BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF020J08

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08361.1|  unnamed protein product                                133   7e-33   Coffea canephora [robusta coffee]
ref|XP_011081282.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    125   3e-30   Sesamum indicum [beniseed]
ref|XP_004253373.2|  PREDICTED: plasminogen activator inhibitor 1...    125   5e-30   Solanum lycopersicum
ref|XP_006362472.1|  PREDICTED: plasminogen activator inhibitor 1...    125   6e-30   Solanum tuberosum [potatoes]
ref|XP_011081281.1|  PREDICTED: RNA-binding protein FUS isoform X1      125   6e-30   Sesamum indicum [beniseed]
ref|XP_009607515.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    123   2e-29   Nicotiana tomentosiformis
ref|XP_006362473.1|  PREDICTED: plasminogen activator inhibitor 1...    123   3e-29   
gb|AAF14242.1|AF110226_1  nuclear RNA binding protein                   122   3e-29   Nicotiana tabacum [American tobacco]
ref|XP_006362474.1|  PREDICTED: plasminogen activator inhibitor 1...    123   3e-29   Solanum tuberosum [potatoes]
ref|XP_009607512.1|  PREDICTED: intracellular hyaluronan-binding ...    122   4e-29   Nicotiana tomentosiformis
ref|XP_009772180.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    121   1e-28   Nicotiana sylvestris
ref|XP_009613636.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    121   2e-28   Nicotiana tomentosiformis
ref|XP_009772173.1|  PREDICTED: plasminogen activator inhibitor 1...    121   2e-28   Nicotiana sylvestris
ref|XP_009613635.1|  PREDICTED: plasminogen activator inhibitor 1...    121   2e-28   Nicotiana tomentosiformis
ref|NP_001275449.1|  plasminogen activator inhibitor 1 RNA-bindin...    119   7e-28   Solanum tuberosum [potatoes]
ref|XP_011081284.1|  PREDICTED: plasminogen activator inhibitor 1...    117   3e-27   Sesamum indicum [beniseed]
ref|XP_009789579.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    115   1e-26   Nicotiana sylvestris
ref|XP_009766508.1|  PREDICTED: plasminogen activator inhibitor 1...    115   2e-26   Nicotiana sylvestris
ref|XP_009789577.1|  PREDICTED: plasminogen activator inhibitor 1...    115   2e-26   Nicotiana sylvestris
ref|XP_007052330.1|  Hyaluronan / mRNA binding family isoform 4         110   6e-25   
ref|XP_009594553.1|  PREDICTED: plasminogen activator inhibitor 1...    110   1e-24   Nicotiana tomentosiformis
ref|XP_007052327.1|  Hyaluronan / mRNA binding family isoform 1         109   3e-24   
gb|EYU19470.1|  hypothetical protein MIMGU_mgv1a008507mg                108   6e-24   Erythranthe guttata [common monkey flower]
ref|XP_004244706.2|  PREDICTED: plasminogen activator inhibitor 1...    104   1e-22   Solanum lycopersicum
ref|XP_010661405.1|  PREDICTED: plasminogen activator inhibitor 1...    104   1e-22   Vitis vinifera
ref|XP_010275458.1|  PREDICTED: plasminogen activator inhibitor 1...    103   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010258760.1|  PREDICTED: plasminogen activator inhibitor 1...    103   4e-22   Nelumbo nucifera [Indian lotus]
ref|XP_003521066.1|  PREDICTED: plasminogen activator inhibitor 1...    101   2e-21   Glycine max [soybeans]
ref|XP_002266051.1|  PREDICTED: uncharacterized protein DDB_G0288133  99.8    7e-21   Vitis vinifera
emb|CAN75176.1|  hypothetical protein VITISV_016687                   99.8    7e-21   Vitis vinifera
gb|KDP39931.1|  hypothetical protein JCGZ_03462                       97.8    3e-20   Jatropha curcas
ref|XP_007039722.1|  Hyaluronan / mRNA binding family                 97.4    4e-20   
ref|XP_007134461.1|  hypothetical protein PHAVU_010G049300g           97.1    6e-20   Phaseolus vulgaris [French bean]
gb|EYU19467.1|  hypothetical protein MIMGU_mgv1a008831mg              96.7    6e-20   Erythranthe guttata [common monkey flower]
gb|KJB37651.1|  hypothetical protein B456_006G214200                  96.3    8e-20   Gossypium raimondii
gb|KJB24891.1|  hypothetical protein B456_004G166300                  96.3    9e-20   Gossypium raimondii
gb|KHG05539.1|  Plasminogen activator inhibitor 1 RNA-binding         96.3    9e-20   Gossypium arboreum [tree cotton]
gb|KJB37652.1|  hypothetical protein B456_006G214200                  95.9    1e-19   Gossypium raimondii
ref|XP_008369209.1|  PREDICTED: plasminogen activator inhibitor 1...  95.9    1e-19   Malus domestica [apple tree]
gb|KHG30709.1|  hypothetical protein F383_14338                       95.9    1e-19   Gossypium arboreum [tree cotton]
ref|XP_003529036.1|  PREDICTED: plasminogen activator inhibitor 1...  95.9    1e-19   Glycine max [soybeans]
gb|KJB37648.1|  hypothetical protein B456_006G214200                  95.9    1e-19   Gossypium raimondii
gb|KJB37646.1|  hypothetical protein B456_006G214200                  95.5    2e-19   Gossypium raimondii
ref|XP_010677113.1|  PREDICTED: plasminogen activator inhibitor 1...  95.1    2e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011032359.1|  PREDICTED: plasminogen activator inhibitor 1...  95.1    3e-19   Populus euphratica
ref|XP_011031954.1|  PREDICTED: plasminogen activator inhibitor 1...  94.4    4e-19   Populus euphratica
gb|KJB24881.1|  hypothetical protein B456_004G166200                  93.2    1e-18   Gossypium raimondii
ref|XP_009343931.1|  PREDICTED: plasminogen activator inhibitor 1...  93.2    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_002303373.2|  nuclear RNA-binding family protein               93.2    1e-18   
gb|KJB24880.1|  hypothetical protein B456_004G166200                  93.2    1e-18   Gossypium raimondii
ref|XP_007209289.1|  hypothetical protein PRUPE_ppa007665mg           92.8    2e-18   Prunus persica
ref|XP_011017364.1|  PREDICTED: plasminogen activator inhibitor 1...  92.8    2e-18   Populus euphratica
ref|XP_002301233.2|  transcription factor family protein              92.4    2e-18   
ref|NP_001241515.1|  uncharacterized protein LOC100807657             92.0    3e-18   Glycine max [soybeans]
ref|XP_011032341.1|  PREDICTED: plasminogen activator inhibitor 1...  91.7    4e-18   Populus euphratica
gb|KJB37647.1|  hypothetical protein B456_006G214200                  91.3    4e-18   Gossypium raimondii
ref|XP_008373667.1|  PREDICTED: plasminogen activator inhibitor 1...  91.3    5e-18   Malus domestica [apple tree]
ref|XP_008238398.1|  PREDICTED: plasminogen activator inhibitor 1...  91.3    5e-18   Prunus mume [ume]
ref|XP_008238397.1|  PREDICTED: plasminogen activator inhibitor 1...  91.3    5e-18   Prunus mume [ume]
ref|XP_002531778.1|  Plasminogen activator inhibitor 1 RNA-bindin...  91.3    5e-18   Ricinus communis
gb|KHG17525.1|  Plasminogen activator inhibitor 1 RNA-binding         90.9    7e-18   Gossypium arboreum [tree cotton]
ref|XP_004140509.1|  PREDICTED: uncharacterized protein LOC101209927  90.5    9e-18   Cucumis sativus [cucumbers]
gb|KHG27284.1|  hypothetical protein F383_11722                       90.5    9e-18   Gossypium arboreum [tree cotton]
ref|XP_011093237.1|  PREDICTED: plasminogen activator inhibitor 1...  90.1    1e-17   Sesamum indicum [beniseed]
ref|XP_011093236.1|  PREDICTED: plasminogen activator inhibitor 1...  90.5    1e-17   Sesamum indicum [beniseed]
ref|XP_010053521.1|  PREDICTED: vasodilator-stimulated phosphopro...  90.5    1e-17   Eucalyptus grandis [rose gum]
ref|XP_008459799.1|  PREDICTED: plasminogen activator inhibitor 1...  90.1    1e-17   Cucumis melo [Oriental melon]
gb|AEI59279.1|  RNA binding protein                                   90.1    1e-17   Suaeda glauca
gb|KJB25493.1|  hypothetical protein B456_004G194400                  90.1    1e-17   Gossypium raimondii
gb|KCW77830.1|  hypothetical protein EUGRSUZ_D02118                   90.1    1e-17   Eucalyptus grandis [rose gum]
gb|KCW77831.1|  hypothetical protein EUGRSUZ_D02118                   90.1    2e-17   Eucalyptus grandis [rose gum]
ref|XP_009368155.1|  PREDICTED: plasminogen activator inhibitor 1...  89.7    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_007218155.1|  hypothetical protein PRUPE_ppa007410mg           89.7    2e-17   Prunus persica
ref|XP_008232490.1|  PREDICTED: plasminogen activator inhibitor 1...  89.7    2e-17   Prunus mume [ume]
ref|XP_006853790.1|  hypothetical protein AMTR_s00056p00215280        89.7    3e-17   
ref|XP_003552493.1|  PREDICTED: plasminogen activator inhibitor 1...  89.0    3e-17   Glycine max [soybeans]
gb|ABK94426.1|  unknown                                               89.0    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_006368965.1|  nuclear RNA-binding family protein               89.0    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011047584.1|  PREDICTED: plasminogen activator inhibitor 1...  88.6    4e-17   Populus euphratica
ref|XP_009368154.1|  PREDICTED: plasminogen activator inhibitor 1...  88.6    5e-17   
gb|KDO57094.1|  hypothetical protein CISIN_1g017915mg                 88.2    5e-17   Citrus sinensis [apfelsine]
ref|XP_006440206.1|  hypothetical protein CICLE_v10020747mg           88.2    6e-17   Citrus clementina [clementine]
ref|XP_006477113.1|  PREDICTED: plasminogen activator inhibitor 1...  87.8    6e-17   Citrus sinensis [apfelsine]
gb|KHN40549.1|  hypothetical protein glysoja_001047                   88.2    6e-17   Glycine soja [wild soybean]
gb|KDO57096.1|  hypothetical protein CISIN_1g017915mg                 88.2    6e-17   Citrus sinensis [apfelsine]
ref|XP_006477112.1|  PREDICTED: plasminogen activator inhibitor 1...  88.2    7e-17   Citrus sinensis [apfelsine]
ref|XP_006440205.1|  hypothetical protein CICLE_v10020747mg           88.2    7e-17   Citrus clementina [clementine]
ref|XP_010053520.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  87.4    9e-17   Eucalyptus grandis [rose gum]
gb|KHN00198.1|  hypothetical protein glysoja_034729                   84.0    1e-16   Glycine soja [wild soybean]
ref|XP_010053519.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  87.4    1e-16   Eucalyptus grandis [rose gum]
ref|XP_009373211.1|  PREDICTED: plasminogen activator inhibitor 1...  87.0    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_006375155.1|  hypothetical protein POPTR_0014s04820g           86.7    2e-16   Populus trichocarpa [western balsam poplar]
gb|ABK94354.1|  unknown                                               86.7    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006398418.1|  hypothetical protein EUTSA_v10000938mg           86.3    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_008344404.1|  PREDICTED: plasminogen activator inhibitor 1...  86.3    3e-16   
emb|CDP21265.1|  unnamed protein product                              86.3    3e-16   Coffea canephora [robusta coffee]
gb|KJB25494.1|  hypothetical protein B456_004G194400                  85.9    4e-16   Gossypium raimondii
ref|XP_011465242.1|  PREDICTED: plasminogen activator inhibitor 1...  86.3    4e-16   Fragaria vesca subsp. vesca
ref|XP_004300342.1|  PREDICTED: intracellular hyaluronan-binding ...  85.9    5e-16   Fragaria vesca subsp. vesca
ref|XP_010924482.1|  PREDICTED: probable H/ACA ribonucleoprotein ...  85.5    6e-16   Elaeis guineensis
ref|XP_008347095.1|  PREDICTED: plasminogen activator inhibitor 1...  84.0    6e-16   
dbj|BAE71297.1|  hypothetical protein                                 85.5    7e-16   Trifolium pratense [peavine clover]
ref|XP_004515346.1|  PREDICTED: plasminogen activator inhibitor 1...  85.1    9e-16   Cicer arietinum [garbanzo]
ref|XP_004150996.1|  PREDICTED: uncharacterized protein LOC101210473  84.7    1e-15   Cucumis sativus [cucumbers]
ref|XP_010918620.1|  PREDICTED: plasminogen activator inhibitor 1...  84.3    2e-15   Elaeis guineensis
ref|XP_007139646.1|  hypothetical protein PHAVU_008G047300g           84.0    2e-15   Phaseolus vulgaris [French bean]
ref|XP_008375773.1|  PREDICTED: LOW QUALITY PROTEIN: plasminogen ...  84.0    2e-15   
ref|XP_002458112.1|  hypothetical protein SORBIDRAFT_03g027110        83.6    2e-15   Sorghum bicolor [broomcorn]
gb|ABY60453.1|  putative nuclear RNA binding protein                  80.9    3e-15   Adonis aestivalis var. palaestina
ref|XP_004306983.1|  PREDICTED: circumsporozoite protein-like         84.0    3e-15   Fragaria vesca subsp. vesca
ref|XP_003624316.1|  Transcription factor                             85.1    3e-15   
ref|XP_006654864.1|  PREDICTED: plasminogen activator inhibitor 1...  83.6    4e-15   Oryza brachyantha
gb|KDO57095.1|  hypothetical protein CISIN_1g017915mg                 82.8    5e-15   Citrus sinensis [apfelsine]
ref|XP_007142624.1|  hypothetical protein PHAVU_007G003500g           82.4    6e-15   Phaseolus vulgaris [French bean]
gb|ABR26138.1|  salt tolerance protein 2                              80.1    7e-15   Oryza sativa Indica Group [Indian rice]
emb|CDY40563.1|  BnaC02g33290D                                        82.0    7e-15   Brassica napus [oilseed rape]
ref|XP_006644341.1|  PREDICTED: plasminogen activator inhibitor 1...  82.4    7e-15   Oryza brachyantha
ref|XP_009395730.1|  PREDICTED: keratin, type II cytoskeletal 2 e...  82.4    7e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010104826.1|  hypothetical protein L484_024026                 83.2    9e-15   
gb|AFK43517.1|  unknown                                               81.6    1e-14   Lotus japonicus
gb|AES80534.2|  nuclear RNA-binding-like protein                      83.2    1e-14   Medicago truncatula
gb|ABD65038.1|  nuclear RNA binding protein, putative                 80.9    2e-14   Brassica oleracea
ref|XP_009101440.1|  PREDICTED: suppressor protein STM1               80.9    2e-14   Brassica rapa
ref|XP_008810382.1|  PREDICTED: plasminogen activator inhibitor 1...  80.9    3e-14   Phoenix dactylifera
ref|XP_008811725.1|  PREDICTED: uncharacterized protein LOC103722810  77.4    3e-14   Phoenix dactylifera
gb|AAF14244.1|AF110228_1  nuclear RNA binding protein A               80.1    4e-14   Spinacia oleracea
ref|XP_009776248.1|  PREDICTED: plasminogen activator inhibitor 1...  80.1    4e-14   Nicotiana sylvestris
emb|CAA66481.1|  transcription factor                                 80.1    4e-14   Vicia faba var. minor [tick bean]
ref|NP_001148572.1|  plasminogen activator inhibitor 1 RNA-bindin...  79.3    8e-14   Zea mays [maize]
ref|NP_001056483.1|  Os05g0589600                                     79.7    8e-14   
gb|KHN27127.1|  hypothetical protein glysoja_032895                   79.0    8e-14   Glycine soja [wild soybean]
gb|AFW81314.1|  plasminogen activator inhibitor 1 RNA-binding pro...  79.3    9e-14   
gb|EAY99238.1|  hypothetical protein OsI_21200                        79.7    9e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_003556572.1|  PREDICTED: plasminogen activator inhibitor 1...  79.0    9e-14   Glycine max [soybeans]
ref|NP_001043502.1|  Os01g0603000                                     79.3    1e-13   
ref|XP_003567795.1|  PREDICTED: plasminogen activator inhibitor 1...  79.3    1e-13   Brachypodium distachyon [annual false brome]
ref|XP_009128949.1|  PREDICTED: suppressor protein STM1-like          78.6    1e-13   Brassica rapa
gb|ACL54182.1|  unknown                                               76.3    2e-13   Zea mays [maize]
gb|EAY74854.1|  hypothetical protein OsI_02745                        78.6    2e-13   Oryza sativa Indica Group [Indian rice]
gb|KDO57093.1|  hypothetical protein CISIN_1g017915mg                 77.8    2e-13   Citrus sinensis [apfelsine]
gb|EAY75654.1|  hypothetical protein OsI_03559                        77.8    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_002440366.1|  hypothetical protein SORBIDRAFT_09g030400        78.2    2e-13   Sorghum bicolor [broomcorn]
