BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF020L03

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617840.1|  PREDICTED: uncharacterized protein LOC104110119    208   3e-64   
ref|XP_009787718.1|  PREDICTED: uncharacterized protein LOC104235612    207   4e-62   Nicotiana sylvestris
ref|XP_007014648.1|  Uncharacterized protein TCM_039966                 206   5e-62   
gb|EYU32819.1|  hypothetical protein MIMGU_mgv1a012602mg                206   9e-62   Erythranthe guttata [common monkey flower]
ref|XP_011089758.1|  PREDICTED: uncharacterized protein LOC105170618    204   2e-61   Sesamum indicum [beniseed]
ref|XP_004228972.1|  PREDICTED: uncharacterized protein LOC101267925    203   5e-61   Solanum lycopersicum
ref|XP_006348221.1|  PREDICTED: uncharacterized protein LOC102606203    201   3e-60   Solanum tuberosum [potatoes]
emb|CDP18577.1|  unnamed protein product                                201   6e-60   Coffea canephora [robusta coffee]
gb|KJB83393.1|  hypothetical protein B456_013G245200                    194   2e-58   Gossypium raimondii
gb|KHG03556.1|  Chromosome-associated kinesin KIF4                      195   2e-57   Gossypium arboreum [tree cotton]
gb|KJB83392.1|  hypothetical protein B456_013G245200                    194   2e-57   Gossypium raimondii
ref|XP_011048149.1|  PREDICTED: uncharacterized protein LOC105142285    191   3e-56   Populus euphratica
ref|XP_002299091.1|  hypothetical protein POPTR_0001s03860g             191   5e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010105296.1|  hypothetical protein L484_002346                   190   7e-56   
ref|XP_002285769.1|  PREDICTED: uncharacterized protein LOC100250...    190   2e-55   
ref|XP_010276434.1|  PREDICTED: uncharacterized protein LOC104611177    189   2e-55   Nelumbo nucifera [Indian lotus]
gb|EPS63583.1|  hypothetical protein M569_11194                         187   7e-55   Genlisea aurea
gb|KFK29159.1|  hypothetical protein AALP_AA7G096800                    186   3e-54   Arabis alpina [alpine rockcress]
ref|XP_010536807.1|  PREDICTED: uncharacterized protein LOC104811711    186   5e-54   Tarenaya hassleriana [spider flower]
ref|XP_010651409.1|  PREDICTED: uncharacterized protein LOC100250...    183   5e-53   
ref|XP_002523392.1|  conserved hypothetical protein                     183   7e-53   Ricinus communis
ref|XP_010032828.1|  PREDICTED: uncharacterized protein LOC104422263    182   1e-52   Eucalyptus grandis [rose gum]
ref|XP_006413188.1|  hypothetical protein EUTSA_v10026011mg             182   2e-52   Eutrema salsugineum [saltwater cress]
ref|XP_002869612.1|  hypothetical protein ARALYDRAFT_913923             182   2e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_006284348.1|  hypothetical protein CARUB_v10005520mg             182   2e-52   Capsella rubella
ref|XP_010448277.1|  PREDICTED: uncharacterized protein LOC104730768    182   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004505352.1|  PREDICTED: uncharacterized protein LOC101513717    180   7e-52   Cicer arietinum [garbanzo]
emb|CDX89342.1|  BnaA01g15510D                                          180   1e-51   
ref|NP_194371.2|  uncharacterized protein                               180   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142234.1|  PREDICTED: uncharacterized protein LOC103866109    179   3e-51   Brassica rapa
emb|CDX94341.1|  BnaC01g18430D                                          179   4e-51   
emb|CDX92771.1|  BnaC07g40290D                                          179   4e-51   
ref|XP_003607819.1|  hypothetical protein MTR_4g083250                  179   4e-51   Medicago truncatula
ref|XP_007205735.1|  hypothetical protein PRUPE_ppa010110mg             179   5e-51   Prunus persica
ref|XP_010438763.1|  PREDICTED: uncharacterized protein LOC104722317    179   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_008220369.1|  PREDICTED: uncharacterized protein LOC103320436    179   5e-51   Prunus mume [ume]
ref|XP_006445553.1|  hypothetical protein CICLE_v10016445mg             176   2e-50   Citrus clementina [clementine]
ref|XP_008450994.1|  PREDICTED: uncharacterized protein LOC103492410    176   4e-50   Cucumis melo [Oriental melon]
ref|XP_003607823.1|  hypothetical protein MTR_4g083290                  179   4e-50   
ref|XP_010433511.1|  PREDICTED: uncharacterized protein LOC104717609    176   5e-50   Camelina sativa [gold-of-pleasure]
emb|CDY42739.1|  BnaA03g48000D                                          176   6e-50   Brassica napus [oilseed rape]
ref|XP_004144064.1|  PREDICTED: uncharacterized protein LOC101216...    175   6e-50   Cucumis sativus [cucumbers]
ref|XP_006488962.1|  PREDICTED: uncharacterized protein LOC102628779    175   6e-50   Citrus sinensis [apfelsine]
gb|KDO54526.1|  hypothetical protein CISIN_1g025242mg                   175   8e-50   Citrus sinensis [apfelsine]
ref|XP_009137593.1|  PREDICTED: uncharacterized protein LOC103861626    175   1e-49   Brassica rapa
gb|KDP30630.1|  hypothetical protein JCGZ_16195                         174   1e-49   Jatropha curcas
ref|XP_003556589.1|  PREDICTED: uncharacterized protein LOC100780119    173   3e-49   Glycine max [soybeans]
ref|XP_004294933.1|  PREDICTED: uncharacterized protein LOC101308945    172   9e-49   Fragaria vesca subsp. vesca
ref|XP_003529452.1|  PREDICTED: uncharacterized protein LOC100808143    172   9e-49   Glycine max [soybeans]
gb|ACU19454.1|  unknown                                                 171   1e-48   Glycine max [soybeans]
ref|XP_009339217.1|  PREDICTED: uncharacterized protein LOC103931455    172   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_007157828.1|  hypothetical protein PHAVU_002G101500g             169   2e-47   Phaseolus vulgaris [French bean]
ref|XP_008384350.1|  PREDICTED: uncharacterized protein LOC103446960    169   2e-47   
ref|XP_010673453.1|  PREDICTED: uncharacterized protein LOC104889828    167   7e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN20511.1|  hypothetical protein glysoja_029524                     166   2e-46   Glycine soja [wild soybean]
ref|XP_006829819.1|  hypothetical protein AMTR_s00119p00084860          165   2e-45   Amborella trichopoda
gb|KHN42956.1|  hypothetical protein glysoja_007486                     160   9e-44   Glycine soja [wild soybean]
gb|KJB83396.1|  hypothetical protein B456_013G245200                    153   1e-41   Gossypium raimondii
gb|KJB83391.1|  hypothetical protein B456_013G245200                    152   2e-41   Gossypium raimondii
ref|XP_006413187.1|  hypothetical protein EUTSA_v10026011mg             152   3e-41   
gb|KJB83395.1|  hypothetical protein B456_013G245200                    152   4e-41   Gossypium raimondii
emb|CAA18229.1|  putative protein                                       150   6e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KEH30817.1|  hypothetical protein MTR_4g083250                       141   5e-37   Medicago truncatula
ref|XP_004144065.1|  PREDICTED: uncharacterized protein LOC101216...    134   1e-34   
gb|EEC75159.1|  hypothetical protein OsI_11373                          129   6e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001049981.1|  Os03g0324800                                       129   1e-32   
ref|XP_002465337.1|  hypothetical protein SORBIDRAFT_01g036710          129   1e-32   Sorghum bicolor [broomcorn]
ref|XP_010921336.1|  PREDICTED: uncharacterized protein LOC105044929    129   2e-32   Elaeis guineensis
ref|XP_004984525.1|  PREDICTED: uncharacterized protein LOC101782...    128   3e-32   Setaria italica
ref|XP_008781206.1|  PREDICTED: uncharacterized protein LOC103701046    129   3e-32   Phoenix dactylifera
ref|XP_004984524.1|  PREDICTED: uncharacterized protein LOC101782...    128   3e-32   Setaria italica
ref|XP_006650015.1|  PREDICTED: uncharacterized protein LOC102714271    126   1e-31   Oryza brachyantha
ref|XP_008670078.1|  PREDICTED: uncharacterized protein LOC100276...    126   2e-31   
ref|XP_003558009.1|  PREDICTED: uncharacterized protein LOC100838509    124   1e-30   Brachypodium distachyon [annual false brome]
dbj|BAK05826.1|  predicted protein                                      121   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001760783.1|  predicted protein                                  124   2e-29   
ref|XP_009393907.1|  PREDICTED: uncharacterized protein LOC103979471    119   5e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB83394.1|  hypothetical protein B456_013G245200                    118   2e-28   Gossypium raimondii
gb|KDP28809.1|  hypothetical protein JCGZ_14580                         116   2e-27   Jatropha curcas
ref|XP_010053946.1|  PREDICTED: uncharacterized protein LOC104442278    111   2e-25   Eucalyptus grandis [rose gum]
ref|XP_011017444.1|  PREDICTED: uncharacterized protein LOC105120771    109   8e-25   Populus euphratica
ref|XP_002302514.1|  hypothetical protein POPTR_0002s14390g             109   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010524407.1|  PREDICTED: uncharacterized protein LOC104802474    108   2e-24   Tarenaya hassleriana [spider flower]
ref|XP_002277999.1|  PREDICTED: uncharacterized protein LOC100266783    106   1e-23   Vitis vinifera
gb|KDO54525.1|  hypothetical protein CISIN_1g025242mg                   105   2e-23   Citrus sinensis [apfelsine]
gb|AIA26010.1|  hypothetical protein                                    102   2e-23   Phyllostachys edulis [kikko-chiku]
ref|XP_002511643.1|  conserved hypothetical protein                     105   3e-23   Ricinus communis
gb|AIA26008.1|  hypothetical protein                                    101   4e-23   Phyllostachys nidularia [broom bamboo]
ref|XP_010258900.1|  PREDICTED: uncharacterized protein LOC104598502    104   5e-23   Nelumbo nucifera [Indian lotus]
gb|AIA26006.1|  hypothetical protein                                    100   6e-23   Fargesia nitida
gb|AIA26007.1|  hypothetical protein                                    100   1e-22   Fargesia spathacea [umbrella bamboo]
ref|XP_007052188.1|  Uncharacterized protein isoform 1                  103   2e-22   
ref|XP_007052191.1|  Uncharacterized protein isoform 4                  103   2e-22   
gb|EEC75161.1|  hypothetical protein OsI_11375                          100   3e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001143401.1|  uncharacterized protein LOC100276044             98.2    4e-22   
ref|XP_009776946.1|  PREDICTED: uncharacterized protein LOC104226615    101   8e-22   Nicotiana sylvestris
ref|XP_008232561.1|  PREDICTED: uncharacterized protein LOC103331692  99.4    5e-21   Prunus mume [ume]
ref|XP_009133693.1|  PREDICTED: uncharacterized protein LOC103858149  99.0    6e-21   Brassica rapa
ref|XP_007052189.1|  Uncharacterized protein isoform 2                99.0    7e-21   
emb|CDX83410.1|  BnaA03g20960D                                        97.8    7e-21   
ref|XP_006347915.1|  PREDICTED: uncharacterized protein LOC102584275  98.6    8e-21   Solanum tuberosum [potatoes]
ref|XP_006397686.1|  hypothetical protein EUTSA_v10001582mg           98.6    9e-21   Eutrema salsugineum [saltwater cress]
ref|XP_004229779.1|  PREDICTED: uncharacterized protein LOC101267648  98.2    1e-20   Solanum lycopersicum
ref|XP_001771369.1|  predicted protein                                98.2    2e-20   
ref|XP_006445337.1|  hypothetical protein CICLE_v10021755mg           97.1    3e-20   Citrus clementina [clementine]
gb|EMT21115.1|  hypothetical protein F775_32566                       95.5    4e-20   
gb|KFK37300.1|  hypothetical protein AALP_AA4G239300                  96.3    5e-20   Arabis alpina [alpine rockcress]
gb|KHG03984.1|  Alanine--tRNA ligase                                  95.9    8e-20   Gossypium arboreum [tree cotton]
ref|NP_566034.1|  uncharacterized protein                             95.1    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881994.1|  hypothetical protein ARALYDRAFT_903941           95.1    2e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_002983323.1|  hypothetical protein SELMODRAFT_445444           95.9    2e-19   Selaginella moellendorffii
ref|XP_006838189.1|  hypothetical protein AMTR_s00106p00135890        94.4    2e-19   Amborella trichopoda
ref|XP_002987624.1|  hypothetical protein SELMODRAFT_447060           95.5    3e-19   Selaginella moellendorffii
ref|XP_009339857.1|  PREDICTED: uncharacterized protein LOC103932041  94.0    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_009337245.1|  PREDICTED: uncharacterized protein LOC103929743  94.0    4e-19   Pyrus x bretschneideri [bai li]
gb|KJB09928.1|  hypothetical protein B456_001G175600                  94.0    4e-19   Gossypium raimondii
ref|XP_009142315.1|  PREDICTED: uncharacterized protein LOC103866188  94.0    4e-19   Brassica rapa
gb|KJB09931.1|  hypothetical protein B456_001G175600                  94.0    4e-19   Gossypium raimondii
emb|CDY37025.1|  BnaA04g26030D                                        93.6    5e-19   Brassica napus [oilseed rape]
gb|KCW78323.1|  hypothetical protein EUGRSUZ_D02501                   93.2    5e-19   Eucalyptus grandis [rose gum]
gb|EYU42370.1|  hypothetical protein MIMGU_mgv1a023111mg              92.8    5e-19   Erythranthe guttata [common monkey flower]
ref|XP_006294796.1|  hypothetical protein CARUB_v10023846mg           92.4    1e-18   Capsella rubella
ref|XP_011093293.1|  PREDICTED: uncharacterized protein LOC105173298  92.0    1e-18   Sesamum indicum [beniseed]
ref|XP_008375716.1|  PREDICTED: uncharacterized protein LOC103438950  92.0    2e-18   
ref|XP_010508215.1|  PREDICTED: uncharacterized protein LOC104784826  92.0    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010506443.1|  PREDICTED: uncharacterized protein LOC104783...  91.3    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004171485.1|  PREDICTED: uncharacterized LOC101214960          89.4    5e-18   
ref|XP_010518116.1|  PREDICTED: uncharacterized protein LOC104793462  90.5    6e-18   Camelina sativa [gold-of-pleasure]
emb|CDX95625.1|  BnaC03g25060D                                        90.9    7e-18   
gb|KGN46560.1|  hypothetical protein Csa_6G108580                     89.0    9e-18   Cucumis sativus [cucumbers]
gb|AIA25954.1|  hypothetical protein                                  85.5    2e-17   Fargesia spathacea [umbrella bamboo]
ref|XP_003538068.1|  PREDICTED: uncharacterized protein LOC100804339  88.6    2e-17   Glycine max [soybeans]
ref|XP_008459726.1|  PREDICTED: uncharacterized protein LOC103498769  88.2    3e-17   Cucumis melo [Oriental melon]
gb|AIA25947.1|  hypothetical protein                                  84.7    3e-17   Phyllostachys nigra var. henonis
ref|XP_004140609.1|  PREDICTED: uncharacterized protein LOC101214960  88.2    3e-17   
ref|XP_010445295.1|  PREDICTED: pentatricopeptide repeat-containi...  88.6    4e-17   
ref|XP_004306965.1|  PREDICTED: uncharacterized protein LOC101308610  87.4    6e-17   Fragaria vesca subsp. vesca
ref|XP_007221158.1|  hypothetical protein PRUPE_ppa020296mg           84.3    6e-17   
ref|XP_010934947.1|  PREDICTED: uncharacterized protein LOC105054...  87.0    8e-17   Elaeis guineensis
gb|AIA25953.1|  hypothetical protein                                  83.6    9e-17   Fargesia spathacea [umbrella bamboo]
ref|XP_011033296.1|  PREDICTED: uncharacterized protein LOC105131821  85.9    1e-16   Populus euphratica
ref|XP_007052190.1|  Uncharacterized protein isoform 3                86.3    2e-16   
ref|XP_010692135.1|  PREDICTED: uncharacterized protein LOC104905332  84.7    5e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK47092.1|  unknown                                               84.0    9e-16   Lotus japonicus
gb|AFK39373.1|  unknown                                               83.6    1e-15   Lotus japonicus
emb|CAN64905.1|  hypothetical protein VITISV_042831                   86.3    1e-15   Vitis vinifera
gb|KEH22362.1|  hypothetical protein MTR_7g445370                     83.6    1e-15   Medicago truncatula
ref|XP_004514234.1|  PREDICTED: uncharacterized protein LOC101491840  83.2    2e-15   Cicer arietinum [garbanzo]
ref|XP_010506444.1|  PREDICTED: uncharacterized protein LOC104783...  81.3    6e-15   
gb|AFK35211.1|  unknown                                               81.3    7e-15   Medicago truncatula
gb|KDO85659.1|  hypothetical protein CISIN_1g024845mg                 79.0    4e-14   Citrus sinensis [apfelsine]
ref|XP_009385849.1|  PREDICTED: uncharacterized protein LOC103973101  78.6    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH22363.1|  hypothetical protein MTR_7g445370                     78.6    7e-14   Medicago truncatula
ref|XP_006423787.1|  hypothetical protein CICLE_v10029731mg           73.9    1e-13   
ref|XP_008796933.1|  PREDICTED: uncharacterized protein LOC103712...  75.9    4e-13   
ref|XP_008796934.1|  PREDICTED: uncharacterized protein LOC103712...  75.5    5e-13   Phoenix dactylifera
ref|XP_006375267.1|  hypothetical protein POPTR_0014s05780g           75.9    5e-13   
gb|KHN41331.1|  hypothetical protein glysoja_049618                   71.6    2e-12   Glycine soja [wild soybean]
gb|EMS57790.1|  hypothetical protein TRIUR3_22595                     71.2    3e-12   Triticum urartu
ref|XP_011396980.1|  hypothetical protein F751_1359                   73.2    4e-12   Auxenochlorella protothecoides
dbj|BAJ98005.1|  predicted protein                                    71.2    3e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005846915.1|  hypothetical protein CHLNCDRAFT_134807           71.2    3e-11   Chlorella variabilis
gb|AIA26009.1|  hypothetical protein                                  66.2    1e-10   Phyllostachys nigra var. henonis
gb|EEC72302.1|  hypothetical protein OsI_05485                        69.3    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010934948.1|  PREDICTED: uncharacterized protein LOC105054...  68.6    2e-10   Elaeis guineensis
ref|NP_001045615.1|  Os02g0104800                                     68.9    2e-10   
gb|KDD75675.1|  hypothetical protein H632_c557p1                      68.6    2e-10   Helicosporidium sp. ATCC 50920
ref|XP_003570319.1|  PREDICTED: uncharacterized protein LOC100834616  68.2    4e-10   Brachypodium distachyon [annual false brome]
ref|XP_006659070.1|  PREDICTED: uncharacterized protein LOC102721384  66.6    1e-09   Oryza brachyantha
ref|XP_001416629.1|  predicted protein                                64.3    2e-09   Ostreococcus lucimarinus CCE9901
gb|KDO85660.1|  hypothetical protein CISIN_1g024845mg                 64.3    4e-09   Citrus sinensis [apfelsine]
gb|AEJ54427.1|  hypothetical protein                                  59.7    1e-08   Fagopyrum esculentum subsp. ancestrale
ref|XP_003078117.1|  unnamed protein product                          62.4    2e-08   
emb|CEF97085.1|  unnamed product                                      62.0    3e-08   Ostreococcus tauri
ref|XP_001690494.1|  hypothetical protein CHLREDRAFT_144132           60.1    2e-07   Chlamydomonas reinhardtii
ref|XP_003064805.1|  predicted protein                                58.2    8e-07   Micromonas pusilla CCMP1545
gb|AIA25951.1|  hypothetical protein                                  51.6    2e-05   Phyllostachys nidularia [broom bamboo]
ref|XP_007140976.1|  hypothetical protein PHAVU_008G156700g           51.2    3e-05   Phaseolus vulgaris [French bean]
ref|XP_002952655.1|  hypothetical protein VOLCADRAFT_93417            50.4    5e-04   Volvox carteri f. nagariensis
ref|XP_007511188.1|  predicted protein                                50.4    5e-04   Bathycoccus prasinos



