P 
Sbjct  324  LGSLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVKVPELVNILERHLKVKAKRNIVDMPG  383

Query  17   NGDVP  3
            NGDVP
Sbjct  384  NGDVP  388



>ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
 gb|EMJ23580.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
Length=432

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKN V  P 
Sbjct  323  LGSLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKMKAKKNFVDMPG  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Prunus mume]
Length=432

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KKN V  P 
Sbjct  323  LGSLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKMKAKKNFVDMPG  382

Query  17   NGDVP  3
            NGDVP
Sbjct  383  NGDVP  387



>ref|XP_009397005.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            + ALD A KS G GG  +G A LRV NLGN  PV V  LV I E LL +K  +NVVK PR
Sbjct  334  LAALDNAGKSTGSGGKKRGSAPLRVYNLGNTSPVPVSHLVSILEQLLKVKAVRNVVKMPR  393

Query  17   NGDV  6
            NGDV
Sbjct  394  NGDV  397



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD + KS G GG  +GPA  R+ NLGN  PV V  LV + E  L +K K+N V  P 
Sbjct  322  VGSLDTSGKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSLLERHLKVKAKRNFVDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>dbj|BAJ85817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96148.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD A +S G GG  +GPA  R+ NLGN  PV V  LV I E  L +K KK+VV+ P 
Sbjct  329  LGSLDTAGRSTGTGGKKRGPAPYRIFNLGNTSPVTVPTLVSILEKHLRVKAKKHVVEMPG  388

Query  17   NGDVP  3
            NGDVP
Sbjct  389  NGDVP  393



>ref|XP_010103125.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
 gb|EXB94890.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
Length=432

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            +G+LD A KS G GG  K PA  R+ NLGN  PV V  LV I E  L +K K+NVV  P 
Sbjct  322  LGSLDTAGKSTGSGGKKKRPAPYRIFNLGNTSPVTVPTLVDILERHLKVKAKRNVVDMPG  381

Query  17   NGDVP  3
            NGDVP
Sbjct  382  NGDVP  386



>gb|KHN30291.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=341

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  VGALDPAEKSPGXGGXXKGPAXLRVXNLGNXXPVXVRXLVLIFENLLXIKGKKNVVKXPR  18
            VG+LD + KS G GG  +GPA  R+ NLGN  PV V  LV I E  L +K K+N+V  P 
Sbjct  232  VGSLDTSAKSTGSGGKKRGPAPYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPG  291

Query  17   NGDVP  3
            NGDVP
Sbjct  292  NGDVP  296



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563261113660