gb|EAZ13376.1|  hypothetical protein OsJ_03294                        77.8    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KHN11561.1|  hypothetical protein glysoja_006014                   75.5    3e-13   Glycine soja [wild soybean]
gb|ADE76006.1|  unknown                                               74.7    3e-13   Picea sitchensis
ref|XP_006837401.1|  hypothetical protein AMTR_s00111p00140620        77.8    3e-13   Amborella trichopoda
ref|XP_004961407.1|  PREDICTED: RNA-binding protein FUS-like          77.8    3e-13   Setaria italica
emb|CDY33522.1|  BnaA06g35510D                                        77.0    3e-13   Brassica napus [oilseed rape]
gb|ABR25759.1|  nuclear antigen                                       75.9    3e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001044098.1|  Os01g0721900                                     77.8    3e-13   
gb|KJB22277.1|  hypothetical protein B456_004G038700                  77.4    4e-13   Gossypium raimondii
ref|XP_004961035.1|  PREDICTED: insulin receptor substrate 4-like     77.4    4e-13   Setaria italica
ref|XP_011101848.1|  PREDICTED: plasminogen activator inhibitor 1...  77.4    5e-13   Sesamum indicum [beniseed]
ref|XP_009416461.1|  PREDICTED: plasminogen activator inhibitor 1...  77.0    6e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008459800.1|  PREDICTED: plasminogen activator inhibitor 1...  76.6    7e-13   Cucumis melo [Oriental melon]
ref|XP_006280739.1|  hypothetical protein CARUB_v10026708mg           76.6    7e-13   Capsella rubella
ref|XP_002863351.1|  hypothetical protein ARALYDRAFT_494257           76.6    7e-13   
ref|NP_001281195.1|  plasminogen activator inhibitor 1 RNA-bindin...  76.6    1e-12   Zea mays [maize]
ref|XP_004969088.1|  PREDICTED: plasminogen activator inhibitor 1...  76.3    1e-12   Setaria italica
ref|XP_008675099.1|  PREDICTED: plasminogen activator inhibitor 1...  75.9    1e-12   Zea mays [maize]
emb|CDY28966.1|  BnaA02g25100D                                        75.5    1e-12   Brassica napus [oilseed rape]
dbj|BAE71280.1|  putative nuclear antigen homolog                     75.9    2e-12   Trifolium pratense [peavine clover]
ref|NP_199532.1|  Hyaluronan / mRNA binding family protein            75.5    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531668.1|  PREDICTED: plasminogen activator inhibitor 1...  75.5    2e-12   Tarenaya hassleriana [spider flower]
dbj|BAE71204.1|  putative nuclear antigen homolog                     75.5    2e-12   Trifolium pratense [peavine clover]
ref|XP_010925494.1|  PREDICTED: protein argonaute 2-like              75.5    2e-12   Elaeis guineensis
gb|EMS68133.1|  hypothetical protein TRIUR3_26332                     76.6    2e-12   Triticum urartu
gb|AAM63072.1|  nuclear RNA binding protein A-like protein            75.1    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410905.1|  PREDICTED: plasminogen activator inhibitor 1...  74.7    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ98247.1|  predicted protein                                    72.0    4e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAS75737.1|  thermoinhibition-associated THB-4 protein             70.5    4e-12   Tagetes minuta
ref|XP_003568032.1|  PREDICTED: probable H/ACA ribonucleoprotein ...  74.3    5e-12   Brachypodium distachyon [annual false brome]
ref|XP_010531670.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  74.3    5e-12   Tarenaya hassleriana [spider flower]
dbj|BAG90611.1|  unnamed protein product                              72.4    6e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009396539.1|  PREDICTED: plasminogen activator inhibitor 1...  74.3    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK31390.1|  hypothetical protein AALP_AA6G105700                  73.9    7e-12   Arabis alpina [alpine rockcress]
ref|NP_001056139.1|  Os05g0533100                                     72.4    1e-11   
dbj|BAJ96699.1|  predicted protein                                    73.2    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010919740.1|  PREDICTED: plasminogen activator inhibitor 1...  73.2    1e-11   Elaeis guineensis
gb|EMT08444.1|  hypothetical protein F775_29168                       74.3    1e-11   
ref|XP_010919739.1|  PREDICTED: plasminogen activator inhibitor 1...  73.2    1e-11   Elaeis guineensis
ref|XP_010481347.1|  PREDICTED: plasminogen activator inhibitor 1...  72.8    1e-11   Camelina sativa [gold-of-pleasure]
gb|KDP28866.1|  hypothetical protein JCGZ_14637                       73.2    1e-11   Jatropha curcas
ref|XP_010481348.1|  PREDICTED: plasminogen activator inhibitor 1...  72.8    2e-11   Camelina sativa [gold-of-pleasure]
emb|CAC85227.1|  salt tolerance protein 1                             72.8    2e-11   Beta vulgaris [beet]
ref|XP_010441486.1|  PREDICTED: plasminogen activator inhibitor 1...  72.8    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_004969787.1|  PREDICTED: eukaryotic translation initiation...  72.8    2e-11   Setaria italica
ref|XP_010692032.1|  PREDICTED: uncharacterized protein DDB_G0288...  72.4    2e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010494951.1|  PREDICTED: plasminogen activator inhibitor 1...  72.4    2e-11   Camelina sativa [gold-of-pleasure]
emb|CDY43435.1|  BnaAnng07070D                                        72.0    2e-11   Brassica napus [oilseed rape]
ref|XP_004492923.1|  PREDICTED: intracellular hyaluronan-binding ...  72.4    3e-11   Cicer arietinum [garbanzo]
emb|CDY65881.1|  BnaAnng21260D                                        71.6    3e-11   Brassica napus [oilseed rape]
ref|XP_001760974.1|  predicted protein                                71.6    3e-11   
gb|EEE64473.1|  hypothetical protein OsJ_19323                        72.0    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79581.1|  hypothetical protein OsI_20751                        72.0    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_009114287.1|  PREDICTED: uncharacterized protein LOC103839539  71.6    4e-11   Brassica rapa
ref|XP_003569708.1|  PREDICTED: RNA-binding protein FUS-like          71.6    5e-11   Brachypodium distachyon [annual false brome]
ref|XP_010531669.1|  PREDICTED: plasminogen activator inhibitor 1...  71.2    5e-11   Tarenaya hassleriana [spider flower]
gb|AAT47083.1|  unknown protein                                       71.6    5e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KHG04303.1|  hypothetical protein F383_01005                       71.2    5e-11   Gossypium arboreum [tree cotton]
gb|ABD64914.1|  nuclear RNA binding protein, putative                 70.9    6e-11   Brassica oleracea
gb|EMT12851.1|  hypothetical protein F775_28068                       70.5    6e-11   
ref|XP_001756282.1|  predicted protein                                71.2    7e-11   
gb|EYU40365.1|  hypothetical protein MIMGU_mgv1a008102mg              71.2    7e-11   Erythranthe guttata [common monkey flower]
ref|XP_010440090.1|  PREDICTED: uncharacterized protein LOC104723416  67.4    8e-11   
gb|EPS72575.1|  hypothetical protein M569_02184                       70.9    8e-11   Genlisea aurea
emb|CDY67886.1|  BnaCnng56800D                                        70.5    9e-11   Brassica napus [oilseed rape]
ref|XP_010449710.1|  PREDICTED: plasminogen activator inhibitor 1...  69.3    1e-10   Camelina sativa [gold-of-pleasure]
gb|EMT09866.1|  hypothetical protein F775_32096                       70.5    1e-10   
ref|XP_008798814.1|  PREDICTED: plasminogen activator inhibitor 1...  70.5    1e-10   Phoenix dactylifera
ref|XP_008798813.1|  PREDICTED: plasminogen activator inhibitor 1...  70.5    1e-10   Phoenix dactylifera
ref|XP_009406178.1|  PREDICTED: plasminogen activator inhibitor 1...  70.5    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS59053.1|  hypothetical protein TRIUR3_33029                     69.3    1e-10   Triticum urartu
ref|XP_002440127.1|  hypothetical protein SORBIDRAFT_09g026550        70.1    2e-10   Sorghum bicolor [broomcorn]
ref|XP_010449709.1|  PREDICTED: plasminogen activator inhibitor 1...  69.7    2e-10   Camelina sativa [gold-of-pleasure]
emb|CDM84169.1|  unnamed protein product                              69.7    2e-10   Triticum aestivum [Canadian hard winter wheat]
gb|KJB37649.1|  hypothetical protein B456_006G214200                  68.9    2e-10   Gossypium raimondii
gb|KJB24892.1|  hypothetical protein B456_004G166300                  68.9    3e-10   Gossypium raimondii
ref|XP_009388577.1|  PREDICTED: plasminogen activator inhibitor 1...  69.3    4e-10   
dbj|BAJ89734.1|  predicted protein                                    68.9    4e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010434762.1|  PREDICTED: plasminogen activator inhibitor 1...  68.6    4e-10   Camelina sativa [gold-of-pleasure]
ref|NP_001275394.1|  nuclear RNA binding protein                      68.6    4e-10   Solanum tuberosum [potatoes]
ref|XP_010434652.1|  PREDICTED: plasminogen activator inhibitor 1...  68.6    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002870130.1|  hypothetical protein ARALYDRAFT_493188           68.6    5e-10   
ref|XP_008793172.1|  PREDICTED: uncharacterized protein DDB_G0288...  68.6    6e-10   Phoenix dactylifera
ref|XP_001785274.1|  predicted protein                                68.6    6e-10   
ref|XP_009145376.1|  PREDICTED: plasminogen activator inhibitor 1...  67.8    6e-10   Brassica rapa
ref|XP_002870099.1|  hypothetical protein ARALYDRAFT_493124           67.8    8e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_002991714.1|  hypothetical protein SELMODRAFT_448524           67.8    9e-10   Selaginella moellendorffii
ref|XP_010449600.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  67.8    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009145362.1|  PREDICTED: plasminogen activator inhibitor 1...  67.4    1e-09   Brassica rapa
emb|CDY35615.1|  BnaC01g21370D                                        67.4    1e-09   Brassica napus [oilseed rape]
ref|XP_006414296.1|  hypothetical protein EUTSA_v10025552mg           67.0    2e-09   Eutrema salsugineum [saltwater cress]
gb|KEH17858.1|  nuclear RNA-binding-like protein                      67.0    2e-09   Medicago truncatula
ref|XP_009605755.1|  PREDICTED: plasminogen activator inhibitor 1...  67.0    2e-09   Nicotiana tomentosiformis
gb|KFK22256.1|  hypothetical protein AALP_AAs66747U001100             66.6    2e-09   Arabis alpina [alpine rockcress]
gb|AAF14245.1|AF110229_1  nuclear RNA binding protein B               65.1    3e-09   Spinacia oleracea
ref|XP_004229741.1|  PREDICTED: plasminogen activator inhibitor 1...  65.9    4e-09   
ref|XP_010439990.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  65.9    4e-09   Camelina sativa [gold-of-pleasure]
gb|AAF14246.1|AF110230_1  nuclear RNA binding protein C               64.7    4e-09   Spinacia oleracea
ref|XP_006284012.1|  hypothetical protein CARUB_v10005134mg           65.5    6e-09   Capsella rubella
ref|XP_002511578.1|  RNA binding protein, putative                    64.7    6e-09   Ricinus communis
gb|KJB37650.1|  hypothetical protein B456_006G214200                  64.7    6e-09   Gossypium raimondii
gb|ACG24258.1|  plasminogen activator inhibitor 1 RNA-binding pro...  65.1    7e-09   Zea mays [maize]
gb|AAM64962.1|  nuclear RNA binding protein A-like protein            65.1    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010231993.1|  PREDICTED: uncharacterized protein LOC100831026  61.6    9e-09   
gb|EMS56112.1|  hypothetical protein TRIUR3_18406                     62.8    9e-09   Triticum urartu
emb|CDY38403.1|  BnaC01g10120D                                        64.7    1e-08   Brassica napus [oilseed rape]
ref|XP_009108277.1|  PREDICTED: plasminogen activator inhibitor 1...  63.9    1e-08   Brassica rapa
ref|NP_193485.1|  hyaluronan / mRNA binding family                    64.3    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001767830.1|  predicted protein                                64.3    1e-08   
emb|CDX76586.1|  BnaA08g08140D                                        63.9    2e-08   
gb|AGV54489.1|  plasminogen activator inhibitor 1 RNA-binding pro...  63.9    2e-08   Phaseolus vulgaris [French bean]
ref|XP_009108276.1|  PREDICTED: plasminogen activator inhibitor 1...  63.5    2e-08   Brassica rapa
ref|XP_002458418.1|  hypothetical protein SORBIDRAFT_03g033140        63.2    3e-08   Sorghum bicolor [broomcorn]
gb|EPS59059.1|  hypothetical protein M569_15751                       62.0    7e-08   Genlisea aurea
gb|ABD65145.1|  nuclear RNA binding protein, putative                 62.0    8e-08   Brassica oleracea
emb|CDX90469.1|  BnaA03g43120D                                        61.6    1e-07   
ref|XP_009130695.1|  PREDICTED: intracellular hyaluronan-binding ...  61.2    1e-07   Brassica rapa
ref|XP_009136852.1|  PREDICTED: plasminogen activator inhibitor 1...  61.2    1e-07   Brassica rapa
gb|ABI18976.1|  nuclear-localized RNA binding protein                 61.2    1e-07   Capsicum annuum
gb|KFK24045.1|  hypothetical protein AALP_AAs42697U000600             61.2    2e-07   Arabis alpina [alpine rockcress]
gb|ABD65067.1|  nuclear RNA binding protein, putative                 61.2    2e-07   Brassica oleracea
ref|NP_001078399.1|  hyaluronan / mRNA binding domain-containing ...  60.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193416.1|  hyaluronan / mRNA binding domain-containing pro...  60.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDX76567.1|  BnaA08g08330D                                        60.8    2e-07   
ref|XP_009108330.1|  PREDICTED: plasminogen activator inhibitor 1...  60.5    2e-07   Brassica rapa
ref|XP_006655517.1|  PREDICTED: plasminogen activator inhibitor 1...  60.5    3e-07   
ref|XP_006285507.1|  hypothetical protein CARUB_v10006948mg           60.5    3e-07   Capsella rubella
ref|XP_008650627.1|  PREDICTED: DNA ligase 1-like                     58.9    3e-07   
ref|NP_001078400.1|  hyaluronan / mRNA binding domain-containing ...  59.7    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148350.1|  PREDICTED: uncharacterized protein LOC101207608  59.7    5e-07   Cucumis sativus [cucumbers]
ref|XP_006414219.1|  hypothetical protein EUTSA_v10025512mg           59.7    5e-07   Eutrema salsugineum [saltwater cress]
ref|XP_008465866.1|  PREDICTED: plasminogen activator inhibitor 1...  59.3    6e-07   Cucumis melo [Oriental melon]
gb|AAM61393.1|  nuclear antigen homolog                               58.9    9e-07   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA57853.1|  TPA: hypothetical protein ZEAMMB73_322547            57.0    3e-06   
tpg|DAA57846.1|  TPA: hypothetical protein ZEAMMB73_955694            57.0    4e-06   
ref|NP_001078724.1|  Hyaluronan / mRNA binding family protein         56.6    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009383830.1|  PREDICTED: keratin, type I cytoskeletal 9-like   55.5    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002988573.1|  hypothetical protein SELMODRAFT_447366           54.7    3e-05   
gb|KHN13635.1|  UDP-glucose 4-epimerase GEPI48                        53.1    6e-05   
ref|XP_010246647.1|  PREDICTED: aspartate, glycine, lysine and se...  53.1    8e-05   
ref|XP_002979268.1|  hypothetical protein SELMODRAFT_444118           52.0    2e-04   
emb|CDY43474.1|  BnaC08g10790D                                        52.4    2e-04   
gb|KHN46561.1|  hypothetical protein glysoja_032653                   51.2    4e-04   
ref|XP_001760895.1|  predicted protein                                51.2    4e-04   
dbj|BAD87405.1|  nuclear RNA binding protein A-like                   48.1    6e-04   