>ref|XP_009617840.1| PREDICTED: uncharacterized protein LOC104110119, partial [Nicotiana 
tomentosiformis]
Length=133

 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGR +SEEA+F+KAEKNVKEL LSVDLMKKES KL ERAALA  +MKRG SE
Sbjct  2    RRFLFRQTLGRLQSEEAKFSKAEKNVKELSLSVDLMKKESKKLLERAALAEKDMKRGLSE  61

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM+AG +IQS+ K V K EAQA DLMD+LREIPGRE LKLRAEVASMASHLRQQ+ A+DK
Sbjct  62   LMDAGNQIQSVGKTVYKVEAQAADLMDVLREIPGREALKLRAEVASMASHLRQQRTAIDK  121

Query  392  RIVKISELGVPV  357
            RIVK+SELGVP+
Sbjct  122  RIVKVSELGVPI  133



>ref|XP_009787718.1| PREDICTED: uncharacterized protein LOC104235612 [Nicotiana sylvestris]
Length=249

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGR +SEEA+F+KAEKNVKEL LSVDLMKKES KL ERAALA  +MKRG S+
Sbjct  118  RRFLFRQTLGRLQSEEAKFSKAEKNVKELSLSVDLMKKESKKLLERAALAEKDMKRGLSD  177

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM+AG +IQS+ K V K EAQA DLMD+LREIPGRE LKLRAEVASMASHLRQQ+ A+DK
Sbjct  178  LMDAGNQIQSIGKTVYKVEAQAADLMDVLREIPGREALKLRAEVASMASHLRQQRTAIDK  237

Query  392  RIVKISELGVPV  357
            RIVK+SELGVP+
Sbjct  238  RIVKVSELGVPI  249



>ref|XP_007014648.1| Uncharacterized protein TCM_039966 [Theobroma cacao]
 gb|EOY32267.1| Uncharacterized protein TCM_039966 [Theobroma cacao]
Length=238

 Score =   206 bits (524),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR LFRNTLGRF+SEEAQF +AEKNVKEL LSVD+MKKES KL ERAALA  +MKRGH E
Sbjct  107  RRLLFRNTLGRFQSEEAQFLRAEKNVKELNLSVDMMKKESSKLLERAALAEKDMKRGHKE  166

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMNAG +IQ LAK+V KAEAQA DLMD LREIPGRE LKLRAEVASMAS LRQQ+ ++DK
Sbjct  167  LMNAGGQIQHLAKSVYKAEAQAADLMDGLREIPGREALKLRAEVASMASLLRQQRVSLDK  226

Query  392  RIVKISELGVPV  357
            RI+KISELG+PV
Sbjct  227  RIMKISELGIPV  238



>gb|EYU32819.1| hypothetical protein MIMGU_mgv1a012602mg [Erythranthe guttata]
Length=245

 Score =   206 bits (523),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGR +SEEAQF KAE NVKEL LSVD+MKKES KL ER+ LA  +MKRGHS+
Sbjct  114  RRFLFRQTLGRLQSEEAQFVKAENNVKELTLSVDIMKKESKKLLERSVLAEKDMKRGHSD  173

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM AGT IQSLA++V K E +A DLMDLLREIPGRE LKLRA+VASMASHLRQQ++AMD+
Sbjct  174  LMGAGTEIQSLARSVYKTETKAADLMDLLREIPGREALKLRADVASMASHLRQQRSAMDR  233

Query  392  RIVKISELGVPV  357
            RI+KISELGVPV
Sbjct  234  RILKISELGVPV  245



>ref|XP_011089758.1| PREDICTED: uncharacterized protein LOC105170618 [Sesamum indicum]
Length=234

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGR +SEEAQF +AEKNVKEL LSVDLMKKES KL ER+ALA  +MKRGHS+
Sbjct  103  RRFLFRQTLGRLQSEEAQFVRAEKNVKELNLSVDLMKKESKKLLERSALAEKDMKRGHSD  162

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMNAG +IQSL ++V K EA+A DLMDLLREIPGRE LKLRA+VASMASHLRQQ++A+DK
Sbjct  163  LMNAGKQIQSLVRSVYKTEAEAADLMDLLREIPGREALKLRADVASMASHLRQQRSALDK  222

Query  392  RIVKISELGVPV  357
            RI+KISELG+ V
Sbjct  223  RILKISELGIHV  234



>ref|XP_004228972.1| PREDICTED: uncharacterized protein LOC101267925 [Solanum lycopersicum]
Length=233

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+R TLGR +SEEA+F KAEKNVKEL LSV LMKKES KL ERA+LA  +MKRGHS+
Sbjct  102  RRFLYRQTLGRLQSEEAKFIKAEKNVKELGLSVGLMKKESKKLLERASLAEKDMKRGHSD  161

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM AG +IQS+AK+V K E QA DLMD+LREIPGRE LKLRAEVASMASHLRQQ+ A+DK
Sbjct  162  LMVAGNQIQSVAKSVYKVEGQAADLMDVLREIPGREALKLRAEVASMASHLRQQRTAIDK  221

Query  392  RIVKISELGVPV  357
            RIVKISELGVP+
Sbjct  222  RIVKISELGVPI  233



>ref|XP_006348221.1| PREDICTED: uncharacterized protein LOC102606203 [Solanum tuberosum]
Length=233

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+R TLGR +SEEA+F KAEKNVKEL LSV LMKKES KL ERA+LA  +M+RGHS+
Sbjct  102  RRFLYRQTLGRLQSEEAKFIKAEKNVKELGLSVGLMKKESKKLLERASLAEKDMQRGHSD  161

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM AG +IQS+AK+V K E QA DLMD+LREIPGRE LKLRAEVASMASHLRQQ+ A+DK
Sbjct  162  LMVAGNQIQSVAKSVYKVEGQAADLMDVLREIPGREALKLRAEVASMASHLRQQRTAIDK  221

Query  392  RIVKISELGVPV  357
            RIVKISELGVP+
Sbjct  222  RIVKISELGVPI  233



>emb|CDP18577.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEAQF +AEKNVKEL LSVDLMKKESGKL ERAALA  EMK G  +
Sbjct  129  RRFLFRHTLGRFQSEEAQFIRAEKNVKELNLSVDLMKKESGKLLERAALAEKEMKHGQID  188

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMNAG +IQ+LA++V+KAE +ATDLMDLLRE+PGRE LKLRAEVAS+ASHLR+Q+ AM+K
Sbjct  189  LMNAGVQIQTLARSVHKAETKATDLMDLLRELPGREALKLRAEVASVASHLREQRIAMEK  248

Query  392  RIVKISELGVPV  357
            +I+KIS+ G+PV
Sbjct  249  KIMKISDSGLPV  260



>gb|KJB83393.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=169

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  E
Sbjct  38   RRFLFRNTLGRFQSEEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKE  97

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN+G +I  LAK+V K EA+A DLMD LREIPGRE LKLRAEVASMAS LRQQ+ ++D+
Sbjct  98   LMNSGGQIHRLAKSVYKVEAEAVDLMDGLREIPGREALKLRAEVASMASLLRQQRVSLDR  157

Query  392  RIVKISELGVPV  357
            RI KISELG+PV
Sbjct  158  RIRKISELGIPV  169



>gb|KHG03556.1| Chromosome-associated kinesin KIF4 [Gossypium arboreum]
Length=243

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  E
Sbjct  112  RRFLFRNTLGRFQSEEAKFSRAEKNVKVLSLSVDLMKKESSKLLERAALAEKDMKRGQKE  171

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN+G +I  LAK+V K EA+A DLMD LREIPGRE LKLRAEVASMAS LRQQ+ ++D+
Sbjct  172  LMNSGGQIHRLAKSVYKVEAEAVDLMDGLREIPGREALKLRAEVASMASLLRQQRVSLDR  231

Query  392  RIVKISELGVPV  357
            RI KISELG+PV
Sbjct  232  RIRKISELGIPV  243



>gb|KJB83392.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=242

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  E
Sbjct  111  RRFLFRNTLGRFQSEEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKE  170

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN+G +I  LAK+V K EA+A DLMD LREIPGRE LKLRAEVASMAS LRQQ+ ++D+
Sbjct  171  LMNSGGQIHRLAKSVYKVEAEAVDLMDGLREIPGREALKLRAEVASMASLLRQQRVSLDR  230

Query  392  RIVKISELGVPV  357
            RI KISELG+PV
Sbjct  231  RIRKISELGIPV  242



>ref|XP_011048149.1| PREDICTED: uncharacterized protein LOC105142285 [Populus euphratica]
Length=236

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEAQF +AEKNVKE   SVDLMKKES KL ERA+LA  EMK GH+E
Sbjct  105  RRFLFRNTLGRFQSEEAQFLRAEKNVKEYSFSVDLMKKESRKLLERASLAEKEMKNGHTE  164

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L++AG +IQ L+K+V K E +  DLMD LREIPGR+ LKLRAEVASM S L+QQ+A +DK
Sbjct  165  LLDAGIQIQRLSKSVYKVETKTADLMDGLREIPGRDALKLRAEVASMTSLLKQQRAVLDK  224

Query  392  RIVKISELGVPV  357
            RI+KISELG+PV
Sbjct  225  RIMKISELGIPV  236



>ref|XP_002299091.1| hypothetical protein POPTR_0001s03860g [Populus trichocarpa]
 gb|EEE83896.1| hypothetical protein POPTR_0001s03860g [Populus trichocarpa]
Length=239

 Score =   191 bits (485),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEAQF +AEKNVKE   SVDLMKKES KL ERA+LA  EMK GH+E
Sbjct  108  RRFLFRNTLGRFQSEEAQFLRAEKNVKEFSFSVDLMKKESRKLLERASLAEKEMKNGHTE  167

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L++ G +IQ LAK+V K E +  DLMD LREIPGR+ LKLRAEVASM S L+QQ+A +DK
Sbjct  168  LLDTGIQIQRLAKSVYKVETKTADLMDGLREIPGRDALKLRAEVASMTSLLKQQRAVLDK  227

Query  392  RIVKISELGVPV  357
            RI+KISELG+PV
Sbjct  228  RIMKISELGIPV  239



>ref|XP_010105296.1| hypothetical protein L484_002346 [Morus notabilis]
 gb|EXC04261.1| hypothetical protein L484_002346 [Morus notabilis]
Length=226

 Score =   190 bits (482),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGR RSEEAQF KAEKNVKEL LSVD+MK ES KL ERAALA  +MK GH+E
Sbjct  95   RRFLFRHTLGRLRSEEAQFVKAEKNVKELSLSVDVMKNESRKLLERAALAEKDMKYGHTE  154

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM AG +IQ LAK+V K EAQA DL+D LRE PGRE LKLRAEVAS+ SHL++Q+  +DK
Sbjct  155  LMKAGNQIQHLAKSVYKVEAQAADLVDGLRETPGREALKLRAEVASVLSHLKKQRVELDK  214

Query  392  RIVKISELGVPV  357
            RI++IS+LGVPV
Sbjct  215  RIMQISDLGVPV  226



>ref|XP_002285769.1| PREDICTED: uncharacterized protein LOC100250144 isoform X2 [Vitis 
vinifera]
 emb|CBI16570.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLF +TLGRF+SEEAQF +AEKNVKEL LSVDLMK ES KL ERAALA  +MK GH+E
Sbjct  115  RRFLFHHTLGRFQSEEAQFVRAEKNVKELNLSVDLMKNESRKLLERAALAEKDMKCGHTE  174

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN G++++ LAK V K EAQA DLMD LRE PGRE LKLR+EVASM S L+QQ+ A+DK
Sbjct  175  LMNTGSQLKRLAKTVFKVEAQAADLMDGLRETPGREALKLRSEVASMTSLLKQQRIALDK  234

Query  392  RIVKISELGVPV  357
            RI+KISELGVPV
Sbjct  235  RIMKISELGVPV  246



>ref|XP_010276434.1| PREDICTED: uncharacterized protein LOC104611177 [Nelumbo nucifera]
Length=248

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGR +SEEAQF +AEKNVKEL LSVDLMK ES KL ERA LA  +MKRG+ +
Sbjct  117  RRFLFRHTLGRLQSEEAQFLRAEKNVKELTLSVDLMKNESKKLLERATLAEKDMKRGYDQ  176

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMNAG  IQ LAK+V K EAQA DLMD LREIPGRE LKLRAEVASMAS ++QQ++++DK
Sbjct  177  LMNAGADIQRLAKSVYKIEAQAADLMDGLREIPGREALKLRAEVASMASLVKQQRSSLDK  236

Query  392  RIVKISELGVPV  357
            RI+K+SELGV V
Sbjct  237  RIMKMSELGVAV  248



>gb|EPS63583.1| hypothetical protein M569_11194 [Genlisea aurea]
Length=236

 Score =   187 bits (476),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL R TL R +SEEA+F +AEKNV EL LSV+LMKKE  KLF+R+ LA  +MK G+S 
Sbjct  105  RRFLLRQTLHRLQSEEARFVRAEKNVNELNLSVELMKKEGVKLFQRSMLAEKDMKHGYSS  164

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMNAGT+IQ+LAK+V KAEA+A DLMDLLR+IPGRE +KLRAEVASMAS LRQQ++AMDK
Sbjct  165  LMNAGTQIQTLAKSVYKAEAEAKDLMDLLRQIPGREAIKLRAEVASMASQLRQQRSAMDK  224

Query  392  RIVKISELGVPV  357
            R+++ISE GVPV
Sbjct  225  RLLRISEFGVPV  236



>gb|KFK29159.1| hypothetical protein AALP_AA7G096800 [Arabis alpina]
Length=229

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ERAALA  +MKRG SE
Sbjct  98   RRFLFRNTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESRKLLERAALAEKDMKRGLSE  157

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM++G  I  LAK+V+K E +ATDLMD LR+IPGRE +KLRAEVASM S LRQ++ A++K
Sbjct  158  LMDSGNNIHRLAKSVHKVECEATDLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  217

Query  392  RIVKISELGVPV  357
            RI+++SELGVPV
Sbjct  218  RIMRMSELGVPV  229



>ref|XP_010536807.1| PREDICTED: uncharacterized protein LOC104811711 [Tarenaya hassleriana]
Length=255

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGRF+SEEA++ K EKNV+EL ++VDLMKKES KL ERAALA  +MKRG SE
Sbjct  124  RRFLFRQTLGRFQSEEARYLKVEKNVQELNMTVDLMKKESRKLLERAALAEKDMKRGLSE  183

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM++G  +Q LAK+V K E+QATDLMD+LR+I GR+ LKLRAEVASMAS LRQ++ A++K
Sbjct  184  LMSSGCEVQRLAKSVYKVESQATDLMDVLRQISGRDALKLRAEVASMASILRQKRIALNK  243

Query  392  RIVKISELGVPV  357
            RI+KISELGVPV
Sbjct  244  RIMKISELGVPV  255



>ref|XP_010651409.1| PREDICTED: uncharacterized protein LOC100250144 isoform X1 [Vitis 
vinifera]
Length=252

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 111/138 (80%), Gaps = 6/138 (4%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLF +TLGRF+SEEAQF +AEKNVKEL LSVDLMK ES KL ERAALA  +MK GH+E
Sbjct  115  RRFLFHHTLGRFQSEEAQFVRAEKNVKELNLSVDLMKNESRKLLERAALAEKDMKCGHTE  174

Query  572  LMNAGTRIQSLAKAVNKAEAQA------TDLMDLLREIPGREPLKLRAEVASMASHLRQQ  411
            LMN G++++ LAK V K EAQA       DLMD LRE PGRE LKLR+EVASM S L+QQ
Sbjct  175  LMNTGSQLKRLAKTVFKVEAQAAVIIHFVDLMDGLRETPGREALKLRSEVASMTSLLKQQ  234

Query  410  KAAMDKRIVKISELGVPV  357
            + A+DKRI+KISELGVPV
Sbjct  235  RIALDKRIMKISELGVPV  252



>ref|XP_002523392.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38971.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+T GRF+SEEA+F K EKNVKEL LSVDLMK ES KL ERA+LA  +MK GH+E
Sbjct  134  RRFLFRHTFGRFQSEEARFLKTEKNVKELNLSVDLMKNESRKLLERASLAEKDMKHGHTE  193

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM+AG++IQ LAK++ K E Q   LMD LREIPGR+ LKLRAEVA+MAS L++ K+ +DK
Sbjct  194  LMDAGSQIQRLAKSIYKVETQVAGLMDGLREIPGRDALKLRAEVATMASALKKHKSVLDK  253

Query  392  RIVKISELGVPV  357
            RI+KISELG+PV
Sbjct  254  RIMKISELGIPV  265



>ref|XP_010032828.1| PREDICTED: uncharacterized protein LOC104422263 [Eucalyptus grandis]
 gb|KCW52324.1| hypothetical protein EUGRSUZ_J01745 [Eucalyptus grandis]
Length=242

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL R T GR +SEEAQF +AEKNVK+L LSVDLMKKES KL ERAALA T+MKRG ++
Sbjct  111  RRFLIRQTFGRLQSEEAQFVRAEKNVKDLNLSVDLMKKESKKLIERAALAETDMKRGLTD  170

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L N G + Q LAK++ K E+QA  LMD LREIPGRE LKLRAEVAS+AS+L+QQ+ AM+K
Sbjct  171  LKNTGNQTQRLAKSIYKVESQAGGLMDDLREIPGREALKLRAEVASLASNLKQQRVAMEK  230

Query  392  RIVKISELGVPV  357
            RIVKISELGV V
Sbjct  231  RIVKISELGVAV  242



>ref|XP_006413188.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
 gb|ESQ54641.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
Length=261

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEAQF KAEK+V+EL +SVDLMKKES KL ER+ALA  +MKRG SE
Sbjct  130  RRFLFRHTLGRFQSEEAQFLKAEKHVQELNMSVDLMKKESRKLLERSALAEKDMKRGLSE  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM++G  I  LA +V+K E +ATDLMD LR+IPGRE +KLRAEVASM S LRQ++ A++K
Sbjct  190  LMDSGNNIHRLANSVHKVECEATDLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  249

Query  392  RIVKISELGVPV  357
            RI+++SELGVPV
Sbjct  250  RIMRMSELGVPV  261



>ref|XP_002869612.1| hypothetical protein ARALYDRAFT_913923 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45871.1| hypothetical protein ARALYDRAFT_913923 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEAQF KAEK+V+EL +SVDLMKKES KL ER ALA  +MKRG SE
Sbjct  132  RRFLFRHTLGRFQSEEAQFLKAEKHVQELNMSVDLMKKESRKLLERTALAEKDMKRGLSE  191

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN+G  I  LAK+V+K E +A DLMD LR+IPGRE +KLRAEVASM S LRQ++ A++K
Sbjct  192  LMNSGNDIHRLAKSVHKVECEAADLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  251

Query  392  RIVKISELGVPV  357
            RI+ +SELGVPV
Sbjct  252  RIMSMSELGVPV  263



>ref|XP_006284348.1| hypothetical protein CARUB_v10005520mg [Capsella rubella]
 gb|EOA17246.1| hypothetical protein CARUB_v10005520mg [Capsella rubella]
Length=263

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER ALA  +MKRG SE
Sbjct  132  RRFLFRQTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESKKLLERTALAEKDMKRGLSE  191

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN+G  +  LAK+V+K E QA DLMD LR+IPGRE +KLRAEVASM S LRQ++ A++K
Sbjct  192  LMNSGNDVHRLAKSVHKVECQAADLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  251

Query  392  RIVKISELGVPV  357
            RI+ +SELGVPV
Sbjct  252  RIMSMSELGVPV  263



>ref|XP_010448277.1| PREDICTED: uncharacterized protein LOC104730768 [Camelina sativa]
Length=263

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGRF+SEEAQF +AEK V+EL +SVDLMKKES KL ERA LA  +MKRGHSE
Sbjct  132  RRFLFRQTLGRFQSEEAQFLRAEKQVQELNMSVDLMKKESKKLLERATLAEKDMKRGHSE  191

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN+G  I  LAK+V+K E +A DLMD LR+IPGR+ +KLRAEVASM S L+Q++ A++K
Sbjct  192  LMNSGNDIHRLAKSVHKVECEAADLMDGLRQIPGRDAIKLRAEVASMTSLLKQKRIALNK  251

Query  392  RIVKISELGVPV  357
            RI+ +SELG+PV
Sbjct  252  RILSMSELGLPV  263



>ref|XP_004505352.1| PREDICTED: uncharacterized protein LOC101513717 [Cicer arietinum]
Length=233

 Score =   180 bits (456),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R ALA  EMK GH+E
Sbjct  102  RRFLFRNTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTALAEKEMKYGHNE  161

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN G ++Q LAK+  K EA+ATDL+D LR+IP RE L LRAEVAS+AS+L++Q++ +DK
Sbjct  162  LMNTGAQLQKLAKSSYKVEARATDLIDRLRDIPSRETLALRAEVASLASNLKRQRSVLDK  221

Query  392  RIVKISELGVPV  357
            RI+KISELG+ V
Sbjct  222  RIMKISELGISV  233



>emb|CDX89342.1| BnaA01g15510D [Brassica napus]
Length=261

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER+ALA  +MKRG SE
Sbjct  130  RRFLFRHTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESMKLLERSALAEKDMKRGLSE  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM++G  I  LAK+V+K E +A DLMD LR+IPGRE +KLRAEVASM S LRQ++ A++K
Sbjct  190  LMDSGNNIHRLAKSVHKVECEAADLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  249

Query  392  RIVKISELGVPV  357
            RI+++SELGVPV
Sbjct  250  RIMRMSELGVPV  261



>ref|NP_194371.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO22774.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42434.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85195.1| uncharacterized protein AT4G26410 [Arabidopsis thaliana]
Length=263

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEAQF KAEK+V+EL +SVDLMKKES KL ER ALA  +MKRG SE
Sbjct  132  RRFLFRNTLGRFQSEEAQFLKAEKHVQELNMSVDLMKKESRKLLERTALAEKDMKRGLSE  191

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN+G  I  LAK+V+KAE +A DLMD LR+IPGR+ +KLRAEVASM S LRQ++ A++K
Sbjct  192  LMNSGNDIHRLAKSVHKAECEAADLMDGLRQIPGRDAIKLRAEVASMTSLLRQKRIALNK  251

Query  392  RIVKISELGVPV  357
            RI+ +S+LGV V
Sbjct  252  RIMGMSDLGVSV  263



>ref|XP_009142234.1| PREDICTED: uncharacterized protein LOC103866109 [Brassica rapa]
Length=261

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER+ALA  +MKRG SE
Sbjct  130  RRFLFRHTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESVKLLERSALAEKDMKRGLSE  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM++G  I  LAK+V+K E +A DLMD LR+IPGRE +KLRAEVASM S L+Q++ A++K
Sbjct  190  LMDSGNNIHRLAKSVHKVECEAADLMDGLRQIPGREAIKLRAEVASMTSLLKQKRIALNK  249

Query  392  RIVKISELGVPV  357
            RI+++SELGVPV
Sbjct  250  RIMRMSELGVPV  261



>emb|CDX94341.1| BnaC01g18430D [Brassica napus]
Length=261

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER+ALA  +MKRG SE
Sbjct  130  RRFLFRHTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESMKLLERSALAEKDMKRGLSE  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM++G  I  L K+V+K E +A DLMD LR+IPGRE +KLRAEVASM S LRQ++ A++K
Sbjct  190  LMDSGNNIHRLVKSVHKVECEAADLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  249

Query  392  RIVKISELGVPV  357
            RI+++SELGVPV
Sbjct  250  RIMRMSELGVPV  261



>emb|CDX92771.1| BnaC07g40290D [Brassica napus]
Length=263

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER+ALA  +MKRG SE
Sbjct  132  RRFLFRRTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESSKLLERSALAEKDMKRGLSE  191

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN+G  I  LAK+V+K E +A  LMD LR+IPGRE +KLRAEVASM S LRQ++ A++K
Sbjct  192  LMNSGNNIHRLAKSVHKVECEAAGLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  251

Query  392  RIVKISELGVPV  357
            RI+ +SELGVPV
Sbjct  252  RIMGMSELGVPV  263



>ref|XP_003607819.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
 gb|AES90016.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
 gb|AFK36915.1| unknown [Medicago truncatula]
Length=266

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R ALA  EMK GHSE
Sbjct  135  RRFLFRHTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTALAEKEMKYGHSE  194

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN G ++Q LAK+  KAEA+ATDL+D LR+IP RE L LRAEVAS+AS L++Q++ +DK
Sbjct  195  LMNTGAQLQRLAKSSYKAEARATDLIDRLRDIPSREALTLRAEVASLASSLKRQRSVLDK  254

Query  392  RIVKISELGVPV  357
            RI+KISELG+ V
Sbjct  255  RIMKISELGISV  266



>ref|XP_007205735.1| hypothetical protein PRUPE_ppa010110mg [Prunus persica]
 gb|EMJ06934.1| hypothetical protein PRUPE_ppa010110mg [Prunus persica]
Length=263

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF  R T  R +SEEAQF +AEKNVKEL LSVDLMKKES KL ERA LA  +MK G ++
Sbjct  132  RRFFIRQTFSRLQSEEAQFVRAEKNVKELNLSVDLMKKESKKLLERALLAEKDMKYGQTD  191

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM+ G++IQSL+K+V+K E+QA DLMD LREIP RE LKLRAEVASMAS L++Q++ +DK
Sbjct  192  LMDVGSQIQSLSKSVHKVESQAADLMDGLREIPNREALKLRAEVASMASVLKRQRSVLDK  251

Query  392  RIVKISELGVPV  357
            RI+KISELG+PV
Sbjct  252  RIMKISELGLPV  263



>ref|XP_010438763.1| PREDICTED: uncharacterized protein LOC104722317 [Camelina sativa]
Length=263

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ERA LA  +MKRG SE
Sbjct  132  RRFLFRQTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESKKLLERATLAEKDMKRGLSE  191

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN+G  I  LAK+V+K E +A DLMD LR+IPGR+ +KLRAEVASM S LRQ++ A++K
Sbjct  192  LMNSGNDIHRLAKSVHKVECEAADLMDGLRQIPGRDAIKLRAEVASMTSLLRQKRIALNK  251

Query  392  RIVKISELGVPV  357
            RI+ +SELG+PV
Sbjct  252  RIMSMSELGLPV  263



>ref|XP_008220369.1| PREDICTED: uncharacterized protein LOC103320436 [Prunus mume]
Length=263

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF  R T  R +SEEAQF +AEKNVKEL LSVDLMKKES KL ERA LA  +MK G ++
Sbjct  132  RRFFIRQTFSRLQSEEAQFVRAEKNVKELNLSVDLMKKESKKLLERALLAEKDMKYGQTD  191

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM+ G++IQSL+K+V+K E+QA DLMD LREIP RE LKLRAEVASMAS L++Q++ +DK
Sbjct  192  LMDVGSQIQSLSKSVHKVESQAADLMDGLREIPNREALKLRAEVASMASVLKRQRSVLDK  251

Query  392  RIVKISELGVPV  357
            RI+KISELG+PV
Sbjct  252  RIMKISELGLPV  263



>ref|XP_006445553.1| hypothetical protein CICLE_v10016445mg [Citrus clementina]
 gb|ESR58793.1| hypothetical protein CICLE_v10016445mg [Citrus clementina]
 gb|KDO54524.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=243

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+T GR RSEEA F +AEKNV EL LS +LMKKES KL ERAALA  EM RG +E
Sbjct  112  RRFLFRHTFGRLRSEEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKEMIRGETE  171

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L NAG ++Q LAK V K E QA DLM+ LREIPGRE LKLRAEVASMAS L++Q+A MDK
Sbjct  172  LKNAGNQVQRLAKQVYKVETQAADLMEGLREIPGREALKLRAEVASMASLLKRQRAMMDK  231

Query  392  RIVKISELGVPV  357
            +I+KISELGV V
Sbjct  232  QIMKISELGVSV  243



>ref|XP_008450994.1| PREDICTED: uncharacterized protein LOC103492410 [Cucumis melo]
Length=241

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF++EEA F KAEK+VKEL LSVDLMK ES KL ERAALA  +MK GH+E
Sbjct  110  RRFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDLMKNESKKLLERAALAEKDMKYGHNE  169

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMNAG++IQ L++++ KAEAQA DLMD LREI GR+ LKLRAEVASM + L++Q+  ++ 
Sbjct  170  LMNAGSQIQHLSRSIYKAEAQAADLMDGLREISGRDALKLRAEVASMTTFLKRQRTLLEN  229

Query  392  RIVKISELGVPV  357
            R +K+S++G+P+
Sbjct  230  RAMKVSDMGIPL  241



>ref|XP_003607823.1| hypothetical protein MTR_4g083290 [Medicago truncatula]
Length=353

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R ALA  EMK GHSE
Sbjct  222  RRFLFRHTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTALAEKEMKYGHSE  281

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN G ++Q LAK+  KAEA+ATDL+D LR+IP RE L LRAEVAS+AS L++Q++ +DK
Sbjct  282  LMNTGAQLQRLAKSSYKAEARATDLIDRLRDIPSREALTLRAEVASLASSLKRQRSVLDK  341

Query  392  RIVKISELGVPV  357
            RI+KISELG+ V
Sbjct  342  RIMKISELGISV  353



>ref|XP_010433511.1| PREDICTED: uncharacterized protein LOC104717609 [Camelina sativa]
Length=263

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ERA LA  +MKRG SE
Sbjct  132  RRFLFRQTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESKKLLERATLAEKDMKRGLSE  191

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMN+G  I  LAK+V+K E +A DLMD LR+IPGR+ +KLRAEVASM S L Q++ A++K
Sbjct  192  LMNSGNDIHRLAKSVHKVECEAADLMDGLRQIPGRDAIKLRAEVASMTSLLGQKRIALNK  251

Query  392  RIVKISELGVPV  357
            RI+ +SELG+PV
Sbjct  252  RIMSMSELGLPV  263



>emb|CDY42739.1| BnaA03g48000D [Brassica napus]
Length=254

 Score =   176 bits (445),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER+ALA  +MKRG SE
Sbjct  123  RRFLFRRTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESMKLLERSALAEKDMKRGLSE  182

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM++G  I  LAK+V+K E +A  LMD LR+IPGRE +KLRAEVASM S LRQ++ A++K
Sbjct  183  LMDSGNNIHRLAKSVHKVECEAAGLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  242

Query  392  RIVKISELGVPV  357
            RI+ +SELGVPV
Sbjct  243  RIMGMSELGVPV  254



>ref|XP_004144064.1| PREDICTED: uncharacterized protein LOC101216418 isoform 1 [Cucumis 
sativus]
 ref|XP_004159354.1| PREDICTED: uncharacterized LOC101216418 isoform 1 [Cucumis sativus]
 gb|KGN66344.1| hypothetical protein Csa_1G599380 [Cucumis sativus]
Length=241

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF++EEA F KAEK+VKEL LSVDLMK ES KL ERAALA  +MK GH+E
Sbjct  110  RRFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDLMKNESKKLLERAALAEKDMKYGHNE  169

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMNAG++IQ L++++ KAEAQA DLMD LREI GR+ LKLRAEVASM + L++Q+  ++ 
Sbjct  170  LMNAGSQIQRLSRSIYKAEAQAADLMDGLREISGRDALKLRAEVASMTTFLKRQRTLLEN  229

Query  392  RIVKISELGVPV  357
            R +K+S++G+P+
Sbjct  230  RAMKVSDMGIPL  241



>ref|XP_006488962.1| PREDICTED: uncharacterized protein LOC102628779 [Citrus sinensis]
Length=243

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+T GR RSEEA F +AEKNV EL LS +LMKKES KL ERAALA  +M RG +E
Sbjct  112  RRFLFRHTFGRLRSEEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKDMIRGETE  171

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L NAG ++Q LAK V K E QA DLM+ LREIPGRE LKLRAEVASMAS L++Q+A MDK
Sbjct  172  LKNAGNQVQRLAKQVYKVETQAADLMEGLREIPGREALKLRAEVASMASLLKRQRAMMDK  231

Query  392  RIVKISELGVPV  357
            +I+KISELGV V
Sbjct  232  QIMKISELGVSV  243



>gb|KDO54526.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=250

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+T GR RSEEA F +AEKNV EL LS +LMKKES KL ERAALA  EM RG +E
Sbjct  119  RRFLFRHTFGRLRSEEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKEMIRGETE  178

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L NAG ++Q LAK V K E QA DLM+ LREIPGRE LKLRAEVASMAS L++Q+A MDK
Sbjct  179  LKNAGNQVQRLAKQVYKVETQAADLMEGLREIPGREALKLRAEVASMASLLKRQRAMMDK  238

Query  392  RIVKISELGVPV  357
            +I+KISELGV V
Sbjct  239  QIMKISELGVSV  250



>ref|XP_009137593.1| PREDICTED: uncharacterized protein LOC103861626 [Brassica rapa]
Length=254

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGRF+SEEAQF +AEK+V+EL +SVDLMKKES KL ER+ALA  +MKRG SE
Sbjct  123  RRFLFRRTLGRFQSEEAQFLRAEKHVQELNMSVDLMKKESSKLLERSALAEKDMKRGLSE  182

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM++G  I  LAK+V K E +A DL+  LR+IPGRE +KLRAEVASM S LRQ++ A++K
Sbjct  183  LMDSGNNIHRLAKSVQKVECEAADLIHGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  242

Query  392  RIVKISELGVPV  357
            RI+ +SELGVPV
Sbjct  243  RIMGMSELGVPV  254



>gb|KDP30630.1| hypothetical protein JCGZ_16195 [Jatropha curcas]
Length=226

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR LFR T GR +SEEA+F KAEKN+KEL LSVDLMK ES KL ERA+ A  +MK G +E
Sbjct  95   RRLLFRQTFGRLQSEEAKFLKAEKNLKELTLSVDLMKNESRKLLERASYAEKDMKHGLTE  154

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L+++G++IQ LAK+V K E Q  DLMD LREI GRE LKLRAEVASMAS L+Q + A+DK
Sbjct  155  LLDSGSQIQRLAKSVYKVENQVADLMDGLREISGREALKLRAEVASMASGLKQHRTALDK  214

Query  392  RIVKISELGVPV  357
            RI+KISELGVPV
Sbjct  215  RIMKISELGVPV  226



>ref|XP_003556589.1| PREDICTED: uncharacterized protein LOC100780119 [Glycine max]
Length=230

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEA++ + EKNVK+L LSVDL+KKE+ KL +R  LA  EMK GH+E
Sbjct  99   RRFLFRHTLGRFQSEEARYARIEKNVKDLNLSVDLLKKENAKLLQRTTLAEKEMKYGHTE  158

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L++AGT+ Q LAK+  K E +A DL+D LR IP RE L LRAEVASMAS+L++Q+++++K
Sbjct  159  LVSAGTQFQQLAKSAYKVETRAADLLDKLRYIPSREALALRAEVASMASNLKRQRSSLNK  218

Query  392  RIVKISELGVPV  357
            RI+KI+ELGVPV
Sbjct  219  RIMKINELGVPV  230



>ref|XP_004294933.1| PREDICTED: uncharacterized protein LOC101308945 [Fragaria vesca 
subsp. vesca]
Length=249

 Score =   172 bits (436),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+S EA++ KAEKNV +L LSVDLMK+ES KL ERA  A   MK G ++
Sbjct  118  RRFLFRNTLGRFQSLEAKYAKAEKNVNQLNLSVDLMKQESKKLLERAGYAEKHMKVGQTD  177

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM+ G+RIQSL+K++ K ++QA DLMD LREIP  E LKLR++VA+M S L+ QKA MDK
Sbjct  178  LMDVGSRIQSLSKSMRKVDSQAADLMDGLREIPSGEALKLRSQVAAMTSELKTQKAVMDK  237

Query  392  RIVKISELGVPV  357
             I+KISELG+PV
Sbjct  238  HIMKISELGLPV  249



>ref|XP_003529452.1| PREDICTED: uncharacterized protein LOC100808143 [Glycine max]
Length=231

 Score =   172 bits (435),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEE ++ + EKNVK+L LSVDL+KKES KL +R ALA  EMK GH+E
Sbjct  100  RRFLFRHTLGRFQSEEVRYARTEKNVKDLGLSVDLLKKESVKLLQRTALAEKEMKYGHTE  159

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L++AGT+ Q LAK+  K E +A DL+D LR IP RE L LRAEVASMAS+L++Q+++++K
Sbjct  160  LVSAGTQFQQLAKSAYKVETRAADLLDKLRYIPSREALVLRAEVASMASNLKRQRSSLNK  219

Query  392  RIVKISELGVPV  357
            RI+KI+ELGVPV
Sbjct  220  RIMKINELGVPV  231



>gb|ACU19454.1| unknown [Glycine max]
Length=230

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEA++ + EKNVK+L LSVDL+KKE+ KL +R  LA  EMK GH+E
Sbjct  99   RRFLFRHTLGRFQSEEARYARIEKNVKDLNLSVDLLKKENAKLLQRTTLAEKEMKYGHTE  158

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L++AGT+ Q LAK+  K E +A DL+D LR IP RE L LRAEVASMAS+L++Q+ +++K
Sbjct  159  LVSAGTQFQQLAKSAYKVETRAADLLDKLRYIPSREALALRAEVASMASNLKRQRFSLNK  218

Query  392  RIVKISELGVPV  357
            RI+KI+ELGVPV
Sbjct  219  RIMKINELGVPV  230



>ref|XP_009339217.1| PREDICTED: uncharacterized protein LOC103931455 [Pyrus x bretschneideri]
Length=259