>emb|CDP08361.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtle--eyeKVLEEKRKALL  574
            +NE EK  D EKQ+ QE  GD  KDS  +E EEKE E +E  +   EY+K+LEEKRK+LL
Sbjct  215  VNEGEKNADAEKQSGQETVGDGNKDSHVDEPEEKEKEPEEKEMTLEEYQKLLEEKRKSLL  274

Query  573  ASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKP  394
            ASKPEERKV LDKEF SMQLLSNKKND++VFIKLGS+K+K+++AGEK KK  +INEFLKP
Sbjct  275  ASKPEERKVNLDKEFESMQLLSNKKNDDDVFIKLGSDKDKRRDAGEKAKKAVSINEFLKP  334

Query  393  AEGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLG  259
            AEGENYYR GGRGRGRGRGRGGYG +  +V+APSI DVGQFP+LG
Sbjct  335  AEGENYYRPGGRGRGRGRGRGGYGNNSYNVEAPSIADVGQFPSLG  379



>ref|XP_011081282.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 isoform 
X2 [Sesamum indicum]
Length=343

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             NE  K VD+EKQ+ ++D  DA KDS  NE EEKEPEEKEMTLEEYEKVLEEKRKALLA 
Sbjct  179  TNEGVKNVDSEKQSGEDDVIDANKDSSANEQEEKEPEEKEMTLEEYEKVLEEKRKALLAL  238

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            K EERKV LDKE  SMQLLSNKKND+EVFIKLGS+K+K+KEA EK KK+ +INEFLKPAE
Sbjct  239  KSEERKVGLDKELESMQLLSNKKNDDEVFIKLGSDKDKRKEAAEKAKKSVSINEFLKPAE  298

Query  387  GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTL  262
            G+ YYR+GGRGRGRGRGRGG+GG+  +V+AP+IEDVGQFP+L
Sbjct  299  GDKYYRAGGRGRGRGRGRGGFGGNNYNVEAPAIEDVGQFPSL  340



>ref|XP_004253373.2| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like, 
partial [Solanum lycopersicum]
Length=327

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 131/163 (80%), Gaps = 2/163 (1%)
 Frame = -2

Query  735  EKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEE  556
            EK V+ EKQT QED GD  KDS   E EEKEPEEKEMTLEEYEKV+EEKRKAL+A K EE
Sbjct  157  EKIVEAEKQTGQEDAGDDNKDSTAAELEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEE  216

Query  555  RKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAEGEN-  379
            RKV LDKE  SMQLLSNKKND+E+FIKLG+EK+KKKEA EK KK ++INEFLKPAEGE+ 
Sbjct  217  RKVNLDKELQSMQLLSNKKNDDEIFIKLGAEKDKKKEAVEKAKKAQSINEFLKPAEGESY  276

Query  378  -yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
                  GRGRGRGRG GG  G +SSV APSIEDVGQFP+L  K
Sbjct  277  YRPGGRGRGRGRGRGNGGGYGGISSVSAPSIEDVGQFPSLAVK  319