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR T  R +SEEAQF  AEK+VKEL LSVDLMKKES KL ERA LA  +M  GH++
Sbjct  128  RRFLFRQTFRRLQSEEAQFLSAEKSVKELNLSVDLMKKESKKLLERALLAEKDMTYGHND  187

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM+ G +IQ L+K+V+K E+QA+DLMD LREIP RE LKLRAEVASM S L++Q++ +DK
Sbjct  188  LMDVGRQIQHLSKSVHKVESQASDLMDGLREIPNREALKLRAEVASMTSILKRQRSVLDK  247

Query  392  RIVKISELGVPV  357
             I+KISELG+PV
Sbjct  248  HIMKISELGLPV  259



>ref|XP_007157828.1| hypothetical protein PHAVU_002G101500g [Phaseolus vulgaris]
 gb|ESW29822.1| hypothetical protein PHAVU_002G101500g [Phaseolus vulgaris]
Length=241

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 108/139 (78%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR TLGRF+SEEA++ + EK+VK+  LSVDL+KKESGKL +R ALA  EMK GHSE
Sbjct  103  RRFLFRQTLGRFQSEEARYARTEKSVKDFNLSVDLLKKESGKLLQRTALAEKEMKYGHSE  162

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAE-------VASMASHLRQ  414
            L++AG++ Q LAK+  K E +A DL+D LR IP RE L LRAE       VASM S+L+ 
Sbjct  163  LLSAGSQFQQLAKSAYKVENRAIDLLDKLRYIPNREALALRAEASKLYLCVASMVSNLKD  222

Query  413  QKAAMDKRIVKISELGVPV  357
            Q++A++KRIVKI+ELGVPV
Sbjct  223  QRSALNKRIVKINELGVPV  241



>ref|XP_008384350.1| PREDICTED: uncharacterized protein LOC103446960 [Malus domestica]
Length=259

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR T  R +SEEAQF  AEK+VKEL LSVDLM KES KL ERA LA  +M  GH++
Sbjct  128  RRFLFRQTFRRLQSEEAQFLSAEKSVKELNLSVDLMXKESKKLLERALLAEKDMTYGHTD  187

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LM+ G +IQ L K+ +K E+QA+DLMD LREIP RE LKLRAEVASM S L++Q++ +DK
Sbjct  188  LMDVGRQIQHLCKSAHKVESQASDLMDGLREIPNREALKLRAEVASMTSILKRQRSVLDK  247

Query  392  RIVKISELGVPV  357
             I+KISELG+PV
Sbjct  248  HIMKISELGLPV  259



>ref|XP_010673453.1| PREDICTED: uncharacterized protein LOC104889828 [Beta vulgaris 
subsp. vulgaris]
Length=248

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLF++T+GR +SEE QF +AEK+VK L LSVDLMKKES KL ERA+LA  EM  G ++
Sbjct  117  RRFLFQHTVGRLQSEEVQFVRAEKSVKMLELSVDLMKKESRKLLERASLAEKEMINGQTD  176

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            LMNAG  I+ LAK+V++ E QA DL+DLLREIPGRE L+LRAEVAS+AS L+QQ+  + K
Sbjct  177  LMNAGKHIRHLAKSVDQVENQAADLVDLLREIPGREALQLRAEVASVASLLKQQRTGLAK  236

Query  392  RIVKISELGVPV  357
            R +K++E+GVPV
Sbjct  237  RKIKLTEMGVPV  248



>gb|KHN20511.1| hypothetical protein glysoja_029524 [Glycine soja]
Length=237

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 110/139 (79%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEA++ + EKNVK+L LSVDL+KKE+ KL +R  LA  EMK GH+E
Sbjct  99   RRFLFRHTLGRFQSEEARYARIEKNVKDLNLSVDLLKKENAKLLQRTTLAEKEMKYGHTE  158

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAE-------VASMASHLRQ  414
            L++AGT+ Q LAK+  K E +A DL+D LR IP RE L LRAE       VASMAS+L++
Sbjct  159  LVSAGTQFQQLAKSAYKVETRAADLLDKLRYIPSREALALRAEASQLCLIVASMASNLKR  218

Query  413  QKAAMDKRIVKISELGVPV  357
            Q+++++KRI+KI+ELGVPV
Sbjct  219  QRSSLNKRIMKINELGVPV  237



>ref|XP_006829819.1| hypothetical protein AMTR_s00119p00084860 [Amborella trichopoda]
 gb|ERM97235.1| hypothetical protein AMTR_s00119p00084860 [Amborella trichopoda]
Length=292

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+T GR +SEEAQ+ + EK + EL LS+DLMKKES KL +RA  A  EM+RGH++
Sbjct  161  RRFLFRHTFGRLQSEEAQYVRTEKRLTELGLSLDLMKKESKKLLQRATFAEDEMRRGHAK  220

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L NAG  IQ L  +V K E QA DLMD LR IPGRE LKLRAEVASMA  ++++++A+DK
Sbjct  221  LKNAGNEIQRLVNSVYKMEPQAADLMDALRVIPGREALKLRAEVASMACQVKKERSALDK  280

Query  392  RIVKISELGVPV  357
            +++KIS+ G+PV
Sbjct  281  KLLKISDFGIPV  292



>gb|KHN42956.1| hypothetical protein glysoja_007486 [Glycine soja]
Length=264

 Score =   160 bits (404),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 106/132 (80%), Gaps = 5/132 (4%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEE ++ + EKNVK+L LSVDL+KKES KL +R ALA  EMK GH+E
Sbjct  138  RRFLFRHTLGRFQSEEVRYARTEKNVKDLGLSVDLLKKESVKLLQRTALAEKEMKYGHTE  197

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L++AGT+ Q LAK+  K E +A DL+D LR IP RE L     VASMAS+L++Q+++++K
Sbjct  198  LVSAGTQFQQLAKSAYKVETRAADLLDKLRYIPSREAL-----VASMASNLKRQRSSLNK  252

Query  392  RIVKISELGVPV  357
            RI+KI+ELGVPV
Sbjct  253  RIMKINELGVPV  264



>gb|KJB83396.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=239

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  E
Sbjct  111  RRFLFRNTLGRFQSEEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKE  170

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHL  420
            LMN+G +I  LAK+V K EA+A DLMD LREIPGRE LKLRAE AS A H 
Sbjct  171  LMNSGGQIHRLAKSVYKVEAEAVDLMDGLREIPGREALKLRAE-ASPAFHF  220



>gb|KJB83391.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=229

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  E
Sbjct  111  RRFLFRNTLGRFQSEEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKE  170

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASM  432
            LMN+G +I  LAK+V K EA+A DLMD LREIPGRE LKLRAE +  
Sbjct  171  LMNSGGQIHRLAKSVYKVEAEAVDLMDGLREIPGREALKLRAEASCF  217



>ref|XP_006413187.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
 gb|ESQ54640.1| hypothetical protein EUTSA_v10026011mg [Eutrema salsugineum]
Length=245

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 16/132 (12%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEAQF KAEK+V+EL +SVDLMKKES KL ER              
Sbjct  130  RRFLFRHTLGRFQSEEAQFLKAEKHVQELNMSVDLMKKESRKLLER--------------  175

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
              ++G  I  LA +V+K E +ATDLMD LR+IPGRE +KLRAEVASM S LRQ++ A++K
Sbjct  176  --DSGNNIHRLANSVHKVECEATDLMDGLRQIPGREAIKLRAEVASMTSLLRQKRIALNK  233

Query  392  RIVKISELGVPV  357
            RI+++SELGVPV
Sbjct  234  RIMRMSELGVPV  245



>gb|KJB83395.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=237

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  E
Sbjct  111  RRFLFRNTLGRFQSEEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKE  170

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAE  444
            LMN+G +I  LAK+V K EA+A DLMD LREIPGRE LKLRAE
Sbjct  171  LMNSGGQIHRLAKSVYKVEAEAVDLMDGLREIPGREALKLRAE  213



>emb|CAA18229.1| putative protein [Arabidopsis thaliana]
 emb|CAB79496.1| putative protein [Arabidopsis thaliana]
Length=266

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = -2

Query  746  FLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELM  567
             +F +T  +  S +AQF KAEK+V+EL +SVDLMKKES KL ER ALA  +MKRG SELM
Sbjct  138  LIFTST-SKSSSLQAQFLKAEKHVQELNMSVDLMKKESRKLLERTALAEKDMKRGLSELM  196

Query  566  NAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRI  387
            N+G  I  LAK+V+KAE +A DLMD LR+IPGR+ +KLRAEVASM S LRQ++ A++KRI
Sbjct  197  NSGNDIHRLAKSVHKAECEAADLMDGLRQIPGRDAIKLRAEVASMTSLLRQKRIALNKRI  256

Query  386  VKISELGVPV  357
            + +S+LGV V
Sbjct  257  MGMSDLGVSV  266



>gb|KEH30817.1| hypothetical protein MTR_4g083250 [Medicago truncatula]
Length=240

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF+SEEA++  AEKNVK+L LSVDL+KKES KL +R ALA  EMK GHSE
Sbjct  135  RRFLFRHTLGRFQSEEARYASAEKNVKDLNLSVDLLKKESIKLLQRTALAEKEMKYGHSE  194

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVA  438
            LMN G ++Q LAK+  KAEA+ATDL+D LR+IP RE L LRAE +
Sbjct  195  LMNTGAQLQRLAKSSYKAEARATDLIDRLRDIPSREALTLRAEAS  239



>ref|XP_004144065.1| PREDICTED: uncharacterized protein LOC101216418 isoform 2 [Cucumis 
sativus]
 ref|XP_004159355.1| PREDICTED: uncharacterized LOC101216418 isoform 2 [Cucumis sativus]
Length=217

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+TLGRF++EEA F KAEK+VKEL LSVDLMK ES KL ERAALA  +MK GH+E
Sbjct  110  RRFLFRHTLGRFQTEEASFLKAEKHVKELNLSVDLMKNESKKLLERAALAEKDMKYGHNE  169

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPG  471
            LMNAG++IQ L++++ KAEAQA DLMD LREI G
Sbjct  170  LMNAGSQIQRLSRSIYKAEAQAADLMDGLREISG  203



>gb|EEC75159.1| hypothetical protein OsI_11373 [Oryza sativa Indica Group]
Length=195

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNTLGRF++E+   N AE+++ E + S++ +KK+S    ++ A+  ++++RG ++
Sbjct  64   RRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQRGQTD  123

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L + G +I+SL  ++ KAE+ AT LMD LR IP R+ L+LRAEVASMAS L+ Q+  + +
Sbjct  124  LRSTGKQIRSLIGSIYKAESTATGLMDRLRTIPTRQSLELRAEVASMASDLKNQRCVLQE  183

Query  392  RIVKISELGVPV  357
            RI KISE GV V
Sbjct  184  RINKISEYGVRV  195



>ref|NP_001049981.1| Os03g0324800 [Oryza sativa Japonica Group]
 gb|ABF95704.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11895.1| Os03g0324800 [Oryza sativa Japonica Group]
 dbj|BAG92495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87177.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58974.1| hypothetical protein OsJ_10675 [Oryza sativa Japonica Group]
Length=214

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNTLGRF++E+   N AE+++ E + S++ +KK+S    ++ A+  ++++RG ++
Sbjct  83   RRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQRGQTD  142

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L + G +I+SL  ++ KAE+ AT LMD LR IP R+ L+LRAEVASMAS L+ Q+  + +
Sbjct  143  LRSTGKQIRSLIGSIYKAESTATGLMDRLRTIPTRQSLELRAEVASMASDLKNQRCVLQE  202

Query  392  RIVKISELGVPV  357
            RI KISE GV V
Sbjct  203  RINKISEYGVRV  214



>ref|XP_002465337.1| hypothetical protein SORBIDRAFT_01g036710 [Sorghum bicolor]
 gb|EER92335.1| hypothetical protein SORBIDRAFT_01g036710 [Sorghum bicolor]
Length=214

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNT GRF++E+   N AE+++ E + S+  +KKES    ++ A+  ++++RG ++
Sbjct  83   RRFLYRNTFGRFKTEKDLLNDAEQSMMEYKTSIQNLKKESKYTLDKVAVGESDLQRGRTD  142

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L + G +IQSL  ++ KAE+ A  LMD LR IP R+ L+LRAEVASMAS L+ Q+ A+ +
Sbjct  143  LRSTGKQIQSLIGSIYKAESTAAGLMDRLRTIPTRQSLELRAEVASMASDLKNQRCALQE  202

Query  392  RIVKISELGVPV  357
            RI KISE GV V
Sbjct  203  RINKISEYGVRV  214



>ref|XP_010921336.1| PREDICTED: uncharacterized protein LOC105044929 [Elaeis guineensis]
Length=250

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL RNT GR  SE+ +  KAE  +KEL  SV+ +KK+S  +  +A+    +++RGH++
Sbjct  119  RRFLLRNTFGRLVSEQDRSAKAELCLKELSQSVEKLKKDSKNMLLKASWGEQDLQRGHAK  178

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            +  AG  IQ LAK++ K E++ATDLMD LR +PGR  L+LRAEVASMAS L+ Q+  +++
Sbjct  179  IRAAGREIQRLAKSIYKIESEATDLMDGLRALPGRTALQLRAEVASMASDLKNQRRELNE  238

Query  392  RIVKISELGVPV  357
            RI+KISELG+ V
Sbjct  239  RIMKISELGIRV  250



>ref|XP_004984525.1| PREDICTED: uncharacterized protein LOC101782823 isoform X2 [Setaria 
italica]
Length=210

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNT GRF++E+   N AE+++ E + S+  +KKES    ++ A+  ++++RG ++
Sbjct  79   RRFLYRNTFGRFKTEKDLLNDAEESMMEYKTSIANLKKESKYTLDKVAIGESDLQRGQTD  138

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L + G +IQSL  ++ KAE+ A  LMD LR IP R+ L+LRAEVASMAS L+ Q+ A+ +
Sbjct  139  LRSTGKQIQSLIGSIYKAESTAAGLMDRLRTIPTRQSLELRAEVASMASDLKNQRYALQE  198

Query  392  RIVKISELGVPV  357
            RI KISE GV V
Sbjct  199  RINKISEYGVRV  210



>ref|XP_008781206.1| PREDICTED: uncharacterized protein LOC103701046 [Phoenix dactylifera]
Length=248

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL RNT+GR  SE+ +  KAE  +KEL  SVD +KK+S  +  +A+    +++RGH++
Sbjct  117  RRFLVRNTIGRLLSEQDRSAKAELCLKELSQSVDKLKKDSKNMLLKASWGEQDLQRGHTK  176

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            +  AG  IQ LA ++ K E++A DLMD LR +PGR  L+LRAEVASMAS L+ Q+  ++K
Sbjct  177  IRAAGREIQRLANSIYKIESEAADLMDGLRALPGRTALQLRAEVASMASDLKTQRRELNK  236

Query  392  RIVKISELGVPV  357
            RI+KISELG+ V
Sbjct  237  RIMKISELGIRV  248



>ref|XP_004984524.1| PREDICTED: uncharacterized protein LOC101782823 isoform X1 [Setaria 
italica]
Length=214

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNT GRF++E+   N AE+++ E + S+  +KKES    ++ A+  ++++RG ++
Sbjct  83   RRFLYRNTFGRFKTEKDLLNDAEESMMEYKTSIANLKKESKYTLDKVAIGESDLQRGQTD  142

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L + G +IQSL  ++ KAE+ A  LMD LR IP R+ L+LRAEVASMAS L+ Q+ A+ +
Sbjct  143  LRSTGKQIQSLIGSIYKAESTAAGLMDRLRTIPTRQSLELRAEVASMASDLKNQRYALQE  202

Query  392  RIVKISELGVPV  357
            RI KISE GV V
Sbjct  203  RINKISEYGVRV  214



>ref|XP_006650015.1| PREDICTED: uncharacterized protein LOC102714271 [Oryza brachyantha]
Length=214

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNTLGRF++E+   N AE+++ E + S+  +KK+S    ++ A+  ++++RG ++
Sbjct  83   RRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIKQLKKDSKYTLDKIAIGESDLQRGQTD  142

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
              + G +I+SL  ++ KAE+ AT LMD LR IP R+ L+LRAEVASMAS L+ Q+  +++
Sbjct  143  FRSTGKQIRSLISSIYKAESTATGLMDRLRTIPTRQSLELRAEVASMASDLKGQRYVLEE  202

Query  392  RIVKISELGVPV  357
            RI KISE GV V
Sbjct  203  RINKISEYGVRV  214



>ref|XP_008670078.1| PREDICTED: uncharacterized protein LOC100276044 isoform X1 [Zea 
mays]
 gb|ACF85910.1| unknown [Zea mays]
 gb|ACG28462.1| hypothetical protein [Zea mays]
 gb|ACG32171.1| hypothetical protein [Zea mays]
 tpg|DAA45114.1| TPA: hypothetical protein ZEAMMB73_628651 [Zea mays]
Length=214

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNT GR ++E+   N AE+++ E + S+  +KKES    ++ A+  ++++RG ++
Sbjct  83   RRFLYRNTFGRLKTEKDLLNDAEQSMMEYQTSIQNLKKESKYTLDKVAIGESDVQRGRTD  142

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L + G +IQSL  ++ KAE+ A  LMD LR IP R+ L+LRAEVASMAS L+ Q+ A+ +
Sbjct  143  LRSTGKQIQSLIGSIYKAESTAAGLMDRLRTIPTRQSLELRAEVASMASDLKNQRCALQE  202

Query  392  RIVKISELGVPV  357
            RI KISE GV V
Sbjct  203  RINKISEYGVRV  214



>ref|XP_003558009.1| PREDICTED: uncharacterized protein LOC100838509 [Brachypodium 
distachyon]
Length=214

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNTLGRF++E+   N AE+++ E + S++ ++KES    ++  +  ++++RG ++
Sbjct  83   RRFLYRNTLGRFKTEKDLLNDAEQSMIEYKTSIENLRKESKYTLDKVVIGESDLQRGRTD  142

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L + G +IQS+  ++ KAE+ A  LMD LR IP R+ L+LRAEVASMAS L+ Q+  +++
Sbjct  143  LRSTGKQIQSVISSIYKAESTAAGLMDRLRTIPTRQSLELRAEVASMASDLKSQRYVLEE  202

Query  392  RIVKISELGVPV  357
            R+ +ISE GV V
Sbjct  203  RVNRISEYGVRV  214



>dbj|BAK05826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNTLGRF++E+   N  E+++ E + S++ ++K+S    ++  +  ++++RG ++
Sbjct  83   RRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQRGRTD  142

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L + G +IQS+  ++ KAE+ A  LMD LR IP R+ L+LRAEVASMAS L+ Q+  +++
Sbjct  143  LRSTGKQIQSVISSIYKAESTAAGLMDRLRIIPTRQSLELRAEVASMASDLKNQRHVLEE  202

Query  392  RIVKISELGVPV  357
            R+ +ISE GV V
Sbjct  203  RVNRISEYGVRV  214



>ref|XP_001760783.1| predicted protein [Physcomitrella patens]
 gb|EDQ74522.1| predicted protein [Physcomitrella patens]
Length=387

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 94/139 (68%), Gaps = 7/139 (5%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR L+R T+G+FRSEEA   +AE  VKE+  +VD +K E+ KL ERA LA  E  RG ++
Sbjct  175  RRLLYRYTIGQFRSEEAMLTRAETKVKEMHQTVDSLKNETKKLEERAKLAEEEFLRGMTK  234

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAE-------VASMASHLRQ  414
            L N+G++I SL++   K E+ A  LMD LR++PGRE L+LRAE       VASMAS ++Q
Sbjct  235  LKNSGSQISSLSRGAYKTESSARGLMDSLRDLPGREALRLRAEGYDYDALVASMASEVKQ  294

Query  413  QKAAMDKRIVKISELGVPV  357
            Q+  +DKR+ +I+   + +
Sbjct  295  QRNLLDKRVSQIASYALKI  313



>ref|XP_009393907.1| PREDICTED: uncharacterized protein LOC103979471 [Musa acuminata 
subsp. malaccensis]
Length=212

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+R TLGRF++EE +   AE  ++E+  SV  +KKES  L  + +    ++ RG ++
Sbjct  81   RRFLYRKTLGRFKTEEERLTDAESFLREINESVTKLKKESKNLLTKVSYGEEDLHRGRTK  140

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            +  AG  IQ L K++ K E++A DLM+ LR IPGR  L+LRAEVA M S L+ Q+  +++
Sbjct  141  IRAAGHEIQRLNKSIYKIESEAADLMEELRTIPGRTALELRAEVAPMTSSLKNQRLELNE  200

Query  392  RIVKISELGVPV  357
            R+ KISELG+ V
Sbjct  201  RVTKISELGIRV  212



>gb|KJB83394.1| hypothetical protein B456_013G245200 [Gossypium raimondii]
Length=193

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFRNTLGRF+SEEA+F++AEKNVK L LSVDLMKKES KL ERAALA  +MKRG  E
Sbjct  111  RRFLFRNTLGRFQSEEAKFSRAEKNVKVLNLSVDLMKKESSKLLERAALAEKDMKRGQKE  170

Query  572  LMNAGTRIQSLAKAVNKAEAQA  507
            LMN+G +I  LAK+V K EA+A
Sbjct  171  LMNSGGQIHRLAKSVYKVEAEA  192



>gb|KDP28809.1| hypothetical protein JCGZ_14580 [Jatropha curcas]
Length=264

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 91/132 (69%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ NTL  F SEE+  ++A+  VKELR S+ L+K ES K+ +RA+LA TE+ RG ++
Sbjct  133  RRFLYYNTLRLFVSEESLLSQADAKVKELRQSISLLKAESEKIEKRASLAETELIRGRTK  192

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQ + ++  K E QA  L D+LR++P RE  + R++V+S++S  +Q+K A+ K
Sbjct  193  LRQAGKQIQGVIRSAYKIEKQAAGLKDVLRDLPSREASRFRSKVSSLSSEAKQEKNALTK  252

Query  392  RIVKISELGVPV  357
             I KIS  G+ V
Sbjct  253  EITKISNYGISV  264



>ref|XP_010053946.1| PREDICTED: uncharacterized protein LOC104442278 [Eucalyptus grandis]
 gb|KCW78322.1| hypothetical protein EUGRSUZ_D02501 [Eucalyptus grandis]
Length=268

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ NTL    SEE+  ++A+  VKELR S+DL+K ES KL  RA LA  EM RG ++
Sbjct  137  RRFLYYNTLRLLMSEESMLSRADAKVKELRKSIDLLKAESEKLERRAQLAEEEMLRGRTK  196

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQS++ +  K E QA  L D++RE+P RE  + R++V+++AS  ++++ A+ K
Sbjct  197  LRQAGKQIQSVSHSAYKIERQAAGLKDVIRELPRREASRFRSQVSNLASEAKRERNALTK  256

Query  392  RIVKISELGVPV  357
             + KI++ G+ V
Sbjct  257  EVSKITDYGISV  268



>ref|XP_011017444.1| PREDICTED: uncharacterized protein LOC105120771 [Populus euphratica]
Length=270

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR L+  TL  F SEEA  ++A+  VKELR S+ L+K ES KL  RA+LA  E+ RG ++
Sbjct  139  RRILYYKTLRLFTSEEALLSQADAKVKELRQSISLLKAESEKLERRASLAEEELIRGRTK  198

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQ + ++  K E QAT L D+LRE+P  E  K R++V+S+AS  +Q++ A+ K
Sbjct  199  LRQAGKQIQGVIRSAYKIERQATGLRDILRELPRAEASKFRSQVSSLASEAKQERNALSK  258

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  259  EVTKISNHGISV  270



>ref|XP_002302514.1| hypothetical protein POPTR_0002s14390g [Populus trichocarpa]
 gb|EEE81787.1| hypothetical protein POPTR_0002s14390g [Populus trichocarpa]
Length=270

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR L+  TL  F SEEA  ++A+  VKELR S+ L+K ES KL  RA+LA  E+ RG ++
Sbjct  139  RRILYYKTLRLFTSEEALLSQADAKVKELRQSISLLKAESEKLERRASLAEEELIRGRTK  198

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQ + ++  K E QAT L D+LRE+P  E  K R++V+S+AS  +Q++ A+ K
Sbjct  199  LRQAGKQIQGVIRSAYKIERQATGLRDILRELPRAEASKFRSQVSSLASEAKQERNALSK  258

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  259  EVAKISNHGISV  270



>ref|XP_010524407.1| PREDICTED: uncharacterized protein LOC104802474 [Tarenaya hassleriana]
Length=269

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ +TL  F SEEA  ++A+  VKELR S+D +K ES KL  R  +A  E+ RG  +
Sbjct  138  RRFLYYSTLRIFSSEEALLSQADLKVKELRQSIDRLKAESEKLERRTTVAEQELIRGRMK  197

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQ +  +  K E QA  L DLL+E+P RE  + R++V+++AS  +Q++ A+ K
Sbjct  198  LRQAGKQIQGVIHSAYKTEKQAAGLKDLLKELPRREASRFRSQVSNLASEAKQERNALTK  257

Query  392  RIVKISELGVPV  357
             + KIS  G+PV
Sbjct  258  EVNKISNYGIPV  269



>ref|XP_002277999.1| PREDICTED: uncharacterized protein LOC100266783 [Vitis vinifera]
 emb|CBI16597.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R FL+ NTL    SEE+   +A+  V ELR S+DL+K ES KL +RA  A  EMKRG ++
Sbjct  129  RHFLYYNTLRLLVSEESMVARADAKVNELRKSIDLLKAESEKLEKRALQAEDEMKRGRTK  188

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQS+ ++  K E QA  L D+L E+P RE  + R++V+ +AS  +++++A+ K
Sbjct  189  LRQAGNQIQSVIRSAYKIERQARGLKDILGELPSREASRFRSQVSKLASEAKRERSALSK  248

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  249  EVSKISNYGISV  260



>gb|KDO54525.1| hypothetical protein CISIN_1g025242mg [Citrus sinensis]
Length=255

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+T GR RSEEA F +AEKNV EL LS +LMKKES KL ERAALA  EM RG +E
Sbjct  112  RRFLFRHTFGRLRSEEAMFVRAEKNVNELNLSGELMKKESKKLLERAALAEKEMIRGETE  171

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLL  486
            L NAG ++Q LAK V K E QA  ++  +
Sbjct  172  LKNAGNQVQRLAKQVYKVETQAAGIVGCI  200



>gb|AIA26010.1| hypothetical protein, partial [Phyllostachys edulis]
Length=116

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -2

Query  698  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKA  519
             N AE+ + E + S++ +KK+S    ++ A+  ++++RG ++L   G +IQSL  ++ KA
Sbjct  3    LNDAEQCMMEYKTSIETLKKDSKYTLDKIAIGESDLQRGRTDLRATGKQIQSLISSIYKA  62

Query  518  EAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVKISELGVPV  357
            E+ A  L+  LR IP R+ L+LRAEVASMAS L+ Q+  +++RI KISE GVPV
Sbjct  63   ESTAAGLVAQLRTIPTRQSLELRAEVASMASDLKNQRCVLEERINKISEYGVPV  116



>ref|XP_002511643.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50312.1| conserved hypothetical protein [Ricinus communis]
Length=267

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ NTL  F SEEA  +KA+  VKEL+ S+ L++ ES KL +RA+ A  E+ RG ++
Sbjct  136  RRFLYYNTLRLFVSEEALLSKADAKVKELQQSISLLRAESEKLEKRASSAEGELIRGRTK  195

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I  +  +  K E QA  L D++RE+P RE  + R++V+S+A+  ++++ A+ K
Sbjct  196  LRQAGKQICGVITSTYKIERQAAGLKDIIRELPSREASRFRSQVSSLATEAKRERNALTK  255

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  256  EVTKISNYGISV  267



>gb|AIA26008.1| hypothetical protein, partial [Phyllostachys nidularia]
Length=116

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -2

Query  698  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKA  519
             N AE+ + E + S++ +KK+S    ++ A+  ++++RG ++L   G +IQSL  ++ KA
Sbjct  3    LNDAEQCMMEYKTSIETLKKDSKYTLDKIAIGESDLQRGRTDLRATGKQIQSLISSIYKA  62

Query  518  EAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVKISELGVPV  357
            E+ A  L+  LR IP R+ L+LRAEVASMAS L+ Q+  +++RI KISE GVPV
Sbjct  63   ESTAAGLVAQLRTIPTRQSLELRAEVASMASDLKNQRYVLEERINKISEYGVPV  116



>ref|XP_010258900.1| PREDICTED: uncharacterized protein LOC104598502 [Nelumbo nucifera]
Length=250

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R FL+ +TL  F SEE+   +A+  VK LR S+ LMK ES KL +RA  A  EMKRG ++
Sbjct  119  RLFLYHSTLRLFMSEESLLARADSKVKALRQSIALMKAESEKLEKRALQAEQEMKRGRTK  178

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQ + ++  K E QA  L D+L+E+P RE  + R++V+S+AS  ++++ A+ K
Sbjct  179  LRQAGNQIQGVIRSAYKIERQARGLKDILKELPSREASRFRSQVSSLASEAKRERNALTK  238

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  239  EVSKISNYGISV  250



>gb|AIA26006.1| hypothetical protein, partial [Fargesia nitida]
Length=116

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -2

Query  698  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKA  519
             N AE+++ E + S++ +KK+S    ++ A+  ++++RG ++L   G +IQSL  ++ KA
Sbjct  3    LNDAEQSMMEYKTSLETLKKDSKYTLDKIAIGESDLQRGRTDLRATGKQIQSLISSIYKA  62

Query  518  EAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVKISELGVPV  357
            E+ A  L+  LR IP R+ L+LRAEVASMAS L+ Q+  +++RI KISE GVPV
Sbjct  63   ESTAAGLVAQLRTIPTRQSLELRAEVASMASDLKNQRYVLEERINKISEYGVPV  116



>gb|AIA26007.1| hypothetical protein, partial [Fargesia spathacea]
Length=116

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -2

Query  698  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKA  519
             N AE+++ E + S++ +KK+S    ++ A+  ++++RG ++L   G +IQSL  ++ KA
Sbjct  3    LNDAEQSMMEYKTSLESLKKDSKYTLDKIAIGESDLQRGRTDLRATGKQIQSLISSIYKA  62

Query  518  EAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVKISELGVPV  357
            E+ A  L+  LR IP R+ L+LRAEVASMAS L+ Q+  +++RI KISE GVPV
Sbjct  63   ESTAAGLVAQLRTIPTRQSLELRAEVASMASDLKNQRYVLEERINKISEYGVPV  116



>ref|XP_007052188.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX96345.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=284

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ NTL  F SEE+  +KA+  VKELR S+D +K ES KL   A++A  ++ RG  +
Sbjct  153  RRFLYYNTLRLFVSEESWLSKADIRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKK  212

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L +AG +IQS+  +  K E QA  L D+L E+P RE  + R++V+++AS  ++++ A+ K
Sbjct  213  LRHAGKQIQSVIHSAYKIERQAAGLKDILGELPSREASRFRSQVSNLASEAKRERNALAK  272

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  273  EVSKISNYGIAV  284



>ref|XP_007052191.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX96348.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=278

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ NTL  F SEE+  +KA+  VKELR S+D +K ES KL   A++A  ++ RG  +
Sbjct  147  RRFLYYNTLRLFVSEESWLSKADIRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKK  206

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L +AG +IQS+  +  K E QA  L D+L E+P RE  + R++V+++AS  ++++ A+ K
Sbjct  207  LRHAGKQIQSVIHSAYKIERQAAGLKDILGELPSREASRFRSQVSNLASEAKRERNALAK  266

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  267  EVSKISNYGIAV  278



>gb|EEC75161.1| hypothetical protein OsI_11375 [Oryza sativa Indica Group]
Length=192

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNTLGRF++E+   N AE+++ E + S++ +KK+S    ++ A+  ++++RG ++
Sbjct  83   RRFLYRNTLGRFKTEKDLLNDAEQSMMEYKTSIEQLKKDSKYTLDKIAVGESDLQRGQTD  142

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASH  423
            L + G +I+SL  ++ KAE+ AT LMD LR IP R+ L+LRAE ++ A +
Sbjct  143  LRSTGKQIRSLIGSIYKAESTATGLMDRLRTIPTRQSLELRAETSNHAQY  192



>ref|NP_001143401.1| uncharacterized protein LOC100276044 [Zea mays]
 gb|ACF83116.1| unknown [Zea mays]
 gb|ACG31730.1| hypothetical protein [Zea mays]
 tpg|DAA45115.1| TPA: hypothetical protein ZEAMMB73_628651 [Zea mays]
Length=107

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = -2

Query  671  ELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKAEAQATDLMD  492
            E + S+  +KKES    ++ A+  ++++RG ++L + G +IQSL  ++ KAE+ A  LMD
Sbjct  3    EYQTSIQNLKKESKYTLDKVAIGESDVQRGRTDLRSTGKQIQSLIGSIYKAESTAAGLMD  62

Query  491  LLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVKISELGVPV  357
             LR IP R+ L+LRAEVASMAS L+ Q+ A+ +RI KISE GV V
Sbjct  63   RLRTIPTRQSLELRAEVASMASDLKNQRCALQERINKISEYGVRV  107



>ref|XP_009776946.1| PREDICTED: uncharacterized protein LOC104226615 [Nicotiana sylvestris]
Length=274

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ + +  F SEEA  ++A+  VKEL+ S+D +K ES KL  RA  A  EM RG ++
Sbjct  143  RRFLYYSAMRLFVSEEALLSRADAKVKELQKSIDFLKAESAKLENRAVQAEGEMIRGRTK  202

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+S+ ++  + E QA  L D+LRE+P RE  + R++V+++AS  ++++  + K
Sbjct  203  LRQAGKQIRSVIQSAYRIERQAAGLKDVLRELPRREVSRFRSQVSNLASEAKKERNVLTK  262

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  263  EVTKISNYGISV  274



>ref|XP_008232561.1| PREDICTED: uncharacterized protein LOC103331692 [Prunus mume]
Length=264

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 85/132 (64%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR L+  TL  F SEE+  ++A+  VKELR S+DL+K E  KL +RA+ A  E+ RG ++
Sbjct  133  RRMLYHKTLRLFVSEESLLSRADAKVKELRHSIDLLKAEGEKLEKRASHAEEELIRGRTK  192

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L + G +I+S+ ++  K E QA  L D+L E+P RE    R++V+ +A+  +Q++ A+ K
Sbjct  193  LRHTGKQIESVIRSAYKIERQAAGLKDILGELPRREASMFRSQVSKLATEAKQERNALTK  252

Query  392  RIVKISELGVPV  357
             I KIS  G+ V
Sbjct  253  EITKISNYGISV  264



>ref|XP_009133693.1| PREDICTED: uncharacterized protein LOC103858149 [Brassica rapa]
Length=275

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 85/132 (64%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF++ NTL  F SEEA  ++A+  VKELR S+D +  ES KL   + +A  E+ RG  +
Sbjct  144  RRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRLTAESEKLERISTVAEDELIRGRMK  203

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+ + ++  K E QA  L DLL+E+P RE  + R+++++ AS ++Q++ A+ K
Sbjct  204  LRQAGKQIRGVVQSAYKIENQAAGLKDLLKELPTREASRFRSQISNRASEIKQERKALTK  263

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  264  EVNKISNYGISV  275



>ref|XP_007052189.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX96346.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=285

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ NTL  F SEE+  +KA+  VKELR S+D +K ES KL   A++A  ++ RG  +
Sbjct  153  RRFLYYNTLRLFVSEESWLSKADIRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKK  212

Query  572  LMNAGTRIQSLAKAVNKAEAQ-ATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMD  396
            L +AG +IQS+  +  K E Q A  L D+L E+P RE  + R++V+++AS  ++++ A+ 
Sbjct  213  LRHAGKQIQSVIHSAYKIERQAAAGLKDILGELPSREASRFRSQVSNLASEAKRERNALA  272

Query  395  KRIVKISELGVPV  357
            K + KIS  G+ V
Sbjct  273  KEVSKISNYGIAV  285



>emb|CDX83410.1| BnaA03g20960D [Brassica napus]
Length=223

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 85/132 (64%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF++ NTL  F SEEA  ++A+  VKELR S+D +  ES KL   + +A  E+ RG  +
Sbjct  92   RRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRLTAESEKLERISTVAEDELIRGRMK  151

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+ + ++  K E QA  L D+L+E+P RE  + R+++++ AS ++Q++ A+ K
Sbjct  152  LRQAGKQIRGVVQSAYKIENQAEGLKDVLKELPTREASRFRSQISNRASEIKQERKALTK  211

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  212  EVNKISNYGISV  223



>ref|XP_006347915.1| PREDICTED: uncharacterized protein LOC102584275 [Solanum tuberosum]
Length=266

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ + +  F  EEA  ++A+  VKEL+ S+DL+K ES KL  +A  A  EM RG ++
Sbjct  135  RRFLYYSAMRLFVREEALLSRADAKVKELQKSIDLLKAESAKLENQAIQAEGEMIRGRTK  194

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+S+ ++  K E QAT L D+L+E+P RE    R++V+++AS  ++++  + K
Sbjct  195  LRQAGKQIRSVIQSAYKIERQATGLQDVLKELPRREVALFRSQVSNLASEAKKERNVLTK  254

Query  392  RIVKISELGVPV  357
             + KIS  G+ +
Sbjct  255  EVTKISNYGISI  266



>ref|XP_006397686.1| hypothetical protein EUTSA_v10001582mg [Eutrema salsugineum]
 gb|ESQ39139.1| hypothetical protein EUTSA_v10001582mg [Eutrema salsugineum]
Length=275

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 84/132 (64%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF++ NT+  F SEEA  ++A+  VKELR S+D +  ES KL   A +A  E+ RG  +
Sbjct  144  RRFVYYNTIRMFLSEEALLSRADLRVKELRQSMDRLTAESEKLERVATVAEDELIRGRMK  203

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+ +  +  K E QA  L D+L+E+P RE  + R++++S AS ++Q++ A+ K
Sbjct  204  LRQAGKQIRGVVSSAYKIEKQAAGLKDVLKELPTREASRFRSQISSRASEIKQERNALTK  263

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  264  EVNKISNYGISV  275



>ref|XP_004229779.1| PREDICTED: uncharacterized protein LOC101267648 [Solanum lycopersicum]
Length=266