>ref|XP_006362472.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum tuberosum]
Length=366

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +N+ EK VD EKQ+ QED GD  KDS   E EEKEPEEKEMTLEEYEKV+EEKRKAL+A 
Sbjct  200  VNDGEKIVDAEKQSGQEDAGDTNKDSSAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVAL  259

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            K EERKV LD E  SMQLLSNKKND+E+FIKLG+EK+KKKEA EK KKTK+INEFLKPAE
Sbjct  260  KQEERKVNLDNELQSMQLLSNKKNDDEIFIKLGAEKDKKKEAVEKNKKTKSINEFLKPAE  319

Query  387  GEN--yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            GE+       GRGRGRGRG GG  G ++SV +PSIEDVGQFP+L  K
Sbjct  320  GESYYRPGGRGRGRGRGRGNGGGYGGINSVSSPSIEDVGQFPSLAAK  366



>ref|XP_011081281.1| PREDICTED: RNA-binding protein FUS isoform X1 [Sesamum indicum]
Length=365

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             NE  K VD+EKQ+ ++D  DA KDS  NE EEKEPEEKEMTLEEYEKVLEEKRKALLA 
Sbjct  201  TNEGVKNVDSEKQSGEDDVIDANKDSSANEQEEKEPEEKEMTLEEYEKVLEEKRKALLAL  260

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            K EERKV LDKE  SMQLLSNKKND+EVFIKLGS+K+K+KEA EK KK+ +INEFLKPAE
Sbjct  261  KSEERKVGLDKELESMQLLSNKKNDDEVFIKLGSDKDKRKEAAEKAKKSVSINEFLKPAE  320

Query  387  GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTL  262
            G+ YYR+GGRGRGRGRGRGG+GG+  +V+AP+IEDVGQFP+L
Sbjct  321  GDKYYRAGGRGRGRGRGRGGFGGNNYNVEAPAIEDVGQFPSL  362



>ref|XP_009607515.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=337

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK VDTEK   Q D  DA+KDSP  E +EKEPEEKEMTLEEYEK+LE+KRKALLA 
Sbjct  173  LNEGEKIVDTEKPAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLEDKRKALLAL  232

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            KPEERKV LDKE  SMQLLSNKK+D+EVFIKLGSEK+K+KEA EK KKTK+INEFLKPA+
Sbjct  233  KPEERKVNLDKELESMQLLSNKKSDDEVFIKLGSEKDKRKEAVEKAKKTKSINEFLKPAD  292

Query  387  GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            G +YYR GGRGRG            +SV APSIEDV QFP+LG K
Sbjct  293  GGSYYRRGGRGRGGRDHGRDGVVGNNSVSAPSIEDVRQFPSLGAK  337



>ref|XP_006362473.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Solanum tuberosum]
Length=364

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 129/163 (79%), Gaps = 2/163 (1%)
 Frame = -2

Query  735  EKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEE  556
            EK V+ EKQ  QED GD  KDS   E EEKEPEEKEMTLEEYEKV+EEKRKAL+A K EE
Sbjct  202  EKIVEAEKQAGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEE  261

Query  555  RKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAEGEN-  379
            RKV LDKE  SMQLLSNKKND+E+FIKLG+EK+KKKEA EK KKT+NINEFLKPAEGEN 
Sbjct  262  RKVNLDKELQSMQLLSNKKNDDEIFIKLGAEKDKKKEAVEKAKKTQNINEFLKPAEGENY  321

Query  378  -yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
                  GRGRGRGRG GG     +SV APSIEDVGQFP+L  K
Sbjct  322  YRSGGRGRGRGRGRGNGGGYVGNNSVSAPSIEDVGQFPSLAAK  364



>gb|AAF14242.1|AF110226_1 nuclear RNA binding protein [Nicotiana tabacum]
Length=299

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 136/165 (82%), Gaps = 3/165 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +N+ EK V+ EK+  QE+  D  KDS   E EEKEPEEKEMTLEEYEK++EEKRKALLA 
Sbjct  132  VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLAL  191

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            KPEERKV LDKE  SMQLLSNKKND+E+FIKLGSEKEK+KEA EK +KT++INEFLKPAE
Sbjct  192  KPEERKVNLDKELESMQLLSNKKNDDEIFIKLGSEKEKRKEAVEKARKTQSINEFLKPAE  251

Query  387  GENyyrsggrgrgrgrgrggyggSLS---SVDAPSIEDVGQFPTL  262
            GENY R GGRGRG GRGRGG+GG +    S  APSIEDVGQFP+L
Sbjct  252  GENYSRRGGRGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSL  296



>ref|XP_006362474.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Solanum tuberosum]
Length=364

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 129/163 (79%), Gaps = 2/163 (1%)
 Frame = -2

Query  735  EKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEE  556
            EK V+ EKQ  QED GD  KDS   E EEKEPEEKEMTLEEYEKV+EEKRKAL+A K EE
Sbjct  202  EKIVEAEKQAGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEE  261

Query  555  RKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAEGEN-  379
            RKV LDKE  SMQLLSNKKND+E+FIKLG+EK+KKKEA EK KKT+NINEFLKPAEGEN 
Sbjct  262  RKVNLDKELQSMQLLSNKKNDDEIFIKLGAEKDKKKEAVEKAKKTQNINEFLKPAEGENY  321

Query  378  -yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
                  GRGRGRGRG GG     +SV APSIEDVGQFP+L  K
Sbjct  322  YRSGGRGRGRGRGRGNGGGYVGNNSVSAPSIEDVGQFPSLAAK  364



>ref|XP_009607512.1| PREDICTED: intracellular hyaluronan-binding protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=359

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK VDTEK   Q D  DA+KDSP  E +EKEPEEKEMTLEEYEK+LE+KRKALLA 
Sbjct  195  LNEGEKIVDTEKPAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLEDKRKALLAL  254

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            KPEERKV LDKE  SMQLLSNKK+D+EVFIKLGSEK+K+KEA EK KKTK+INEFLKPA+
Sbjct  255  KPEERKVNLDKELESMQLLSNKKSDDEVFIKLGSEKDKRKEAVEKAKKTKSINEFLKPAD  314

Query  387  GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            G +YYR GGRGRG            +SV APSIEDV QFP+LG K
Sbjct  315  GGSYYRRGGRGRGGRDHGRDGVVGNNSVSAPSIEDVRQFPSLGAK  359



>ref|XP_009772180.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana sylvestris]
Length=334

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK V TEKQ  Q D  DA+KDSP  E +EKEPEEKEMTLEEYEK+LEEKRKALLA 
Sbjct  170  VNEGEKIVVTEKQAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLEEKRKALLAL  229

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            KPEERKV LDKE  SMQLLSNKK+D+EVFIKLGSEK+K+KEA EK KKTK+INEFLKPA+
Sbjct  230  KPEERKVNLDKELESMQLLSNKKSDDEVFIKLGSEKDKRKEAVEKAKKTKSINEFLKPAD  289

Query  387  GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            GE+YY  GGRGRG            +SV APSIEDV QFP+LG K
Sbjct  290  GESYYGRGGRGRGGRDRGRDGFVGNNSVSAPSIEDVRQFPSLGAK  334



>ref|XP_009613636.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=350

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 136/165 (82%), Gaps = 3/165 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +N+ EK V+ EK+  QE+  D  KDS   E EEKEPEEKEMTLEEYEK++EEKRKALLA 
Sbjct  183  VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLAL  242

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            KPEERKV LDKE  SMQLLSNKKND+E+FIKLGSEKEK+KEA EK +KT++INEFLKPAE
Sbjct  243  KPEERKVNLDKELESMQLLSNKKNDDEIFIKLGSEKEKRKEAVEKARKTQSINEFLKPAE  302

Query  387  GENyyrsggrgrgrgrgrggyggSLS---SVDAPSIEDVGQFPTL  262
            GENY R GGRGRG GRGRGG+GG +    S  APSIEDVGQFP+L
Sbjct  303  GENYSRRGGRGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSL  347



>ref|XP_009772173.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana sylvestris]
Length=356

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK V TEKQ  Q D  DA+KDSP  E +EKEPEEKEMTLEEYEK+LEEKRKALLA 
Sbjct  192  VNEGEKIVVTEKQAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLEEKRKALLAL  251

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            KPEERKV LDKE  SMQLLSNKK+D+EVFIKLGSEK+K+KEA EK KKTK+INEFLKPA+
Sbjct  252  KPEERKVNLDKELESMQLLSNKKSDDEVFIKLGSEKDKRKEAVEKAKKTKSINEFLKPAD  311

Query  387  GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            GE+YY  GGRGRG            +SV APSIEDV QFP+LG K
Sbjct  312  GESYYGRGGRGRGGRDRGRDGFVGNNSVSAPSIEDVRQFPSLGAK  356



>ref|XP_009613635.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana tomentosiformis]
Length=373

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 136/165 (82%), Gaps = 3/165 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +N+ EK V+ EK+  QE+  D  KDS   E EEKEPEEKEMTLEEYEK++EEKRKALLA 
Sbjct  206  VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLAL  265

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            KPEERKV LDKE  SMQLLSNKKND+E+FIKLGSEKEK+KEA EK +KT++INEFLKPAE
Sbjct  266  KPEERKVNLDKELESMQLLSNKKNDDEIFIKLGSEKEKRKEAVEKARKTQSINEFLKPAE  325

Query  387  GENyyrsggrgrgrgrgrggyggSLS---SVDAPSIEDVGQFPTL  262
            GENY R GGRGRG GRGRGG+GG +    S  APSIEDVGQFP+L
Sbjct  326  GENYSRRGGRGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSL  370



>ref|NP_001275449.1| plasminogen activator inhibitor 1 RNA-binding protein-like [Solanum 
tuberosum]
 gb|ABA81884.1| nuclear RNA binding protein-like [Solanum tuberosum]
Length=363

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 131/163 (80%), Gaps = 2/163 (1%)
 Frame = -2

Query  735  EKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEE  556
            EK V+ EKQ  QED GD  K+S   E EEKEPEEKE+TLEEYEKV+EEKRKAL+A K EE
Sbjct  201  EKIVEAEKQAGQEDAGDTNKESTAAEPEEKEPEEKEITLEEYEKVMEEKRKALVALKQEE  260

Query  555  RKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAEGEN-  379
            RKV LDKE  SMQLLSNKKND+E+FIKLG+EK+KKKEA EK KKTK+INEFLKPAEGE+ 
Sbjct  261  RKVNLDKELQSMQLLSNKKNDDEIFIKLGAEKDKKKEAVEKTKKTKSINEFLKPAEGESY  320

Query  378  -yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
                  GRGRGRGRG GG  G ++SV APSIEDVGQFP+L  K
Sbjct  321  YRPGGRGRGRGRGRGNGGGYGGINSVSAPSIEDVGQFPSLAVK  363



>ref|XP_011081284.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Sesamum indicum]
Length=358

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -2

Query  732  KTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEER  553
            K V++EK++ Q+D GDA KD+   E EEKEPEEKEMTLEEYEKVLEEKRKALLA K  ER
Sbjct  199  KNVESEKRSGQDDVGDANKDTSAKEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKSRER  258

Query  552  KVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAEGENyy  373
            KV LDKE  SMQLLSNKKND++VFIKLGS+K+K+KEA EK KK+ +INEFLKPAEGE YY
Sbjct  259  KVDLDKELESMQLLSNKKNDDDVFIKLGSDKDKRKEAAEKAKKSVSINEFLKPAEGEKYY  318

Query  372  rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTL  262
             +  RGRG GRGRGGYGG+   + AP+IEDVGQFP+L
Sbjct  319  GAVRRGRGHGRGRGGYGGNNYDLQAPAIEDVGQFPSL  355



>ref|XP_009789579.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana sylvestris]
Length=351

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +N+ EK V+ EK+  QED  D  KDS   E EEKEPEEKEMTLEEYEK++EEKRKALLA 
Sbjct  183  VNDGEKIVEAEKEAGQEDAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLAL  242

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            KPEERKV LDKE  +MQLLSNKKND+E+FIKLGSEKEK+KEA EK +KTK+INEFLKPA+
Sbjct  243  KPEERKVNLDKELETMQLLSNKKNDDEIFIKLGSEKEKRKEAVEKARKTKSINEFLKPAD  302