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ + +  F  EEA  ++A+  VKEL+ S+DL+K ES KL  +A  A  EM RG ++
Sbjct  135  RRFLYYSAMRLFVREEALLSRADAKVKELQKSIDLLKAESAKLENQAIQAEGEMIRGRTK  194

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+S+ ++ +K E QAT L D+L+E P RE    R++V+++AS  ++++  + K
Sbjct  195  LRQAGKQIRSVIQSAHKIERQATGLQDVLKEFPRREVSLFRSQVSNLASEAKKERNVLTK  254

Query  392  RIVKISELGVPV  357
             + KIS  G+ +
Sbjct  255  EVTKISNYGISI  266



>ref|XP_001771369.1| predicted protein [Physcomitrella patens]
 gb|EDQ63759.1| predicted protein [Physcomitrella patens]
Length=342

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR L+R T+GRF++E+A   +AE  VKE+R +VDL++ E+ KL ERA LA  E+ RG S+
Sbjct  154  RRMLYRYTIGRFQNEQALLARAETKVKEMRQTVDLLRNETKKLEERARLAEEELLRGRSK  213

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L N+G ++++L+++  K E+ A  L D L ++PGRE ++LR EVA+M S  +Q +  +DK
Sbjct  214  LKNSGYQLRNLSRSAYKTESAARGLKDNLVDLPGRESIRLRTEVAAMTSLAKQHRKILDK  273

Query  392  RIVKIS  375
            R+ KI+
Sbjct  274  RVSKIA  279



>ref|XP_006445337.1| hypothetical protein CICLE_v10021755mg [Citrus clementina]
 ref|XP_006490844.1| PREDICTED: uncharacterized protein LOC102630500 [Citrus sinensis]
 gb|ESR58577.1| hypothetical protein CICLE_v10021755mg [Citrus clementina]
 gb|KDO85658.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=261

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 85/132 (64%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R FL+ NTL  F SEE+  ++A+  VK+LR S+D +K ES KL + A +A  E+ RG ++
Sbjct  130  RHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLKAESEKLEKVALVAEDELIRGRTK  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQ +  +  K E QA  L D++ E+P RE  + R++V+++AS  ++++ A+ K
Sbjct  190  LRQAGKQIQGVINSAYKIERQAAGLKDIVGELPRREASRFRSQVSNIASEAKRERNALTK  249

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  250  EVSKISNYGISV  261



>gb|EMT21115.1| hypothetical protein F775_32566 [Aegilops tauschii]
Length=211

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNTLGRF++E+   N  E+++ E + S++ ++K+S    ++  +  ++++RG ++
Sbjct  102  RRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQRGRTD  161

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMA  429
            L + G +IQS+ +++ KAE+ A  LMD LR IP R+ L+LRAE + +A
Sbjct  162  LRSTGKQIQSVIRSIYKAESTAAGLMDQLRIIPTRQSLELRAEASEIA  209



>gb|KFK37300.1| hypothetical protein AALP_AA4G239300 [Arabis alpina]
Length=272

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 81/132 (61%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF++ NTL    SEEA F++A+  VKELR S+D +  ES KL   A +A  E  RG  +
Sbjct  141  RRFVYHNTLRMVMSEEALFSRADLKVKELRQSMDRLIAESDKLERVATVAEEEFIRGRLK  200

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I    ++  K E QA  L D+L+E+P RE  + R ++++ AS ++Q++ AM K
Sbjct  201  LRQAGKQIHGAIRSAYKIEKQAAGLKDVLKELPTREASRFRTQISNRASEVKQERNAMTK  260

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  261  EVNKISNYGISV  272



>gb|KHG03984.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=266

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 84/132 (64%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R  L+  TL  F+SEE+  +KA+  VKELR S+D +K ES KL   A++A  E+ RG ++
Sbjct  135  RHLLYYKTLRLFQSEESLISKADIRVKELRQSIDRLKAESEKLERSASVAEDELIRGRTK  194

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+S+ ++  K E QA  L D L E+P RE  + R++V+S+AS  ++++  + K
Sbjct  195  LRQAGKQIRSVIQSAYKIERQAAGLKDTLGELPSREASRFRSQVSSLASQAKRERNVLTK  254

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  255  EVSKISNHGIAV  266



>ref|NP_566034.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK73943.1| At2g45060/T14P1.13 [Arabidopsis thaliana]
 gb|AAM62665.1| unknown [Arabidopsis thaliana]
 gb|AAN28847.1| At2g45060/T14P1.13 [Arabidopsis thaliana]
 gb|AEC10501.1| uncharacterized protein AT2G45060 [Arabidopsis thaliana]
Length=272

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 81/132 (61%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF++ NT+  F SEEA  ++A+  VKELR S+D +K ES KL   A +A  E  RG  +
Sbjct  141  RRFVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLKAESEKLERVATVAEEEFIRGRMK  200

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+    +  K E QA  L D+L+E+P RE  + R +++  AS ++Q++ A+ K
Sbjct  201  LRQAGKQIRGAISSAYKIEKQAAGLKDVLKELPTREASRFRTQISKRASEVKQERNALTK  260

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  261  EVNKISNYGISV  272



>ref|XP_002881994.1| hypothetical protein ARALYDRAFT_903941 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58253.1| hypothetical protein ARALYDRAFT_903941 [Arabidopsis lyrata subsp. 
lyrata]
Length=272

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R+F++ NT+  F SEEA  ++A+  VKELR S+D +K ES KL   A +A  E+ RG  +
Sbjct  141  RKFVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLKAESEKLERVATVAEEELIRGRMK  200

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+    +  K E QA  L D+L+E+P RE  + R ++++ AS ++Q++ A+ K
Sbjct  201  LRQAGKQIRGAISSAYKIEKQAAGLKDVLKELPTREASRFRTQISNRASEVKQERNALTK  260

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  261  EVNKISNYGISV  272



>ref|XP_002983323.1| hypothetical protein SELMODRAFT_445444 [Selaginella moellendorffii]
 gb|EFJ15665.1| hypothetical protein SELMODRAFT_445444 [Selaginella moellendorffii]
Length=403

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = -2

Query  737  RNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  558
            + TLGRFRS+EA    A+K V ELR +++L K E  KL ER  LA  E  RG S++ NAG
Sbjct  277  KYTLGRFRSQEAMAASAQKKVVELREALELQKNEKRKLEERFRLAEDEFLRGQSKMANAG  336

Query  557  TRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVKI  378
            ++I+SL K++ K E  A  L++ LR++ G+    LRAEVASMAS  +  ++++D+ + +I
Sbjct  337  SQIRSLVKSMYKTENHAQGLLEKLRDMSGKPAFHLRAEVASMASEAKAHRSSLDRNLYRI  396

Query  377  S  375
            +
Sbjct  397  A  397



>ref|XP_006838189.1| hypothetical protein AMTR_s00106p00135890 [Amborella trichopoda]
 gb|ERN00758.1| hypothetical protein AMTR_s00106p00135890 [Amborella trichopoda]
Length=263

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR+LF +    F SEE+    AE  VKELR S++L+K ES KL ERA LA  EM+RG ++
Sbjct  132  RRYLFNSVQRLFVSEESMLASAEAKVKELRQSIELVKNESKKLEERARLAEEEMRRGQTK  191

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L +AG +IQ+   +  K E QA  L D+L E+P RE  + R++V+ MAS  ++++ A+ K
Sbjct  192  LRHAGHQIQTAIHSAYKIEKQARGLKDILGELPRREASRFRSQVSKMASEAKRERDALGK  251

Query  392  RIVKISELGVPV  357
             + KI+  G+P+
Sbjct  252  EVTKITNYGIPI  263



>ref|XP_002987624.1| hypothetical protein SELMODRAFT_447060 [Selaginella moellendorffii]
 gb|EFJ11199.1| hypothetical protein SELMODRAFT_447060 [Selaginella moellendorffii]
Length=403

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = -2

Query  737  RNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAG  558
            + TLGRFRS+EA    A+K V ELR +++L K E  KL ER  LA  E  RG S++ NAG
Sbjct  277  KYTLGRFRSQEAMAASAQKKVVELREALELQKNERRKLEERFRLAEDEFLRGQSKMANAG  336

Query  557  TRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVKI  378
            ++I+SL K++ K E  A  L++ LR++ G+    LRAEVASMAS  +  ++++D+ + +I
Sbjct  337  SQIRSLVKSMYKTENHAQGLLEKLRDMSGKPAFHLRAEVASMASEAKAHRSSLDRNLYRI  396

Query  377  S  375
            +
Sbjct  397  A  397



>ref|XP_009339857.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339858.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339859.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
 ref|XP_009339860.1| PREDICTED: uncharacterized protein LOC103932041 [Pyrus x bretschneideri]
Length=262

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  FRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNA  561
            +   L  F SEE+  ++A+  VKELR S+DL+K ES KL +RA  A  E+ RG ++L   
Sbjct  135  YHKALRLFVSEESLLSRADAKVKELRHSIDLLKAESEKLEKRALHAEEELTRGRTKLRQT  194

Query  560  GTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVK  381
            G +IQS+ ++  KAE QA  L D+L E+P RE    R++V+ +A+  ++++ A+ K + K
Sbjct  195  GKQIQSVIRSAYKAERQAAGLKDILGELPRREAAVFRSQVSKLATEAKKERNALSKEVTK  254

Query  380  ISELGVPV  357
            IS  G+ V
Sbjct  255  ISNYGISV  262



>ref|XP_009337245.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
 ref|XP_009337246.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
 ref|XP_009337247.1| PREDICTED: uncharacterized protein LOC103929743 [Pyrus x bretschneideri]
Length=262

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  FRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNA  561
            +   L  F SEE+  ++A+  VKELR S+DL+K ES KL +RA  A  E+ RG ++L   
Sbjct  135  YHKALRLFVSEESLLSRADAKVKELRHSIDLLKAESEKLEKRALHAEEELTRGRTKLRQT  194

Query  560  GTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVK  381
            G +IQS+ ++  KAE QA  L D+L E+P RE    R++V+ +A+  ++++ A+ K + K
Sbjct  195  GKQIQSVIRSAYKAERQAAGLKDILGELPRREAAVFRSQVSKLATEAKKERNALSKEVTK  254

Query  380  ISELGVPV  357
            IS  G+ V
Sbjct  255  ISNYGISV  262



>gb|KJB09928.1| hypothetical protein B456_001G175600 [Gossypium raimondii]
Length=273

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 84/132 (64%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R  L+  TL  F+SEE+  +KA+  VKELR S+D +K ES KL   A++A  E+ RG ++
Sbjct  142  RHLLYYKTLRLFQSEESLISKADIRVKELRQSIDRLKAESEKLERSASVAEDELIRGRTK  201

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+S+ ++  K E QA  L D L E+P RE  + R++V+++AS  ++++  + K
Sbjct  202  LRQAGKQIRSVIQSAYKIERQAAGLKDTLGELPSREASRFRSQVSNLASQAKRERNVLTK  261

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  262  EVSKISNHGIAV  273



>ref|XP_009142315.1| PREDICTED: uncharacterized protein LOC103866188 [Brassica rapa]
Length=279

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF++ N +  F +EEA  ++A+  VKELR S+D +  ES KL   A +A  E+ RG  +
Sbjct  148  RRFVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKLERVATVAEDELIRGRMK  207

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+ +  +  K E QA  L D+L+E+P RE  + R+++++ AS ++Q++ A+ K
Sbjct  208  LRQAGKQIRGVVNSAYKIEKQAAGLKDVLKELPTREASRFRSQISNRASEVKQERKALTK  267

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  268  EVNKISNYGISV  279



>gb|KJB09931.1| hypothetical protein B456_001G175600 [Gossypium raimondii]
Length=275

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 84/132 (64%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R  L+  TL  F+SEE+  +KA+  VKELR S+D +K ES KL   A++A  E+ RG ++
Sbjct  144  RHLLYYKTLRLFQSEESLISKADIRVKELRQSIDRLKAESEKLERSASVAEDELIRGRTK  203

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+S+ ++  K E QA  L D L E+P RE  + R++V+++AS  ++++  + K
Sbjct  204  LRQAGKQIRSVIQSAYKIERQAAGLKDTLGELPSREASRFRSQVSNLASQAKRERNVLTK  263

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  264  EVSKISNHGIAV  275



>emb|CDY37025.1| BnaA04g26030D [Brassica napus]
Length=279

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF++ N +  F +EEA  ++A+  VKELR S+D +  ES KL   A +A  E+ RG  +
Sbjct  148  RRFVYYNAVRMFSTEEALLSRADLRVKELRQSLDRLTAESEKLERVATVAEDELIRGRMK  207

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+ +  +  K E QA  L D+L+E+P RE  + R+++++ AS ++Q++ A+ K
Sbjct  208  LRQAGKQIRGVVNSAYKIEKQAAGLKDVLKELPTREASRFRSQISNRASEVKQERKALTK  267

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  268  EVNKISNYGISV  279



>gb|KCW78323.1| hypothetical protein EUGRSUZ_D02501 [Eucalyptus grandis]
Length=270

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ NTL    SEE+  ++A+  VKELR S+DL+K ES KL  RA LA  EM RG ++
Sbjct  137  RRFLYYNTLRLLMSEESMLSRADAKVKELRKSIDLLKAESEKLERRAQLAEEEMLRGRTK  196

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMAS  426
            L  AG +IQS++ +  K E QA  L D++RE+P RE  + R++V+ + S
Sbjct  197  LRQAGKQIQSVSHSAYKIERQAAGLKDVIRELPRREASRFRSQVSFLHS  245



>gb|EYU42370.1| hypothetical protein MIMGU_mgv1a023111mg [Erythranthe guttata]
Length=240

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 79/132 (60%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R+FL  +T+  F SEE   ++    VKELR S+DL+K ES KL +RA  A   + RG ++
Sbjct  109  RQFLSHSTMRLFLSEEIMLSRTNAKVKELRQSIDLLKVESEKLEKRALQAEENLVRGRTK  168

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I  +  +  K E+QA  L D+L E+P RE  + R +V S+A   ++++ A+ K
Sbjct  169  LKQAGKQIHGVINSAYKIESQARGLQDVLTELPSREASRFRTQVKSVAKEAKKERNALSK  228

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  229  EVTKISNYGISV  240



>ref|XP_006294796.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
 gb|EOA27694.1| hypothetical protein CARUB_v10023846mg [Capsella rubella]
Length=271

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF++ NT+  F SEEA  ++A+  VKELR S+D +  ES KL   A +A  E+ RG  +
Sbjct  140  RRFVYYNTVRMFLSEEALLSRADLKVKELRQSMDRLTAESEKLQRVATVAEEELIRGRMK  199

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+    +  K E QA  L D+L+E+P RE  + R+++++ AS +++++ A+ K
Sbjct  200  LRQAGKQIRGAIHSAYKIEKQAAGLKDVLKELPTREASRFRSQISNRASEVKKERNALTK  259

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  260  EVNKISNYGISV  271



>ref|XP_011093293.1| PREDICTED: uncharacterized protein LOC105173298 [Sesamum indicum]
Length=261

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 82/132 (62%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R+F + NT+    SEE   ++A+  VK+LR S+DL+K ES KL ++A  A  ++ RG ++
Sbjct  130  RQFFYYNTMRLLFSEETLLSRADAKVKQLRQSIDLLKAESEKLEKKAMQAEEDVVRGRTK  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQS   +  K E QA  L D+LRE+P RE  + R +V ++A   ++++ A+ K
Sbjct  190  LRQAGKQIQSALNSAYKIERQARGLKDVLRELPSRESSRFRTQVNNVAKEAKKERNALSK  249

Query  392  RIVKISELGVPV  357
             + +IS  G+ V
Sbjct  250  EVARISNHGISV  261



>ref|XP_008375716.1| PREDICTED: uncharacterized protein LOC103438950 [Malus domestica]
Length=262

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = -2

Query  740  FRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNA  561
            +   L  F SEE+  ++A+  VKELR S+DL+K ES KL +RA  A  E  RG ++L   
Sbjct  135  YHKALRLFVSEESLLSRADAKVKELRHSIDLLKAESEKLEKRALHAEEEXTRGRTKLRQT  194

Query  560  GTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVK  381
            G +IQS+ ++  KAE QA  L D+L E+P RE    R++V+ +A   ++++ A+ K + K
Sbjct  195  GKQIQSVIRSAYKAERQAAGLKDILGELPRREAAVFRSQVSKLAXEAKKERNALSKEVTK  254

Query  380  ISELGVPV  357
            IS  G+ V
Sbjct  255  ISNYGISV  262



>ref|XP_010508215.1| PREDICTED: uncharacterized protein LOC104784826 [Camelina sativa]
Length=271

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 82/132 (62%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF++ NT+  F SEEA  ++A+  VKELR S+D +  +S KL   A +A  E+ RG  +
Sbjct  140  RRFVYFNTVRMFVSEEALLSRADLKVKELRQSMDRLTAQSEKLERVATMAEEELIRGRMK  199

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+    +  K E QA  L D+L+E+P RE  + R ++++ AS ++Q++ A+ K
Sbjct  200  LRQAGKQIRGAIHSAYKIEKQAAGLKDVLKELPTREASRFRTQISNRASEVKQERNALTK  259

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  260  EVNKISNYGISV  271



>ref|XP_010506443.1| PREDICTED: uncharacterized protein LOC104783057 isoform X1 [Camelina 
sativa]
Length=271

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 82/132 (62%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR ++ NT+  F SEEA  ++A+  VKELR S+D +  +S KL   A +A  E+ RG  +
Sbjct  140  RRLVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLTAQSEKLERVATMAEEELIRGRMK  199

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+    +  K E QA  L D+L+E+P RE  + R+++++ AS ++Q++ A+ K
Sbjct  200  LRQAGKQIRGAIHSAYKIEKQAAGLKDVLKELPSREASRFRSQISNRASEVKQERNALTK  259

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  260  EVNKISNYGISV  271



>ref|XP_004171485.1| PREDICTED: uncharacterized LOC101214960, partial [Cucumis sativus]
Length=186

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R FL+  T+  F +EE+  +KA+  VKELR S+D +K ES +L +R   A  E+ RG ++
Sbjct  55   RNFLYYKTIRLFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEDELIRGRTK  114

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+ + ++ +K E +A  L D+L ++P RE  + R +V+++AS  ++++  + K
Sbjct  115  LRQAGKQIEGVIQSAHKIERKARGLKDILADLPTREASRFRTQVSNLASEAKKERIGLSK  174

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  175  EVSKISNYGISV  186



>ref|XP_010518116.1| PREDICTED: uncharacterized protein LOC104793462 [Camelina sativa]
Length=271

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 82/132 (62%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR ++ NT+  F SEEA  ++A+  VKELR S+D +  +S KL   A +A  E+ RG  +
Sbjct  140  RRLVYYNTVRMFVSEEALLSRADLKVKELRQSMDRLTAQSEKLERVATMAEEELIRGRMK  199

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+    +  K E QA  L D+L+E+P RE  + R+++++ AS ++Q++ A+ K
Sbjct  200  LRQAGKQIRGAIHSAYKIEKQAAGLKDVLKELPKREASRFRSQISNRASEVKQERNALTK  259

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  260  EVNKISNYGISV  271



>emb|CDX95625.1| BnaC03g25060D [Brassica napus]
Length=371

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF++ NTL  F SEEA  ++A+  VKELR S+D +  ES KL   + +A  E+ RG  +
Sbjct  239  RRFVYYNTLRMFSSEEALLSRADLRVKELRQSMDRLTAESEKLERISTVAEDELIRGRMK  298

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMD-LLREIPGREPLKLRAEVASMASHLRQQKAAMD  396
            L  AG +I+ + ++  K E QA  + + +L+E+P RE  + R+++++ AS ++Q++ A+ 
Sbjct  299  LRQAGKQIRGVVQSAYKIENQAAGMFERVLKELPTREASRFRSQISNSASEIKQERKALT  358

Query  395  KRIVKISELGVPV  357
            K + KIS  G+ V
Sbjct  359  KEVNKISNYGISV  371



>gb|KGN46560.1| hypothetical protein Csa_6G108580 [Cucumis sativus]
Length=209

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R FL+  T+  F +EE+  +KA+  VKELR S+D +K ES +L +R   A  E+ RG ++
Sbjct  78   RNFLYYKTIRLFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEDELIRGRTK  137

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+ + ++ +K E +A  L D+L ++P RE  + R +V+++AS  ++++  + K
Sbjct  138  LRQAGKQIEGVIQSAHKIERKARGLKDILADLPTREASRFRTQVSNLASEAKKERIGLSK  197

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  198  EVSKISNYGISV  209



>gb|AIA25954.1| hypothetical protein, partial [Fargesia spathacea]
Length=96

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -2

Query  698  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKA  519
             N AE+++ E + S++ +KK+S    ++ A+  ++++RG ++L + G +IQSL  ++ KA
Sbjct  3    LNDAEQSMMEYKTSLETLKKDSKYTLDKIAIGESDLQRGRTDLRSTGKQIQSLGSSIYKA  62

Query  518  EAQATDLMDLLREIPGREPLKLRAEVASMASHLR  417
            E+ A  LMD LR IP R+ L+LRAEVASMAS L+
Sbjct  63   ESTAAGLMDRLRTIPTRQSLELRAEVASMASDLK  96



>ref|XP_003538068.1| PREDICTED: uncharacterized protein LOC100804339 [Glycine max]
Length=258

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 81/132 (61%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR L+ NTL  F SEE+  ++A   VKELR S++L+K E  KL + A  A  +   G ++
Sbjct  127  RRVLYYNTLRLFVSEESMISRAHAEVKELRQSIELLKAEGEKLEKSALHAEEQFLHGRTK  186

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L +AG +I+++ ++  K E +A  L D+L E+P RE    R++V+ +AS  +++K  M K
Sbjct  187  LRHAGKQIRNVIQSAYKIEIRAGGLKDILGELPKRETSLFRSQVSKLASEAKKEKNTMSK  246

Query  392  RIVKISELGVPV  357
             I KIS  G+ V
Sbjct  247  EISKISNYGISV  258



>ref|XP_008459726.1| PREDICTED: uncharacterized protein LOC103498769 [Cucumis melo]
Length=265

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R FL+  T+  F +EE+  +KA+  VKELR S+D +K ES +L +R   A  E+ RG ++
Sbjct  134  RSFLYYKTVRLFMNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEEELIRGRTK  193

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+ + ++ +K E +A  L D+L ++P RE  + R +V+++AS  ++++  + K
Sbjct  194  LRQAGKQIEGVIQSAHKIERKARGLKDILADLPTREASRFRTQVSNLASEAKKERIGLSK  253

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  254  EVSKISNYGISV  265



>gb|AIA25947.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
 gb|AIA25948.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
 gb|AIA25949.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
 gb|AIA25950.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
 gb|AIA25952.1| hypothetical protein, partial [Phyllostachys edulis]
Length=96

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -2

Query  698  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKA  519
             N AE+++ E + S++ ++K+S    ++ A+  ++++RG ++L + G +IQSL  ++ KA
Sbjct  3    LNDAEQSMMEYKTSIENLQKDSKYTLDKIAIGESDLQRGQTDLRSTGKQIQSLGSSIYKA  62

Query  518  EAQATDLMDLLREIPGREPLKLRAEVASMASHLR  417
            E+ A  LMD LR IP R+ L+LRAEVASMAS L+
Sbjct  63   ESTAAGLMDRLRTIPTRQSLELRAEVASMASDLK  96



>ref|XP_004140609.1| PREDICTED: uncharacterized protein LOC101214960 [Cucumis sativus]
Length=284

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R FL+  T+  F +EE+  +KA+  VKELR S+D +K ES +L +R   A  E+ RG ++
Sbjct  153  RNFLYYKTIRLFVNEESLLSKADAKVKELRQSIDRIKVESERLEKRTLQAEDELIRGRTK  212

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+ + ++ +K E +A  L D+L ++P RE  + R +V+++AS  ++++  + K
Sbjct  213  LRQAGKQIEGVIQSAHKIERKARGLKDILADLPTREASRFRTQVSNLASEAKKERIGLSK  272

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  273  EVSKISNYGISV  284



>ref|XP_010445295.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Camelina sativa]
Length=318

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 72/125 (58%), Gaps = 10/125 (8%)
 Frame = -2

Query  749  RFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSEL  570
            R   R TLGRF+SEEAQF +AEK+V+EL +S DLMKKES KL ERA LA  +MK G SEL
Sbjct  83   RIDIRQTLGRFQSEEAQFLRAEKHVQELNMSADLMKKESKKLLERATLAEKDMKCGLSEL  142

Query  569  MNAGTRIQ--------SLAKAVNKAEAQATDLMD-LLREIPG-REPLKLRAEVASMASHL  420
            MN+G  ++         L K  NK      D+   L  EI   R      + + S+A+H 
Sbjct  143  MNSGNDMRLMFGKIWYKLPKVCNKITCGMIDVAKRLFDEIGNQRNLCSWNSMIGSLATHG  202

Query  419  RQQKA  405
            +  +A
Sbjct  203  KHNEA  207



>ref|XP_004306965.1| PREDICTED: uncharacterized protein LOC101308610 [Fragaria vesca 
subsp. vesca]
Length=274

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 76/132 (58%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+  +L    SEE+  N+A   VKELR ++D++K ES KL  RAA A  E  +G  +
Sbjct  143  RRFLYYKSLRLLMSEESLLNRAHIEVKELRHAIDVLKAESQKLEIRAANAENEFIQGRKK  202

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQS      K E QA  L D++RE+P RE    R  V ++    +Q++ A+ K
Sbjct  203  LRYAGQQIQSAIGTGYKIERQARGLKDIIRELPRREASLFRDRVTNLVDEAKQERKALSK  262

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  263  EVRKISNYGISV  274



>ref|XP_007221158.1| hypothetical protein PRUPE_ppa020296mg, partial [Prunus persica]
 gb|EMJ22357.1| hypothetical protein PRUPE_ppa020296mg, partial [Prunus persica]
Length=116

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = -2

Query  698  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKA  519
             ++A+  VKELR S+DL+K E  KL +RA+ A  E+ RG ++L   G +I+S+ ++  K 
Sbjct  3    LSRADAKVKELRHSIDLLKAEGEKLEKRASHAEEELIRGRTKLRQTGKQIESVIRSAYKI  62

Query  518  EAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVKISELGVPV  357
            E QA  L D+L E+P RE    R++V+ +A+  +Q++ A+ K + KIS  G+ V
Sbjct  63   ERQAAGLKDILGELPRREASMFRSQVSKLATEAKQERNALTKEVTKISNYGISV  116



>ref|XP_010934947.1| PREDICTED: uncharacterized protein LOC105054975 isoform X1 [Elaeis 
guineensis]
Length=261

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 79/132 (60%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF+  N    F S E+  + A+  V ELR SV+L+K ES KL ERA  A  EM+ G  +
Sbjct  130  RRFVIWNVRRIFVSNESLLSDAQAKVNELRQSVNLVKNESKKLEERALKAEEEMREGRMK  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L+  G  I++  + VNK E +A DL D++ E+P  E  + R+EV+++ S ++++K A+  
Sbjct  190  LIEEGRGIRNELRYVNKIEKKAADLKDVINELPIGEASRYRSEVSTLVSQVKKEKKALSG  249

Query  392  RIVKISELGVPV  357
               KI   G+P+
Sbjct  250  AFSKIINYGIPM  261



>gb|AIA25953.1| hypothetical protein, partial [Fargesia spathacea]
Length=96

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -2

Query  698  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKA  519
             N AE+++ E + S + +KK+S    ++ A+  ++++RG ++L + G +IQSL  ++ KA
Sbjct  3    LNDAEQSMMEYKTSFENLKKDSKYTLDKIAIGESDLQRGRTDLRSTGKQIQSLGSSIYKA  62

Query  518  EAQATDLMDLLREIPGREPLKLRAEVASMASHLR  417
            E+ A  LMD LR IP R+ L+LRAEVASMAS L+
Sbjct  63   ESTAAGLMDRLRTIPTRQSLELRAEVASMASDLK  96



>ref|XP_011033296.1| PREDICTED: uncharacterized protein LOC105131821, partial [Populus 
euphratica]
Length=217

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 80/132 (61%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R+ L+  TL    SEEA  ++A+  VKEL+ S+ L+K ES     RA+LA  E+ RG ++
Sbjct  86   RQILYYKTLRLLTSEEALLSQADAKVKELQQSISLLKAESENSKRRASLAEEELIRGRTK  145

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQ +  +  K E QA  L D+L E+P  +  + +++V+S+AS  +Q++ A+ K
Sbjct  146  LRQAGKQIQGVICSAYKIERQAMGLRDILGELPRADASRFQSQVSSLASEAKQERNALSK  205

Query  392  RIVKISELGVPV  357
             I KIS   + V
Sbjct  206  MITKISNYRISV  217



>ref|XP_007052190.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX96347.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=290

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ NTL  F SEE+  +KA+  VKELR S+D +K ES KL   A++A  ++ RG  +
Sbjct  153  RRFLYYNTLRLFVSEESWLSKADIRVKELRQSIDRLKTESVKLERSASVAEEDLIRGRKK  212

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVA  438
            L +AG +IQS+  +  K E QA  L D+L E+P RE  + R++V+
Sbjct  213  LRHAGKQIQSVIHSAYKIERQAAGLKDILGELPSREASRFRSQVS  257



>ref|XP_010692135.1| PREDICTED: uncharacterized protein LOC104905332 [Beta vulgaris 
subsp. vulgaris]
Length=266

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 78/132 (59%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+  TL  F +EEA   +A+  VKEL+ S    K E+ KL +RA++A  EMKRG ++
Sbjct  135  RRFLYYRTLRLFSTEEALLARADAKVKELKQSFQSFKAETEKLEKRASMAEEEMKRGRTK  194

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L +AG +I+    + +K + QA  L D+L ++P  E  +  +++  + +   Q++  + K
Sbjct  195  LRHAGNQIRKAVLSADKIDKQARGLKDILADLPSAESSRFNSQIKKVVAEANQERKVLAK  254

Query  392  RIVKISELGVPV  357
             + KIS  G+ +
Sbjct  255  EVTKISNYGISI  266



>gb|AFK47092.1| unknown [Lotus japonicus]
Length=262

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 83/133 (62%), Gaps = 2/133 (2%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL-AHTEMKRGHS  576
            RR L+ NT+  F +EE   ++A   VKELR S+DL+K E G+ +E++AL A  +   G +
Sbjct  131  RRILYYNTMRLFLNEETLISRASAEVKELRKSIDLLKAE-GEKWEKSALHAEEQFLHGRT  189

Query  575  ELMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMD  396
            +L  AG +I+++  +  K E +A  L D+L E+P RE    R++V+ +AS  +++K ++ 
Sbjct  190  KLRQAGKQIRNVIDSAYKIERRAGGLKDILGELPRREASHFRSQVSKLASEAKREKNSLT  249

Query  395  KRIVKISELGVPV  357
            K + KIS  G+ V
Sbjct  250  KEVSKISNYGISV  262



>gb|AFK39373.1| unknown [Lotus japonicus]
Length=262

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 83/133 (62%), Gaps = 2/133 (2%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAAL-AHTEMKRGHS  576
            RR L+ NT+  F +EE   ++A   VKELR S+DL+K E G+ +E++AL A  +   G +
Sbjct  131  RRILYYNTMRLFLNEETLISRASAEVKELRKSIDLLKAE-GEKWEKSALHAEEQFLHGRT  189

Query  575  ELMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMD  396
            +L  AG +I+++  +  K E +A  L D+L E+P RE    R++V+ +AS  +++K ++ 
Sbjct  190  KLGQAGKQIRNVIDSAYKIERRAGGLKDILGELPRREASHFRSQVSKLASEAKREKNSLT  249

Query  395  KRIVKISELGVPV  357
            K + KIS  G+ V
Sbjct  250  KEVSKISNYGISV  262



>emb|CAN64905.1| hypothetical protein VITISV_042831 [Vitis vinifera]
Length=587

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 73/122 (60%), Gaps = 0/122 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R FL+ NTL    SEE+   +A+  V ELR S+DL+K ES KL +RA  A  EMKRG ++
Sbjct  447  RHFLYYNTLRLLVSEESMVARADAKVNELRKSIDLLKAESEKLEKRALQAEDEMKRGRTK  506

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +IQS+ ++  K E QA  L D+L E+P RE  + R++V  +   L +    +D 
Sbjct  507  LRQAGNQIQSVIRSAYKIERQARGLKDILGELPSREASRFRSQVPELTLGLGELVNNLDV  566

Query  392  RI  387
             I
Sbjct  567  SI  568



>gb|KEH22362.1| hypothetical protein MTR_7g445370 [Medicago truncatula]
Length=264

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 81/132 (61%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ N    F SEE+  +KA + VKELR S+DL+K E  ++ + A  A  +   G ++
Sbjct  133  RRFLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVERMEKSALHAEEQFLHGRTK  192

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+++ ++  K E +A  L D+L E+P  E    R++V+ +AS ++Q+K ++ K
Sbjct  193  LRQAGKQIRNVIQSAYKIERRAGGLKDILGELPKSEASHFRSQVSRIASDVKQEKRSLAK  252

Query  392  RIVKISELGVPV  357
             + KIS  G+ +
Sbjct  253  EVSKISNYGISI  264



>ref|XP_004514234.1| PREDICTED: uncharacterized protein LOC101491840 [Cicer arietinum]
Length=262

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 80/132 (61%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR L+ NT   F SEE+  ++A   VKELR S+D++K E  K+ + A  A  +   G ++
Sbjct  131  RRMLYYNTKRLFVSEESLVSRASAEVKELRQSIDILKSEVEKMEKSALHAEEQFLHGRTK  190

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+++  +  K E +A  L D+L E+P RE    R++V+ +AS  +++K +++K
Sbjct  191  LRQAGKQIRNVISSACKIERRAGGLKDILGELPKREASHFRSQVSKLASEAKREKNSLNK  250

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  251  EVSKISNYGISV  262



>ref|XP_010506444.1| PREDICTED: uncharacterized protein LOC104783057 isoform X2 [Camelina 
sativa]
Length=267

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 79/132 (60%), Gaps = 4/132 (3%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR ++ NT+  F    A  ++A+  VKELR S+D +  +S KL   A +A  E+ RG  +
Sbjct  140  RRLVYYNTVRMF----ALLSRADLKVKELRQSMDRLTAQSEKLERVATMAEEELIRGRMK  195

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+    +  K E QA  L D+L+E+P RE  + R+++++ AS ++Q++ A+ K
Sbjct  196  LRQAGKQIRGAIHSAYKIEKQAAGLKDVLKELPSREASRFRSQISNRASEVKQERNALTK  255

Query  392  RIVKISELGVPV  357
             + KIS  G+ V
Sbjct  256  EVNKISNYGISV  267



>gb|AFK35211.1| unknown [Medicago truncatula]
Length=264

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 80/132 (61%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+ N    F SEE+  +KA + VKELR S+DL+K E  ++ + A  A  +   G ++
Sbjct  133  RRFLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVERMEKSALHAEEQFLHGKTK  192

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  AG +I+++ ++  K E +A  L D+L E+P  E    R++V+ +A  ++Q+K ++ K
Sbjct  193  LRQAGKQIRNVIQSAYKIERRAGGLKDILGELPKSEASHFRSQVSRIAFDVKQEKRSLAK  252

Query  392  RIVKISELGVPV  357
             + KIS  G+ +
Sbjct  253  EVFKISNYGISI  264



>gb|KDO85659.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=237

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R FL+ NTL  F SEE+  ++A+  VK+LR S+D +K ES KL + A +A  E+ RG ++
Sbjct  130  RHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLKAESEKLEKVALVAEDELIRGRTK  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVA  438
            L  AG +IQ +  +  K E QA  L D++ E+P RE  + R++V+
Sbjct  190  LRQAGKQIQGVINSAYKIERQAAGLKDIVGELPRREASRFRSQVS  234



>ref|XP_009385849.1| PREDICTED: uncharacterized protein LOC103973101 [Musa acuminata 
subsp. malaccensis]
Length=281

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 77/132 (58%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL RNT   F SEE+  + A+  VKEL+ SV+L+  ES KL +RA  A  +MKRG   
Sbjct  150  RRFLIRNTRRIFVSEESMLSSAQVKVKELQQSVNLVTNESKKLEDRATRAVEDMKRGQKR  209

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L+  G +IQ         E Q   L   L E+P  +  + +++V++++S ++Q+K A++ 
Sbjct  210  LIEEGHQIQKQLNFAAGIERQIMSLKGRLNELPKADASRYQSQVSTISSQIKQEKKALNG  269

Query  392  RIVKISELGVPV  357
             + +I   G+P+
Sbjct  270  ALSRIINHGIPM  281



>gb|KEH22363.1| hypothetical protein MTR_7g445370 [Medicago truncatula]
Length=276

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 83/144 (58%), Gaps = 12/144 (8%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKL----------FERAALA  603
            RRFL+ N    F SEE+  +KA + VKELR S+DL+K E  ++          + R +  
Sbjct  133  RRFLYYNMQRLFVSEESLVSKASEEVKELRQSIDLLKSEVERMEGARFAIAFRYPRKSAL  192

Query  602  HTEMK--RGHSELMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMA  429
            H E +   G ++L  AG +I+++ ++  K E +A  L D+L E+P  E    R++V+ +A
Sbjct  193  HAEEQFLHGRTKLRQAGKQIRNVIQSAYKIERRAGGLKDILGELPKSEASHFRSQVSRIA  252

Query  428  SHLRQQKAAMDKRIVKISELGVPV  357
            S ++Q+K ++ K + KIS  G+ +
Sbjct  253  SDVKQEKRSLAKEVSKISNYGISI  276



>ref|XP_006423787.1| hypothetical protein CICLE_v10029731mg [Citrus clementina]
 gb|ESR37027.1| hypothetical protein CICLE_v10029731mg [Citrus clementina]
Length=77

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFLFR+T  R RSEEA F +AEKNV +L LS +LMKKES  L ERAALA  +M RG +E
Sbjct  16   RRFLFRHTFDRLRSEEAMFVRAEKNVNKLNLSGELMKKESKTLLERAALAEKDMIRGETE  75

Query  572  L  570
            L
Sbjct  76   L  76



>ref|XP_008796933.1| PREDICTED: uncharacterized protein LOC103712238 isoform X1 [Phoenix 
dactylifera]
Length=245

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL  N    F S E+  + A+ NV ELR SV+L+K ES KL ERA  A  EM+ G  +
Sbjct  138  RRFLIWNVRRIFVSNESLLSDAQANVNELRQSVNLVKNESKKLEERALKAEQEMREGRMK  197