Query  387  GENyyrsggrgrgrgrgrggyggSLS----SVDAPSIEDVGQFPTL  262
            GE+ Y   G          G  G       +  APSIEDVGQFP+L
Sbjct  303  GESSYYRRGGRGRGQGRGRGGFGGGVGGNKNFSAPSIEDVGQFPSL  348



>ref|XP_009766508.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana sylvestris]
Length=369

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 137/171 (80%), Gaps = 6/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK VD EK   +ED GDA KDS     EEKEPEEKEMTLEEYEK+LEEKRKALLA 
Sbjct  199  VTEGEKIVDPEKPAGEEDAGDAKKDSSAAAPEEKEPEEKEMTLEEYEKLLEEKRKALLAQ  258

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            KPEERKV LDKEF SMQLLSNKKN+++VFIKLG+EK+K+KEA EK KKTK+INEFLKPAE
Sbjct  259  KPEERKVNLDKEFESMQLLSNKKNEDDVFIKLGAEKDKRKEAVEKAKKTKSINEFLKPAE  318

Query  387  GENyyrsggrgrgrgrgrggyggSLS------SVDAPSIEDVGQFPTLGKK  253
            GENYYR  GRG   GRGRGGYGG+        SV+AP IEDVGQFP+LG K
Sbjct  319  GENYYRGRGRGGRGGRGRGGYGGNGGNGGNNYSVEAPKIEDVGQFPSLGAK  369



>ref|XP_009789577.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana sylvestris]
Length=374

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +N+ EK V+ EK+  QED  D  KDS   E EEKEPEEKEMTLEEYEK++EEKRKALLA 
Sbjct  206  VNDGEKIVEAEKEAGQEDAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLAL  265

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
            KPEERKV LDKE  +MQLLSNKKND+E+FIKLGSEKEK+KEA EK +KTK+INEFLKPA+
Sbjct  266  KPEERKVNLDKELETMQLLSNKKNDDEIFIKLGSEKEKRKEAVEKARKTKSINEFLKPAD  325

Query  387  GENyyrsggrgrgrgrgrggyggSLS----SVDAPSIEDVGQFPTL  262
            GE+ Y   G          G  G       +  APSIEDVGQFP+L
Sbjct  326  GESSYYRRGGRGRGQGRGRGGFGGGVGGNKNFSAPSIEDVGQFPSL  371



>ref|XP_007052330.1| Hyaluronan / mRNA binding family isoform 4 [Theobroma cacao]
 gb|EOX96487.1| Hyaluronan / mRNA binding family isoform 4 [Theobroma cacao]
Length=267

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 130/170 (76%), Gaps = 6/170 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK +  EK   +ED GDA+K+SP NE EEKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  99   VNESEKNLGDEKPAGEEDAGDASKESPTNEPEEKEPEDKEMTLEEYEKVLEEKRKALQAL  158

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLK  397
            K EERKV   KEFA+MQ LSNKK+++EVFIKLGSEK+K+KEA    E+ KK+ +INEFLK
Sbjct  159  KTEERKVDA-KEFATMQQLSNKKSNDEVFIKLGSEKDKRKEAFDKEERAKKSVSINEFLK  217

Query  396  PAEGENyy--rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE YY     GRGRGRG    G G +  +V APSIED GQFPTLG K
Sbjct  218  PAEGERYYNPSGRGRGRGRGSRGFGGGSAAGNVSAPSIEDPGQFPTLGGK  267



>ref|XP_009594553.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana tomentosiformis]
Length=365

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 130/166 (78%), Gaps = 3/166 (2%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            E EK VD+EK   +ED GDA KDS   E EEKEPEEKEMTLEEYEK+LEEKRKALLA KP
Sbjct  200  EGEKIVDSEKPAGEEDAGDAKKDSSVAEPEEKEPEEKEMTLEEYEKLLEEKRKALLAQKP  259

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAE--  388
            EERKV LDKEF SMQLLSNKKN+++VFIKLG+EK+K+KEA EK KKTK+INEFLKPAE  
Sbjct  260  EERKVNLDKEFESMQLLSNKKNEDDVFIKLGAEKDKRKEAVEKAKKTKSINEFLKPAEGG  319

Query  387  -GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
                    GGRGRG   G  G GG+  SV+AP IEDVGQFP+LG K
Sbjct  320  NYYRGRGRGGRGRGGRGGYEGNGGNNYSVEAPKIEDVGQFPSLGAK  365



>ref|XP_007052327.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 ref|XP_007052328.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 ref|XP_007052329.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96484.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96485.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96486.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
Length=375

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 134/170 (79%), Gaps = 6/170 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK +  EK   +ED GDA+K+SP NE EEKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  207  VNESEKNLGDEKPAGEEDAGDASKESPTNEPEEKEPEDKEMTLEEYEKVLEEKRKALQAL  266

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLK  397
            K EERKV   KEFA+MQ LSNKK+++EVFIKLGSEK+K+KEA    E+ KK+ +INEFLK
Sbjct  267  KTEERKVDA-KEFATMQQLSNKKSNDEVFIKLGSEKDKRKEAFDKEERAKKSVSINEFLK  325

Query  396  PAEGENyyrsggrgrgrgrgrggyggSLSS--VDAPSIEDVGQFPTLGKK  253
            PAEGE YY   GRGRGRGRG  G+GG  ++  V APSIED GQFPTLG K
Sbjct  326  PAEGERYYNPSGRGRGRGRGSRGFGGGSAAGNVSAPSIEDPGQFPTLGGK  375



>gb|EYU19470.1| hypothetical protein MIMGU_mgv1a008507mg [Erythranthe guttata]
Length=371

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = -2

Query  732  KTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEER  553
            K VD EK + +ED  DA KDSP  + E++  EEKEMTLEEYEKV EEKRKALL+ K EER
Sbjct  209  KIVDPEKPSGEEDAVDANKDSPKEQEEKEPEEEKEMTLEEYEKVREEKRKALLSLKSEER  268

Query  552  KVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAEGENyy  373
            KV LDKE  +MQLLS KKND+EVFIKLGS+K+K+KEA EK KK+ +INEFLKPAEGENYY
Sbjct  269  KVNLDKELEAMQLLSTKKNDDEVFIKLGSDKDKRKEAAEKAKKSVSINEFLKPAEGENYY  328

Query  372  rsggrgrgrgrgrggyggSLSS---VDAPSIEDVGQFPTLGKK  253
            R GGRG     GRG  GG   S     AP+I DVGQFP+LG K
Sbjct  329  RGGGRGGRGRGGRGREGGFGRSNAGERAPAIGDVGQFPSLGGK  371



>ref|XP_004244706.2| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum lycopersicum]
Length=340

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -2

Query  735  EKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEE  556
            EK V+ EKQT QED GD  KDS   E EEKEPEEKEMTLEEYEKV+EEKRKAL+A K EE
Sbjct  202  EKIVEAEKQTGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEE  261

Query  555  RKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAEGEN  379
            RKV LDKE  SMQLLSNKKND+E+FIKLG+EK+KKKEA EK KKT+ INEFLKPAEGE+
Sbjct  262  RKVNLDKELQSMQLLSNKKNDDEIFIKLGAEKDKKKEAVEKAKKTQTINEFLKPAEGES  320



>ref|XP_010661405.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Vitis vinifera]
 emb|CBI16673.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 119/171 (70%), Gaps = 6/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK +  EK   +ED  D  K++P NE EEKEPEEKEMTLEEYEKVLEE+RKAL   
Sbjct  191  VNEGEKNLGAEKPVGEEDVADGNKENPVNEPEEKEPEEKEMTLEEYEKVLEERRKALQTL  250

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLK  397
            K EERKV +DKEF SMQ LS+KK ++++FIKLGS   ++++  E  E+ KK  +INEFLK
Sbjct  251  KTEERKVDVDKEFKSMQQLSSKKGNDDIFIKLGSDKDKRKEAAEKEERAKKAVSINEFLK  310

Query  396  PAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE   +    G       RG  G G ++S+V APSIED GQFPTLG K
Sbjct  311  PAEGERFYSPGGRGRGRGRGSRGGYGGGNAMSNVAAPSIEDPGQFPTLGAK  361



>ref|XP_010275458.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Nelumbo nucifera]
Length=359

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 128/170 (75%), Gaps = 7/170 (4%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEKT  TEK   +++TGD  K++P NE EEKEPE+KEMTL+EYEKVLEEKRKAL A K 
Sbjct  190  EVEKTTITEKTGGEDETGDTNKENPVNEPEEKEPEDKEMTLDEYEKVLEEKRKALQALKT  249

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLKPA  391
            EERKV LDK+F SMQ L++KK +++VFIKLGSEK+K+KEA    E+ KK+ +INEFLKPA
Sbjct  250  EERKVNLDKDFESMQQLASKKGNDDVFIKLGSEKDKRKEAIDKEERTKKSVSINEFLKPA  309

Query  390  EGENyyrsggrgrgrgrgrggygg----SLSSVDAPSIEDVGQFPTLGKK  253
            EG  YY  GGRGRGRG      G       S+V APSIED GQFPTLG K
Sbjct  310  EGGRYYSPGGRGRGRGGRGSRGGFSGVNQASNVVAPSIEDPGQFPTLGGK  359



>ref|XP_010258760.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Nelumbo nucifera]
Length=358

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 122/169 (72%), Gaps = 7/169 (4%)
 Frame = -2

Query  738  VEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPE  559
            +EKT  TEK   +E+ GDA K++P NE EEKEPE+KEMTL+EYEKVLEEKRKAL A K E
Sbjct  190  IEKTAITEKPVGEEEAGDANKENPTNEPEEKEPEDKEMTLDEYEKVLEEKRKALQALKTE  249

Query  558  ERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPAE  388
            ERKV LDK+F SMQ L+NKK +++VFIKLGS   +++   +  E+ KK+ +INEFLKP+E
Sbjct  250  ERKVNLDKDFESMQQLANKKGNDDVFIKLGSDKDKRKDNTDKEERAKKSVSINEFLKPSE  309

Query  387  GE---NyyrsggrgrgrgrgrggyggSLSSVD-APSIEDVGQFPTLGKK  253
            GE   N    G    GRG   G  GG+++S + APSI D GQFPTLG K
Sbjct  310  GEKYYNPGGRGRGRGGRGSKGGFGGGNMTSNEVAPSIGDPGQFPTLGGK  358



>ref|XP_003521066.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=368

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 123/169 (73%), Gaps = 5/169 (3%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK +  EK   +ED  +  KDSP NE EEKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  201  VNETEKVLADEKPVGEEDAAEGNKDSPANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQ  260

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLK  397
            K E RKV + KEFASMQ LSNKK ++E+FIKLGS+K+K+K+A    EK KK+ NI EFLK
Sbjct  261  KTEARKVDI-KEFASMQPLSNKKENDEIFIKLGSDKDKRKDALEKEEKSKKSVNITEFLK  319

Query  396  PAEGE-NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE  Y    GRGRGRG   G  G + S+  APSIED G FP+LG K
Sbjct  320  PAEGERYYPGGRGRGRGRGSRGGYSGNAYSNAPAPSIEDPGHFPSLGGK  368



>ref|XP_002266051.1| PREDICTED: uncharacterized protein DDB_G0288133 [Vitis vinifera]
 emb|CBI29539.3| unnamed protein product [Vitis vinifera]
Length=363

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 129/168 (77%), Gaps = 4/168 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            INE EK    EKQ  +E   DA K++P NE+EEKEPE+KEMTLEEY+KVLEEKRKALLA 
Sbjct  197  INETEKNTSAEKQLGEEIAADANKENPVNESEEKEPEDKEMTLEEYQKVLEEKRKALLAL  256

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkke---agekvkktKNINEFLK  397
            K EERKV + K+F +MQ LS+KK++++VFIKLGSEK+K+KE     E+ KK+ +INEFLK
Sbjct  257  KTEERKVDV-KDFEAMQQLSSKKDNDDVFIKLGSEKDKRKELADKEERAKKSVSINEFLK  315