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVA  438
            L+  G  I++  + VNK E +A+DL D++ E+P  E  + R+EV+
Sbjct  198  LIEEGRGIRNELRYVNKIERKASDLKDVINELPIGEASRYRSEVS  242



>ref|XP_008796934.1| PREDICTED: uncharacterized protein LOC103712238 isoform X2 [Phoenix 
dactylifera]
Length=244

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL  N    F S E+  + A+ NV ELR SV+L+K ES KL ERA  A  EM+ G  +
Sbjct  137  RRFLIWNVRRIFVSNESLLSDAQANVNELRQSVNLVKNESKKLEERALKAEQEMREGRMK  196

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVA  438
            L+  G  I++  + VNK E +A+DL D++ E+P  E  + R+EV+
Sbjct  197  LIEEGRGIRNELRYVNKIERKASDLKDVINELPIGEASRYRSEVS  241



>ref|XP_006375267.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
 gb|ERP53064.1| hypothetical protein POPTR_0014s05780g [Populus trichocarpa]
Length=259

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R+ L+  TL  F SEEA  ++A+  VKEL+ S+ L+K ES  L  RA+LA  E+ RG ++
Sbjct  134  RQILYYKTLRLFTSEEALLSQADAKVKELQQSISLLKAESENLKRRASLAEEELIRGRTK  193

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVA  438
            L  AG +IQ +  +  K E QAT L D+L E+P  +  + +++V+
Sbjct  194  LRQAGKQIQGVICSAYKIEIQATGLRDILGELPRADASRFQSQVS  238



>gb|KHN41331.1| hypothetical protein glysoja_049618 [Glycine soja]
Length=118

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 71/117 (61%), Gaps = 0/117 (0%)
 Frame = -2

Query  707  EAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAV  528
            ++  ++A   VKELR S++L+K E  KL + A  A  +   G ++L +AG +I+++ ++ 
Sbjct  2    QSMISRAHAEVKELRQSIELLKAEGEKLEKSALHAEEQFLHGRTKLRHAGKQIRNVIQSA  61

Query  527  NKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDKRIVKISELGVPV  357
             K E +A  L D+L E+P RE    R++V+ +AS  +++K  M K I KIS  G+ V
Sbjct  62   YKIEIRAGGLKDILGELPKRETSLFRSQVSKLASEAKKEKNTMSKEISKISNYGISV  118



>gb|EMS57790.1| hypothetical protein TRIUR3_22595 [Triticum urartu]
Length=122

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+RNTLGRF++E+   N  E+++ E + S++ ++K+S    ++  +  ++++RG ++
Sbjct  17   RRFLYRNTLGRFKTEKDLLNDVEQSMIEYKTSIESLRKDSKYTLDKVVIGESDLQRGRTD  76

Query  572  LMNAGTRIQSLAKAVNKAEAQA  507
            L + G +IQS+ +++ KAE+ A
Sbjct  77   LRSTGKQIQSVIRSIYKAESTA  98



>ref|XP_011396980.1| hypothetical protein F751_1359 [Auxenochlorella protothecoides]
 gb|KFM24094.1| hypothetical protein F751_1359 [Auxenochlorella protothecoides]
Length=254

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 72/134 (54%), Gaps = 4/134 (3%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRFL+R+TLGR RSEEA F  AE     L   V+    E  KL ER  LA  E  RG S+
Sbjct  121  RRFLWRHTLGRLRSEEAVFKSAELRSVVLAEKVEGQALELKKLQERLGLAQAEYTRGLSK  180

Query  572  LMNAGTRIQSLAKAVNKAEAQAT----DLMDLLREIPGREPLKLRAEVASMASHLRQQKA  405
            L    + +QSL+  +   +  A+     L+  LR +P +  L LR+EVA   +    Q+ 
Sbjct  181  LKATASELQSLSSRIGGTQQTASGMWQGLVQDLRSLPSKHALSLRSEVAQKLAVAETQRK  240

Query  404  AMDKRIVKISELGV  363
            A+DK ++ ++  G+
Sbjct  241  AVDKLVLGLARQGI  254



>dbj|BAJ98005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=277

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 71/132 (54%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R +L +     F S+E   +  +  V  +R +V+LM  ES KL +RAA A    ++G + 
Sbjct  146  RSYLIQRVRRVFVSKETLLSGIQAEVNHMRQTVNLMSNESQKLMDRAATAEKRFQKGWNT  205

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L   G  IQS  K ++  E QA  L  +L ++P     + R+E++ +AS ++++K  ++ 
Sbjct  206  LREEGRAIQSELKQISDIENQAVGLKGILDQLPRAHASEFRSEISGLASQVKKEKRVLNS  265

Query  392  RIVKISELGVPV  357
             + KI   GVP+
Sbjct  266  ALTKIVNYGVPI  277



>ref|XP_005846915.1| hypothetical protein CHLNCDRAFT_134807 [Chlorella variabilis]
 gb|EFN54813.1| hypothetical protein CHLNCDRAFT_134807 [Chlorella variabilis]
Length=289

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 74/133 (56%), Gaps = 7/133 (5%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLF-------ERAALAHTE  594
            RRFL R+T+GRFRSEEA F  AE+    L+   +    E  KL        ER  LA  E
Sbjct  152  RRFLLRHTIGRFRSEEAMFKSAEQRYAGLKEKAEGHNGELQKLQASTAVTQERLQLAELE  211

Query  593  MKRGHSELMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQ  414
             +RG ++L +    ++SLA  V  +   A  L+  LRE+P ++ L+LR++ A+ A+ +  
Sbjct  212  YQRGRAKLKSTAGELESLASRVRGSSKAAKRLITDLRELPSKQALQLRSDAANTANTVGN  271

Query  413  QKAAMDKRIVKIS  375
            Q   +DK + +++
Sbjct  272  QAKVLDKALRRVA  284



>gb|AIA26009.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
Length=87

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = -2

Query  698  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKA  519
             N AE+ + E + S++ +KK+S    ++ A+  ++++RG ++L   G +IQSL  ++ KA
Sbjct  3    LNDAEQCMMEYKTSIETLKKDSKYTLDKIAIGESDLQRGRTDLRATGKQIQSLISSIYKA  62

Query  518  EAQATDLMDLLREIPGREPLKLRAE  444
            E+ A  L+  LR IP R+ L+LRAE
Sbjct  63   ESTAAGLVAQLRTIPTRQSLELRAE  87



>gb|EEC72302.1| hypothetical protein OsI_05485 [Oryza sativa Indica Group]
Length=280

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 70/132 (53%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R +L +     F S+E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + 
Sbjct  149  RSYLIQRVRRIFVSKETLLSGIQAEVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNT  208

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L   G  IQS    ++  E QA  L  +L ++P     + R+E++ +AS ++++K  ++ 
Sbjct  209  LREEGRAIQSELNQISDIEKQAVGLKSILNQLPRAHASEFRSEISGLASQVKKEKRVLNN  268

Query  392  RIVKISELGVPV  357
             + KI   GVP+
Sbjct  269  TLTKIVNYGVPI  280



>ref|XP_010934948.1| PREDICTED: uncharacterized protein LOC105054975 isoform X2 [Elaeis 
guineensis]
Length=246

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RRF+  N    F S E+  + A+  V ELR SV+L+K ES KL ERA  A  EM+ G  +
Sbjct  130  RRFVIWNVRRIFVSNESLLSDAQAKVNELRQSVNLVKNESKKLEERALKAEEEMREGRMK  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAE  444
            L+  G  I++  + VNK E +A DL D++ E+P  E  + R+E
Sbjct  190  LIEEGRGIRNELRYVNKIEKKAADLKDVINELPIGEASRYRSE  232



>ref|NP_001045615.1| Os02g0104800 [Oryza sativa Japonica Group]
 dbj|BAD06279.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD07539.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07529.1| Os02g0104800 [Oryza sativa Japonica Group]
 dbj|BAG92178.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 71/132 (54%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R +L +     F S+E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + 
Sbjct  148  RSYLIQRVRRIFVSKETLLSGIQAGVNHMRQTVNLVSNESQKLLDRAATAEKRFQKGWNT  207

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L   G  IQS    ++  E QA  L  +L ++P     + ++E++ +AS ++++K  ++ 
Sbjct  208  LREEGRAIQSELNQISDIEKQAVGLKSILNQLPRAHASEFQSEISGLASQVKKEKRVLNN  267

Query  392  RIVKISELGVPV  357
             + KI+  GVP+
Sbjct  268  TLTKIANYGVPI  279



>gb|KDD75675.1| hypothetical protein H632_c557p1 [Helicosporidium sp. ATCC 50920]
Length=259

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 72/130 (55%), Gaps = 0/130 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            RR L+R TLGR +S EA    AE+  K L  +V   K+E  KL ER ALA  E +RG ++
Sbjct  130  RRLLWRMTLGRLQSPEAGLRSAEQRAKALSEAVTFQKQEVSKLQERVALAQAEYERGRNK  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  +   +  L++ + +A   A +L D LR +   + + LR+ VA  AS    Q+  +++
Sbjct  190  LEASAEELAKLSRRMRRAHEGAAELQDDLRRMRLPQSVPLRSAVAQHASTAEGQRKVVER  249

Query  392  RIVKISELGV  363
             I+ ++  G+
Sbjct  250  MILDLARQGI  259



>ref|XP_003570319.1| PREDICTED: uncharacterized protein LOC100834616 [Brachypodium 
distachyon]
Length=285

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 70/132 (53%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R +L +     F S+E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + 
Sbjct  154  RSYLIQRVRRIFVSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNT  213

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L   G  IQS  K ++  E Q   L  +L ++P     + R+E++ +AS ++++K  ++ 
Sbjct  214  LREEGRAIQSELKQISDIENQVVGLKGILDQLPRAHASEFRSEISGLASQVKKEKRVLNS  273

Query  392  RIVKISELGVPV  357
             + KI   GVP+
Sbjct  274  ALTKIVNYGVPI  285



>ref|XP_006659070.1| PREDICTED: uncharacterized protein LOC102721384 [Oryza brachyantha]
Length=282

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 68/132 (52%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R +L +     F S+E   +  +  V  +R +V+L+  ES KL +RAA A    ++G + 
Sbjct  151  RSYLIQRVRRIFVSKETLLSGIQAEVNHMRQTVNLVSNESQKLMDRAATAEKRFQKGWNT  210

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L   G  IQS    +   E QA  L  +L ++P     + R+E++ +AS ++++K  +  
Sbjct  211  LREEGRAIQSELNQIGDIENQAVGLKSILGQLPRAHASEFRSEISGLASQVKKEKRVLST  270

Query  392  RIVKISELGVPV  357
             + KI   GVP+
Sbjct  271  TLSKIVNYGVPI  282



>ref|XP_001416629.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94922.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=164

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 5/128 (4%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R  L+R+TLGR +SEEA FN   +  + L L  +    E  +L E A+ A  EMKRG + 
Sbjct  33   RALLWRSTLGRLQSEEALFNACVRRSETLALDAEAASGEIQRLTEAASAAEVEMKRGAAN  92

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVAS----MASHLRQQKA  405
            L +A   ++++       + +AT L++ LR +P +E + L+ +VAS    +A+H R    
Sbjct  93   LKSAARELRAMESRTYGMDKKATTLLNDLRVLPSKEAVALQEQVASTVDKVAAH-RNVAL  151

Query  404  AMDKRIVK  381
            +  KRI K
Sbjct  152  STLKRIFK  159



>gb|KDO85660.1| hypothetical protein CISIN_1g024845mg [Citrus sinensis]
Length=217

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R FL+ NTL  F SEE+  ++A+  VK+LR S+D +K ES KL + A +A  E+ RG ++
Sbjct  130  RHFLYYNTLRLFASEESLLSRADTKVKQLRQSIDRLKAESEKLEKVALVAEDELIRGRTK  189

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDL  489
            L  AG +IQ +  +  K E QA  ++ L
Sbjct  190  LRQAGKQIQGVINSAYKIERQAAGMLIL  217



>gb|AEJ54427.1| hypothetical protein [Fagopyrum esculentum subsp. ancestrale]
Length=48

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  722  RFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRG  582
            RF+SEE +F KAEKNV EL+LS+DL K ES KL +RAA A  EM++G
Sbjct  1    RFQSEETKFLKAEKNVNELKLSIDLTKGESKKLLQRAAFAEKEMQQG  47



>ref|XP_003078117.1| unnamed protein product [Ostreococcus tauri]
Length=214

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 69/132 (52%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R  L+R+T+GR +SEEA FN   +  + L L  +    E  +L E  + A  EMKRG S 
Sbjct  83   RALLWRSTIGRLQSEEALFNACVRRSERLTLEAEAASAEIQRLAESVSAAEIEMKRGASN  142

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  A   ++++       +++A+ L++ LR +P  E   L+ +VA     +   ++A  K
Sbjct  143  LRAAARELRAIESKTYGMDSKASSLLNDLRVLPSAEAAALQEQVAGTTDTVAAHRSAALK  202

Query  392  RIVKISELGVPV  357
             + KI + G+ V
Sbjct  203  VLKKIFKSGIEV  214



>emb|CEF97085.1| unnamed product [Ostreococcus tauri]
Length=245

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 69/132 (52%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R  L+R+T+GR +SEEA FN   +  + L L  +    E  +L E  + A  EMKRG S 
Sbjct  114  RALLWRSTIGRLQSEEALFNACVRRSERLTLEAEAASAEIQRLAESVSAAEIEMKRGASN  173

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  A   ++++       +++A+ L++ LR +P  E   L+ +VA     +   ++A  K
Sbjct  174  LRAAARELRAIESKTYGMDSKASSLLNDLRVLPSAEAAALQEQVAGTTDTVAAHRSAALK  233

Query  392  RIVKISELGVPV  357
             + KI + G+ V
Sbjct  234  VLKKIFKSGIEV  245



>ref|XP_001690494.1| hypothetical protein CHLREDRAFT_144132 [Chlamydomonas reinhardtii]
 gb|EDP05753.1| predicted protein [Chlamydomonas reinhardtii]
Length=259

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 66/123 (54%), Gaps = 1/123 (1%)
 Frame = -2

Query  740  FRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNA  561
            +R TLGR RS E     +E  V+ L+  +D   +E+ KL +R   A  E  RG S+L   
Sbjct  133  YRATLGRLRSPENIIKGSEGKVEGLKGKMDDYTQEAKKLHDRMVAAEEEYVRGRSKLKAT  192

Query  560  GTRIQSLAKAVNKAEAQATDLMDLLREIPGRE-PLKLRAEVASMASHLRQQKAAMDKRIV  384
               +Q LA  V+K+E  A  +++ LR I   +    LRAE AS  S L+ Q+ A+ + I 
Sbjct  193  RQELQRLASVVSKSERAAAGVLEDLRAIKKVDKATSLRAEAASQLSALKAQRTALQQYIY  252

Query  383  KIS  375
            +I+
Sbjct  253  RIA  255



>ref|XP_003064805.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51139.1| predicted protein [Micromonas pusilla CCMP1545]
Length=241

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 72/132 (55%), Gaps = 0/132 (0%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSE  573
            R  L+R T GR +SEE  FN+A +  + L  + +    E  K  E AA+A  EM RG S+
Sbjct  110  RALLWRATFGRLQSEEFLFNRATRAYESLAHAAEGRAGELAKAREAAAIAEEEMSRGRSK  169

Query  572  LMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKAAMDK  393
            L  A   ++ L  A  + E++A  ++D LR +P +  L LRA+VA  ++ LR+ +  +D 
Sbjct  170  LRAAAKELKRLGAANARDESKANLVLDELRSLPSKHALSLRAKVADASAELRKIRGGVDD  229

Query  392  RIVKISELGVPV  357
             + K    GV +
Sbjct  230  GLRKAFRAGVEI  241



>gb|AIA25951.1| hypothetical protein, partial [Phyllostachys nidularia]
Length=76

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -2

Query  698  FNKAEKNVKELRLSVDLMKKESGKLFERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKA  519
             N AE+++ E + S++ ++K+S    ++ A+  ++++RG ++L + G +IQSL  ++ KA
Sbjct  3    LNDAEQSMMEYKTSIENLQKDSKYTLDKIAIGESDLQRGQTDLRSTGKQIQSLGSSIYKA  62

Query  518  EAQATDLMDLLREI  477
            E+ A  LMD LR I
Sbjct  63   ESTAAGLMDRLRTI  76



>ref|XP_007140976.1| hypothetical protein PHAVU_008G156700g [Phaseolus vulgaris]
 gb|ESW12970.1| hypothetical protein PHAVU_008G156700g [Phaseolus vulgaris]
Length=88

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  584  GHSELMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHLRQQKA  405
            G  +L  AG +I+++ ++  K E +A  L D+L E+P RE    R++V+ +AS  +++K 
Sbjct  13   GRRKLRQAGKQIRNVIQSAYKIERRAGGLKDILGELPKREASIFRSQVSKLASEAKKEKR  72

Query  404  AMDKRIVKISELGVPV  357
            ++ K I KIS  G+ V
Sbjct  73   SLSKEISKISNYGISV  88



>ref|XP_002952655.1| hypothetical protein VOLCADRAFT_93417 [Volvox carteri f. nagariensis]
 gb|EFJ46208.1| hypothetical protein VOLCADRAFT_93417 [Volvox carteri f. nagariensis]
Length=268

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 61/132 (46%), Gaps = 17/132 (13%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELRLSVDLMKKESGKL----------------F  621
            RRFL+R TLGR RS +      E  V+ LR+ +     E+ KL                 
Sbjct  122  RRFLYRATLGRLRSPDNILKGCEGKVEGLRVKMADYSTEAKKLQVLAWGRWGLGRKNDRL  181

Query  620  ERAALAHTEMKRGHSELMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPG-REPLKLRAE  444
            ER   A  E  RG ++L      +  LA  V K+E  A  +++ LR I    + ++LRAE
Sbjct  182  ERLVAAEEEYIRGRAKLKATRHELTRLASVVGKSERAAASVLEDLRIIRKLDQAVQLRAE  241

Query  443  VASMASHLRQQK  408
             AS  + LR Q+
Sbjct  242  AASQVADLRSQR  253



>ref|XP_007511188.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66748.1| predicted protein [Bathycoccus prasinos]
Length=246

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 66/130 (51%), Gaps = 9/130 (7%)
 Frame = -2

Query  752  RRFLFRNTLGRFRSEEAQFNKAEKNVKELR---LSVDLMKKESGKLFERAALAHTEMKRG  582
            RR L+R+T+GRF SEE  F K  +  + L+    S D+  K      +   LA  EM  G
Sbjct  115  RRLLWRSTIGRFESEEQAFAKLTRRAQTLKDGAASADVALK---GFSQETQLAIAEMNSG  171

Query  581  HSELMNAGTRIQSLAKAVNKAEAQATDLMDLLREIPGREPLKLRAEVASMASHL-RQQKA  405
             ++L   G+ +    K   K+ A   +++  LR  P  + + LR+E+  + + L RQ++ 
Sbjct  172  VAKLKALGSSLSKAEKGTEKSLAGVEEVLGELRTSPSTDAIALRSELGVVQATLERQRRD  231

Query  404  AMD--KRIVK  381
            AM   KRI K
Sbjct  232  AMRELKRIYK  241



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050