Query  396  PAEGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE YY   GRGRGRG   G  G + S+V APSIED GQFPTLG K
Sbjct  316  PAEGERYYGGRGRGRGRGTRGGFAGNTYSNVAAPSIEDPGQFPTLGGK  363



>emb|CAN75176.1| hypothetical protein VITISV_016687 [Vitis vinifera]
Length=363

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 128/168 (76%), Gaps = 4/168 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            INE EK    EKQ  +E   DA K++P NE+EEKEPE+KEMTLEEY+KVLEEKRKALLA 
Sbjct  197  INETEKNTSAEKQLGEEIAADANKENPVNESEEKEPEDKEMTLEEYQKVLEEKRKALLAL  256

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkke---agekvkktKNINEFLK  397
            K EERKV + K+F +MQ LS+KK++++VFIKLGSEK+K+KE     E+ KK+ +INEFLK
Sbjct  257  KTEERKVDV-KDFEAMQQLSSKKDNDDVFIKLGSEKDKRKELADKEERAKKSVSINEFLK  315

Query  396  PAEGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE YY   GRG GRG   G  G + S+V APSIED GQFPTLG K
Sbjct  316  PAEGERYYGGRGRGCGRGTRGGFAGNTYSNVAAPSIEDPGQFPTLGGK  363



>gb|KDP39931.1| hypothetical protein JCGZ_03462 [Jatropha curcas]
Length=366

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 118/169 (70%), Gaps = 5/169 (3%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E+EK V  EK + +ED  DA K+SP +E EEK  +++    E  + +LEEKRKALL+S
Sbjct  199  VTEIEKNVVAEKPSGEEDAADANKESPADEPEEKVEDKEMTLEEYEK-ILEEKRKALLSS  257

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK---NINEFLK  397
            K EERKV ++KEF SM  LSNKK ++++FIKLGSEK+K+K+A +K  + K   +I EFLK
Sbjct  258  KTEERKVDVEKEFGSMLQLSNKKGNDDIFIKLGSEKDKRKDAADKEDRAKKSVSITEFLK  317

Query  396  PAEGEN-yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PA+GE  Y    GRGRGRG   G  GG+   V APSIED GQFP+LG K
Sbjct  318  PADGEKYYSGGRGRGRGRGSRGGYVGGNARDVAAPSIEDRGQFPSLGGK  366



>ref|XP_007039722.1| Hyaluronan / mRNA binding family [Theobroma cacao]
 gb|EOY24223.1| Hyaluronan / mRNA binding family [Theobroma cacao]
Length=358

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK V  EKQ+ +ED  DA+K++  NE EEKEPE KEMTLEEYEK+L+EKRKALLA 
Sbjct  192  VPENEKNVGAEKQSGEEDVVDASKENAANEPEEKEPENKEMTLEEYEKILDEKRKALLAL  251

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk--ktKNINEFLKP  394
            K EERKV + KEF SMQ LSNKK+++++FIKLGSEK+K+K+A ++ +  K+ +INEFLKP
Sbjct  252  KTEERKVDV-KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKP  310

Query  393  AEGENyyrsggrgrgrgrgrggyggSLSS-VDAPSIEDVGQFPTLGKK  253
            AEGE YY  G         RGGYGG   S V AP+IED GQFPTLG K
Sbjct  311  AEGERYYGPGRGRGRGRGPRGGYGGIAGSNVPAPAIEDRGQFPTLGGK  358



>ref|XP_007134461.1| hypothetical protein PHAVU_010G049300g [Phaseolus vulgaris]
 gb|ESW06455.1| hypothetical protein PHAVU_010G049300g [Phaseolus vulgaris]
Length=359

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 121/174 (70%), Gaps = 11/174 (6%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            +E EK    EK   +E   D  KDSP NE EEKEPEEKEMTLEEYEKVLEE+RKAL A K
Sbjct  187  DETEKNFGDEKPVGEESAADGNKDSPANENEEKEPEEKEMTLEEYEKVLEERRKALQALK  246

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLKP  394
             E RKV + KEFASMQ LSNKK+++E+FIKLGS+K+K+K+A    E+ KK+ NI EFLKP
Sbjct  247  TETRKVDI-KEFASMQPLSNKKDNDEIFIKLGSDKDKRKDALEKEERSKKSVNITEFLKP  305

Query  393  AEGENyyrsg-------grgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE YY +          G   G G G  G + S+V APSIED GQFPTLG K
Sbjct  306  AEGERYYNTSGRGRGRGRGGGRGGGGGGYSGNAGSNVSAPSIEDPGQFPTLGGK  359



>gb|EYU19467.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata]
 gb|EYU19468.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata]
Length=361

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 117/170 (69%), Gaps = 7/170 (4%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeye-KVLEEKRKALLASK  565
            EV+K +D+EK++ +++T DA KDS P E EEKE EE++    E   KVLEEKRK LL+ K
Sbjct  190  EVKKVIDSEKKSGEDETDDANKDSSPKEKEEKEAEEEKEMTLEEYEKVLEEKRKTLLSMK  249

Query  564  PEERKVCLDKEFASMQLLSNKKND-EEVFIKLGSekekkkeagekvkktKNINEFLKPAE  388
             E RKV +DKE  SMQLLSNKK D ++VFIKLGS+K+K+KEA EK KK+ +INEFLKP E
Sbjct  250  SEARKVNVDKELESMQLLSNKKIDHDDVFIKLGSDKDKRKEAAEKAKKSVSINEFLKPVE  309

Query  387  GENy-----yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            GE Y        G      G G GG GG   S  AP+IEDV QFP+LG K
Sbjct  310  GEKYSRGGGRGRGRGRGREGFGGGGGGGFGRSERAPAIEDVDQFPSLGGK  359



>gb|KJB37651.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=306

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK V  EKQ+ +ED  DA K++  NE EEKEPE KEMTLEEYEK++EEKRKALLA 
Sbjct  140  VPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLAL  199

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk--ktKNINEFLKP  394
            K EERKV   KEF SMQ LS+KK+++++FIKLGSEK+K+K+A ++ +  K+ +INEFLKP
Sbjct  200  KTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKP  258

Query  393  AEGE-NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE  Y    GRGRGRG   G  G + SSV APSIED G FP+LG K
Sbjct  259  AEGERYYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  306



>gb|KJB24891.1| hypothetical protein B456_004G166300 [Gossypium raimondii]
Length=361

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 125/170 (74%), Gaps = 6/170 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             NE E+ +  EK   +ED  +A K+S  NE EEKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  193  TNEGERNLGDEKPAGEEDAREANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQAL  252

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLK  397
            K EERKV   KEF SMQ LSNKKN++EVFIKLGS   ++++  E  E+ KK+ +INEFLK
Sbjct  253  KIEERKVDA-KEFESMQQLSNKKNNDEVFIKLGSDKDKRKEAYEKEERAKKSVSINEFLK  311

Query  396  PAEGENyyrsggrgrgrgrgrggyggSLSSVD--APSIEDVGQFPTLGKK  253
            PAEGE YY   GRGRGRGRG  G+GG  ++ D  APSIED G FPTLG K
Sbjct  312  PAEGERYYNPSGRGRGRGRGSRGFGGGSAARDVAAPSIEDPGHFPTLGGK  361



>gb|KHG05539.1| Plasminogen activator inhibitor 1 RNA-binding [Gossypium arboreum]
Length=362

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 125/170 (74%), Gaps = 6/170 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             NE E+ +  EK   +ED  DA K+S  NE EEKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  194  TNEGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQAL  253

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLK  397
            K EERKV   KEF SMQ LSNKK+++EVFIKLGS   ++++  E  E+ KK+ +INEFLK
Sbjct  254  KIEERKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYEKEERAKKSVSINEFLK  312

Query  396  PAEGENyyrsggrgrgrgrgrggyggSLSSVD--APSIEDVGQFPTLGKK  253
            PAEGE YY   GRGRGRGRG  G+GG  ++ D  APSIED G FPTLG K
Sbjct  313  PAEGERYYNPSGRGRGRGRGSRGFGGGSAARDVAAPSIEDPGHFPTLGGK  362



>gb|KJB37652.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=335

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK V  EKQ+ +ED  DA K++  NE EEKEPE KEMTLEEYEK++EEKRKALLA 
Sbjct  169  VPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLAL  228

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk--ktKNINEFLKP  394
            K EERKV   KEF SMQ LS+KK+++++FIKLGSEK+K+K+A ++ +  K+ +INEFLKP
Sbjct  229  KTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKP  287

Query  393  AEGE-NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE  Y    GRGRGRG   G  G + SSV APSIED G FP+LG K
Sbjct  288  AEGERYYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  335



>ref|XP_008369209.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Malus domestica]
Length=359

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 118/166 (71%), Gaps = 6/166 (4%)
 Frame = -2

Query  732  KTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEER  553
            K V  EKQ+ + +  DA K+   NETEEKEPEEKEMTLEEY+KVLEEKRKALLA K EER
Sbjct  194  KNVGAEKQSGENEAADANKEDTVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEER  253

Query  552  KVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPAEGE  382
            KV +DK+  +MQLLSNKK ++E+FIKLGS   ++++  E  E+ KK+ +INEFLKPAEGE
Sbjct  254  KVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGE  313

Query  381  Nyy---rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
             Y+     G     RG   GG GG  S+  APSI D GQFP+LG K
Sbjct  314  RYHGGRGRGRGRGPRGGYSGGPGGYSSNAAAPSIGDPGQFPSLGGK  359



>gb|KHG30709.1| hypothetical protein F383_14338 [Gossypium arboreum]
Length=353

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK V  EKQ+ +ED  DA K++  NE EEKEPE KEMTLEEYEK++EEKRKALLA 
Sbjct  187  VPENEKNVGIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLAL  246

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk--ktKNINEFLKP  394
            K EERKV   KEF SMQ LS+KK+++++FIKLGSEK+K+K+A ++ +  K+ +INEFLKP
Sbjct  247  KTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKP  305

Query  393  AEGE-NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE  Y    GRGRGRG   G  G + SSV APSIED G FP+LG K
Sbjct  306  AEGERYYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  353



>ref|XP_003529036.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=368

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 121/169 (72%), Gaps = 5/169 (3%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK    EK   +ED  +  KD P NE EEKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  201  VYETEKNFADEKPAGEEDAPEGNKDCPANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQ  260

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLK  397
            K E RKV + KEFASMQ LSNKK ++E+FIKLGS+K+K+K+A    EK KK+ NI EFLK
Sbjct  261  KTEVRKVDI-KEFASMQPLSNKKENDEIFIKLGSDKDKRKDALEKEEKSKKSVNITEFLK  319

Query  396  PAEGE-NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE  Y    GRGRGRG   G  G + S+V APSIED GQFPTL  K
Sbjct  320  PAEGERYYSGGRGRGRGRGSRGGYSGNAYSNVPAPSIEDPGQFPTLSGK  368



>gb|KJB37648.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=356

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK V  EKQ+ +ED  DA K++  NE EEKEPE KEMTLEEYEK++EEKRKALLA 
Sbjct  190  VPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLAL  249

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk--ktKNINEFLKP  394
            K EERKV   KEF SMQ LS+KK+++++FIKLGSEK+K+K+A ++ +  K+ +INEFLKP
Sbjct  250  KTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKP  308

Query  393  AEGE-NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE  Y    GRGRGRG   G  G + SSV APSIED G FP+LG K
Sbjct  309  AEGERYYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  356



>gb|KJB37646.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=357

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK V  EKQ+ +ED  DA K++  NE EEKEPE KEMTLEEYEK++EEKRKALLA 
Sbjct  191  VPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLAL  250

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk--ktKNINEFLKP  394
            K EERKV   KEF SMQ LS+KK+++++FIKLGSEK+K+K+A ++ +  K+ +INEFLKP
Sbjct  251  KTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKP  309

Query  393  AEGE-NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE  Y    GRGRGRG   G  G + SSV APSIED G FP+LG K
Sbjct  310  AEGERYYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  357



>ref|XP_010677113.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Beta vulgaris subsp. vulgaris]
 emb|CAC85228.1| salt tolerance protein 2 [Beta vulgaris]
Length=356

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 87/118 (74%), Gaps = 3/118 (3%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALL+ K EERKV LDKEF SMQL+S KKND+EVFIKLGS   ++++  E  E+
Sbjct  237  VLEEKRKALLSLKGEERKVDLDKEFESMQLVSKKKNDDEVFIKLGSDKDKRKEAAEREER  296

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLG  259
             KK+ +INEFLKPAEG+ Y+R G      GRG  G G  +++  APSIED  QFP+LG
Sbjct  297  SKKSVSINEFLKPAEGDGYHRRGRGRGRGGRGGYGGGYGMNNASAPSIEDPNQFPSLG  354



>ref|XP_011032359.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Populus euphratica]
Length=360

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            NE EK    +K   ++   D  K++P NE EEKEPE+K MTLEEYEKVLEEKRKAL A K
Sbjct  197  NEGEKNWGDDKPV-EDAAADGKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALK  255

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAEG  385
             EERKV   KEF SMQ LSNKK + +VFIKLGS+K+K+KEA EK KK+ +INEFLKPAEG
Sbjct  256  TEERKVDA-KEFQSMQQLSNKKENNDVFIKLGSDKDKRKEAYEKAKKSVSINEFLKPAEG  314

Query  384  ENyyrsggrgrgrgrgrg--gyggSLSSVDAPSIEDVGQFPTLGKK  253
            E YY +G R RGRGRG    G    +SSV APSIED GQFPTLG K
Sbjct  315  ERYYGAGSRSRGRGRGARGFGNRDGMSSVPAPSIEDPGQFPTLGGK  360



>ref|XP_011031954.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=362

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 114/170 (67%), Gaps = 9/170 (5%)
 Frame = -2

Query  735  EKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtle--eyeKVLEEKRKALLASKP  562
            EK V TEKQ  +E+  DA KD+   E EEKE E +E  +   EYEKVLEEKRKALLA K 
Sbjct  193  EKNVITEKQQGEENAADANKDTAEKEPEEKEKEPEEKEMTLEEYEKVLEEKRKALLALKT  252

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPA  391
            EERKV LDK+   MQ LS+KK+++E+FIKLGS   +++   +  ++ KK  +INEFLKPA
Sbjct  253  EERKVGLDKDLQCMQQLSSKKSNDEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPA  312

Query  390  EGENyyr----sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            EGE  Y       GRGRGRG    GYG +   V APSIED GQFP+LG K
Sbjct  313  EGERSYNPGRGGRGRGRGRGGYGSGYGSNARDVAAPSIEDPGQFPSLGGK  362



>gb|KJB24881.1| hypothetical protein B456_004G166200 [Gossypium raimondii]
Length=363

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 124/169 (73%), Gaps = 6/169 (4%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            NE E+ +  EK   +ED  DA K+S  NE EEKEPE+KEMTLEEYEKVLEEKRKAL A K
Sbjct  196  NEGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALK  255

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKP  394
             EERKV   KEF SMQ LSNKK+++EVFIKLGS   ++++  +  E+ KK+ +INEFLKP
Sbjct  256  IEERKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYDREERAKKSVSINEFLKP  314

Query  393  AEGENyyrsggrgrgrgrgrggyggSLSSVD--APSIEDVGQFPTLGKK  253
            AEGE YY   GRGRGRGRG  G+GG  ++ D  APSIED G FP LG K
Sbjct  315  AEGERYYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHFPILGGK  363



>ref|XP_009343931.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Pyrus x bretschneideri]
Length=367

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 114/170 (67%), Gaps = 7/170 (4%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtlee-yeKVLEEKRKALLASK  565
            E EK V  EKQ+ + +T DA KDS  NETEEKEPEE++    E YEKVLEEKRKALLA K
Sbjct  198  ETEKNVGAEKQSGENETADANKDSTVNETEEKEPEEEKEMTLEEYEKVLEEKRKALLALK  257

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKP  394
             EERKV +DK+  +MQLLSNKK ++E+FIKLGS   ++++  E  E+ KK+ +IN+FLKP
Sbjct  258  TEERKVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINQFLKP  317

Query  393  A---EGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
                        G     RG   GG GG  S+V APSIED GQFP+LG K
Sbjct  318  TEGERYYGGRGRGRGRGPRGGYSGGPGGYSSNVAAPSIEDPGQFPSLGGK  367



>ref|XP_002303373.2| nuclear RNA-binding family protein [Populus trichocarpa]
 gb|EEE78352.2| nuclear RNA-binding family protein [Populus trichocarpa]
Length=361

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 117/170 (69%), Gaps = 10/170 (6%)
 Frame = -2

Query  735  EKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEE  556
            EK V TEKQ  +ED  DA KD+   + EEKEPEEKEMTLEEYEKVLEEKRKALL  K EE
Sbjct  193  EKNVITEKQQGEEDAADANKDTA-EKPEEKEPEEKEMTLEEYEKVLEEKRKALLDLKTEE  251

Query  555  RKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPAEG  385
            RKV LDK+   MQ LS+KK+++E+FIKLGS   +++   +  ++ KK  +INEFLKPAEG
Sbjct  252  RKVGLDKDLQCMQQLSSKKSNDEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPAEG  311

Query  384  ENyy------rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            E  Y      R  GRGRG      GYG +   V APSIED GQFP+LG K
Sbjct  312  ERSYNSGRGGRGRGRGRGGYGSGSGYGSNARDVAAPSIEDPGQFPSLGGK  361



>gb|KJB24880.1| hypothetical protein B456_004G166200 [Gossypium raimondii]
Length=363

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 124/169 (73%), Gaps = 6/169 (4%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            NE E+ +  EK   +ED  DA K+S  NE EEKEPE+KEMTLEEYEKVLEEKRKAL A K
Sbjct  196  NEGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALK  255

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKP  394
             EERKV   KEF SMQ LSNKK+++EVFIKLGS   ++++  +  E+ KK+ +INEFLKP
Sbjct  256  IEERKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYDREERAKKSVSINEFLKP  314

Query  393  AEGENyyrsggrgrgrgrgrggyggSLSSVD--APSIEDVGQFPTLGKK  253
            AEGE YY   GRGRGRGRG  G+GG  ++ D  APSIED G FP LG K
Sbjct  315  AEGERYYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHFPILGGK  363



>ref|XP_007209289.1| hypothetical protein PRUPE_ppa007665mg [Prunus persica]
 gb|EMJ10488.1| hypothetical protein PRUPE_ppa007665mg [Prunus persica]
Length=360

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 121/168 (72%), Gaps = 5/168 (3%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            E+EK V  EKQ  + +  DA K++  NE+EEKEPEEKEMTLEEYEKVLEEKRKALLA K 
Sbjct  193  EIEKNVGAEKQLGENEAADANKENTVNESEEKEPEEKEMTLEEYEKVLEEKRKALLALKT  252

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPA  391
            EERKV LDKE  SMQ LSNKK + ++FIKLGS   ++++  E  E+ KK+ +INEFLKPA
Sbjct  253  EERKVDLDKELKSMQQLSNKKENNDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPA  312

Query  390  EGENyyrsggrgrgrgrgrggyggSLSSVD--APSIEDVGQFPTLGKK  253
            EGE YY   GRGRGRG   G  GG        APSIED GQFPTLG K
Sbjct  313  EGERYYGGRGRGRGRGPRGGYSGGPGGYSGSAAPSIEDPGQFPTLGGK  360



>ref|XP_011017364.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
 ref|XP_011017365.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=359

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 95/119 (80%), Gaps = 3/119 (3%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            VLEEKRKALLA K EERKV   KEF SMQ +S+KK + +VFIKLGS+K+K+KEA EK KK
Sbjct  242  VLEEKRKALLALKTEERKVDA-KEFQSMQQISSKKENNDVFIKLGSDKDKRKEASEKAKK  300

Query  423  tKNINEFLKPAEGENyyrsggrgrgrgrgrggygg--SLSSVDAPSIEDVGQFPTLGKK  253
            + +INEFLKPAEGE Y  SGGRGRGRGRG  G+G    +S+V APSIED GQFPTLG K
Sbjct  301  SVSINEFLKPAEGERYQGSGGRGRGRGRGARGFGNRDGISNVPAPSIEDPGQFPTLGGK  359



>ref|XP_002301233.2| transcription factor family protein [Populus trichocarpa]
 gb|ABK94212.1| unknown [Populus trichocarpa]
 gb|EEE80506.2| transcription factor family protein [Populus trichocarpa]
Length=359

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 89/119 (75%), Gaps = 3/119 (3%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            VLEEKRKALLA K EERKV   +EF SMQ +S+KK + +VFIKLGS+K+K+KEA EK KK
Sbjct  242  VLEEKRKALLALKTEERKVDT-REFQSMQQISSKKENNDVFIKLGSDKDKRKEASEKAKK  300

Query  423  tKNINEFLKPAEGE--NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            + +INEFLKPAEGE  +     GRGRGRG    G    +S+V APSIED GQFPTLG K
Sbjct  301  SVSINEFLKPAEGERYHGSGGRGRGRGRGARGFGNRDGISNVPAPSIEDPGQFPTLGGK  359



>ref|NP_001241515.1| uncharacterized protein LOC100807657 [Glycine max]
 gb|ACU21122.1| unknown [Glycine max]
Length=367

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 121/170 (71%), Gaps = 7/170 (4%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            NE EK +  EK   +ED  D  KDSP NETEEKEPE+KEMTLEEYEKVLEE+RKA  A K
Sbjct  199  NETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEEYEKVLEERRKAFQALK  258

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLKP  394
             EERKV   KEF SMQ LS+KK++ ++FIKLGS+K+K+KEA    EK KK+ +I EFLKP
Sbjct  259  TEERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKEAFEKEEKSKKSVSITEFLKP  317

Query  393  AEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE   N  R  GRGRG   G G +G + ++  APSIED G FPTL  K
Sbjct  318  AEGEAYYNPGRGRGRGRGSRGGGGYHGSATNNAPAPSIEDPGHFPTLSAK  367



>ref|XP_011032341.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Populus euphratica]
 ref|XP_011032350.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Populus euphratica]
Length=370

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 116/176 (66%), Gaps = 14/176 (8%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            NE EK    +K   ++   D  K++P NE EEKEPE+K MTLEEYEKVLEEKRKAL A K
Sbjct  197  NEGEKNWGDDKPV-EDAAADGKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALK  255

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktKNINEFLKPAEG  385
             EERKV   KEF SMQ LSNKK + +VFIKLGS+K+K+KEA EK KK+ +INEFLKPAEG
Sbjct  256  TEERKVDA-KEFQSMQQLSNKKENNDVFIKLGSDKDKRKEAYEKAKKSVSINEFLKPAEG  314

Query  384  ENyyrsgg------------rgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            E YY +G               R       G    +SSV APSIED GQFPTLG K
Sbjct  315  ERYYGAGSRSRGRGRGARGFGNRDGMSSGFGSRDGMSSVPAPSIEDPGQFPTLGGK  370



>gb|KJB37647.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=356

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 119/168 (71%), Gaps = 5/168 (3%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK V  EKQ+ +ED  DA K++  NE EEKEPE K    E  + ++EEKRKALLA 
Sbjct  191  VPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKMTLEEYEK-IVEEKRKALLAL  249

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk--ktKNINEFLKP  394
            K EERKV   KEF SMQ LS+KK+++++FIKLGSEK+K+K+A ++ +  K+ +INEFLKP
Sbjct  250  KTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKP  308

Query  393  AEGE-NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE  Y    GRGRGRG   G  G + SSV APSIED G FP+LG K
Sbjct  309  AEGERYYGPGRGRGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  356



>ref|XP_008373667.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=365

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 112/170 (66%), Gaps = 7/170 (4%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtlee-yeKVLEEKRKALLASK  565
            E EK    EKQ+ + +  DA KDS  NETEEKE EE++    E YEKVLEEKRKALLA K
Sbjct  196  ETEKNFGAEKQSGENEAADANKDSTVNETEEKESEEEKEMTLEEYEKVLEEKRKALLALK  255

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKP  394
             EERKV +DK+  +MQLLSNKK ++E+FIKLGS   ++++  E  E+ KK+ +IN+FLKP
Sbjct  256  TEERKVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINQFLKP  315

Query  393  A---EGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            A           G     RG   GG GG  S+V APSIED GQFP+LG K
Sbjct  316  AEGERYYGGRGRGRGRGPRGGYSGGPGGYSSNVAAPSIEDPGQFPSLGGK  365



>ref|XP_008238398.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Prunus mume]
Length=359

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 120/168 (71%), Gaps = 5/168 (3%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            E+EK V  EKQ  + +  DA K++  NE+EEKE EEKEMTLEEYEKVLEEKRKALLA K 
Sbjct  192  EIEKNVGAEKQLGENEAADANKENTVNESEEKELEEKEMTLEEYEKVLEEKRKALLALKT  251

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPA  391
            EERKV LDK+  SMQ LSNKK + ++FIKLGS   ++++  E  E+ KK+ +INEFLKPA
Sbjct  252  EERKVDLDKDLKSMQQLSNKKENNDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPA  311

Query  390  EGENyyrsggrgrgrgrgrggyggSLSSVD--APSIEDVGQFPTLGKK  253
            EGE YY   GRGRGRG   G  GG        APSIED GQFPTLG K
Sbjct  312  EGERYYGGRGRGRGRGPRGGYGGGPGGYSGSAAPSIEDPGQFPTLGGK  359



>ref|XP_008238397.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Prunus mume]
Length=360

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 120/168 (71%), Gaps = 5/168 (3%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            E+EK V  EKQ  + +  DA K++  NE+EEKE EEKEMTLEEYEKVLEEKRKALLA K 
Sbjct  193  EIEKNVGAEKQLGENEAADANKENTVNESEEKELEEKEMTLEEYEKVLEEKRKALLALKT  252

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPA  391
            EERKV LDK+  SMQ LSNKK + ++FIKLGS   ++++  E  E+ KK+ +INEFLKPA
Sbjct  253  EERKVDLDKDLKSMQQLSNKKENNDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPA  312

Query  390  EGENyyrsggrgrgrgrgrggyggSLSSVD--APSIEDVGQFPTLGKK  253
            EGE YY   GRGRGRG   G  GG        APSIED GQFPTLG K
Sbjct  313  EGERYYGGRGRGRGRGPRGGYGGGPGGYSGSAAPSIEDPGQFPTLGGK  360



>ref|XP_002531778.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative 
[Ricinus communis]
 gb|EEF30592.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative 
[Ricinus communis]
Length=364

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 117/166 (70%), Gaps = 3/166 (2%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            E EK +  EK + +E   DA KD+P NE EEKEPE+KEMTLEEYEK+ EE++K+L  SK 
Sbjct  199  ENEKNIGIEKPSGEEGAADANKDNPMNELEEKEPEDKEMTLEEYEKLREERKKSLSLSKA  258

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPA  391
            EERKV ++KEF +M  LSNKK  +E+FIKLGS   +++   +  ++ KK  +INEFLKPA
Sbjct  259  EERKVDVEKEFGTMLQLSNKKGSDEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPA  318

Query  390  EGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            EGE Y+   GRGRGRG   G   GS   V APSIED GQFPTLG K
Sbjct  319  EGERYFGGRGRGRGRGSRGGYGLGSARDVAAPSIEDRGQFPTLGGK  364



>gb|KHG17525.1| Plasminogen activator inhibitor 1 RNA-binding [Gossypium arboreum]
Length=361

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 123/169 (73%), Gaps = 6/169 (4%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            N  E+ +  EK   +ED  DA K+S  NE EEKEPE+KEMTLEEYEKVLEEKRKAL A K
Sbjct  194  NGGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALK  253

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKP  394
             EERKV   KEF SMQ LSNKK+++EVFIKLGS   ++++  +  E+ KK+ +INEFLKP
Sbjct  254  IEERKVDA-KEFESMQQLSNKKSNDEVFIKLGSDKDKRKEAYDREERAKKSVSINEFLKP  312

Query  393  AEGENyyrsggrgrgrgrgrggyggSLSSVD--APSIEDVGQFPTLGKK  253
            AEGE YY   GRGRGRGRG  G+GG  ++ D  APSIED G FP LG K
Sbjct  313  AEGERYYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHFPILGGK  361



>ref|XP_004140509.1| PREDICTED: uncharacterized protein LOC101209927 [Cucumis sativus]
 ref|XP_004166646.1| PREDICTED: uncharacterized LOC101209927 [Cucumis sativus]
 gb|KGN46515.1| hypothetical protein Csa_6G106180 [Cucumis sativus]
Length=361

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 124/170 (73%), Gaps = 6/170 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK V  EK   ++DT     ++P  E +E EPE+KEMTLEEYEK+LE+KRKALLA 
Sbjct  193  VNETEKNVGDEKPIQEDDTSGVNTENPAKEPQETEPEDKEMTLEEYEKLLEDKRKALLAL  252

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK---NINEFLK  397
            K EERKV   KEFASMQ LS+KK++ ++FIKLGSEK+K+KE  +K ++TK   +INEFL+
Sbjct  253  KTEERKVD-PKEFASMQQLSSKKDNNDIFIKLGSEKDKRKEMADKEERTKKSLSINEFLR  311

Query  396  PAEGENyyr--sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PA+GE +Y     GRGRGRG   G  G  +S+V APSI D GQFPTLG K
Sbjct  312  PADGERHYAPGGRGRGRGRGSRGGYSGSPMSNVAAPSIGDPGQFPTLGAK  361



>gb|KHG27284.1| hypothetical protein F383_11722 [Gossypium arboreum]
Length=354

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 119/159 (75%), Gaps = 4/159 (3%)
 Frame = -2

Query  720  TEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEERKVCL  541
            TEKQ  +ED  DA K++  NETEEKEPE KEMTLEEYEK+LEEKRKAL A K E RKV +
Sbjct  197  TEKQFGEEDAADANKENAANETEEKEPENKEMTLEEYEKILEEKRKALAALKTEGRKVDV  256

Query  540  DKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekv--kktKNINEFLKPAEGENyyrs  367
             KEF SMQ LSNKK+++++FIKLGSEK+K+K+A ++   KK+ +INEFLKPAEGE YY  
Sbjct  257  -KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKEEKVKKSVSINEFLKPAEGERYYGP  315

Query  366  ggrgrgrgrgrggyggSLSS-VDAPSIEDVGQFPTLGKK  253
            G         RGGYGG+ +S V APSI D G FP+LG K
Sbjct  316  GRGRGRSRGPRGGYGGNTASNVQAPSIADPGHFPSLGGK  354



>ref|XP_011093237.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Sesamum indicum]
Length=354

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 114/171 (67%), Gaps = 8/171 (5%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTG-DATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             E EK ++ EK + +ED   D   ++  NE  EKEPE KEMTLEEYEKVLEEKRKAL A 
Sbjct  185  GEAEKGLNAEKPSGEEDAAADGDNEAAKNEVGEKEPENKEMTLEEYEKVLEEKRKALQAL  244

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekk---keagekvkktKNINEFLK  397
            K EERKV + KEF S++ LSNKK +++VFIKLGSEK+KK    E  E+ KK  +INEFLK
Sbjct  245  KTEERKVDV-KEFESLKPLSNKKTNDDVFIKLGSEKDKKRELAEKEERAKKAVSINEFLK  303

Query  396  PAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE   N    G       RG    G  +S+V APSIED GQFPTLG K
Sbjct  304  PAEGERYYNPGGRGRGRGRGSRGGYSGGNEMSNVKAPSIEDPGQFPTLGGK  354



>ref|XP_011093236.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Sesamum indicum]
Length=376

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 114/171 (67%), Gaps = 8/171 (5%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTG-DATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             E EK ++ EK + +ED   D   ++  NE  EKEPE KEMTLEEYEKVLEEKRKAL A 
Sbjct  207  GEAEKGLNAEKPSGEEDAAADGDNEAAKNEVGEKEPENKEMTLEEYEKVLEEKRKALQAL  266

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekk---keagekvkktKNINEFLK  397
            K EERKV + KEF S++ LSNKK +++VFIKLGSEK+KK    E  E+ KK  +INEFLK
Sbjct  267  KTEERKVDV-KEFESLKPLSNKKTNDDVFIKLGSEKDKKRELAEKEERAKKAVSINEFLK  325

Query  396  PAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE   N    G       RG    G  +S+V APSIED GQFPTLG K
Sbjct  326  PAEGERYYNPGGRGRGRGRGSRGGYSGGNEMSNVKAPSIEDPGQFPTLGGK  376



>ref|XP_010053521.1| PREDICTED: vasodilator-stimulated phosphoprotein-like [Eucalyptus 
grandis]
Length=368

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 118/169 (70%), Gaps = 9/169 (5%)
 Frame = -2

Query  732  KTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEER  553
            K V +EKQ   E+  DA+K++P NE EEKEPE+KEMTLEEYEKV EEKRKALL  K EER
Sbjct  200  KNVGSEKQLVDEEAADASKENPLNEPEEKEPEDKEMTLEEYEKVREEKRKALLVLKAEER  259

Query  552  KVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPAEGE  382
            KV +DKE  SMQ LS+KK + ++FIKLGS   ++++  E  E+ KK+ +INEFLKPAEGE
Sbjct  260  KVEVDKELKSMQQLSSKKENHDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGE  319

Query  381  Nyy------rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
             YY      R  GRG   G G GG GG      APSIED GQFP+LG K
Sbjct  320  RYYNPGGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGGK  368



>ref|XP_008459799.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=361

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK V  EK   + DT  A  D P  E EE EPE+KEMTLEEYEK+LE+KRK+LLA 
Sbjct  193  VNETEKNVGDEKPIQENDTSGANTDDPAKEPEETEPEDKEMTLEEYEKLLEDKRKSLLAL  252

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekk---keagekvkktKNINEFLK  397
            K EERKV   KEFASMQ LS+KK++ ++FIKLGSEK+K+    +  E+ KK+ +INEFL+
Sbjct  253  KTEERKVDP-KEFASMQQLSSKKDNNDIFIKLGSEKDKRKEIADKEERTKKSLSINEFLR  311

Query  396  PAEGENyyr--sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE +Y     GRGRGRG   G  G S+S+V APSIED GQFP LG K
Sbjct  312  PAEGERHYTPGGRGRGRGRGSRGGYSGSSMSNVAAPSIEDPGQFPILGAK  361



>gb|AEI59279.1| RNA binding protein [Suaeda glauca]
Length=359

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 85/119 (71%), Gaps = 4/119 (3%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALLA K EERKV LDK+F SMQL+S KKND+EVFIKLGS   ++++  E  E+
Sbjct  239  VLEEKRKALLALKAEERKVDLDKDFESMQLVSKKKNDDEVFIKLGSDKDKRKEAAEKDER  298

Query  432  vkktKNINEFLKPAE-GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLG  259
             KK+ +INEFL+PAE   +Y R G      GRG  G G  +++  APSIED  QFP+LG
Sbjct  299  AKKSVSINEFLRPAEGDGHYRRGGRGRSRGGRGGYGGGYGMNNASAPSIEDPSQFPSLG  357



>gb|KJB25493.1| hypothetical protein B456_004G194400 [Gossypium raimondii]
Length=354

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 117/159 (74%), Gaps = 4/159 (3%)
 Frame = -2

Query  720  TEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEERKVCL  541
            TEKQ  +ED  DA K++  NE EEKEPE KEMTLEEYEK+LEEKRKAL A K E RKV +
Sbjct  197  TEKQFGEEDAADANKENAANEAEEKEPENKEMTLEEYEKILEEKRKALDALKTEGRKVDV  256

Query  540  DKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK--NINEFLKPAEGENyyrs  367
             KEF SMQ LSNKK+++++FIKLGSEK+K+K+A ++ K  K  +INEFLKPAEGE YY  
Sbjct  257  -KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKEEKAKKSVSINEFLKPAEGERYYGP  315

Query  366  ggrgrgrgrgrggyggSLSS-VDAPSIEDVGQFPTLGKK  253
            G         RGGYGG+ +S V APSI D G FP+LG K
Sbjct  316  GRGRGRGRGPRGGYGGNTASNVQAPSIADPGHFPSLGGK  354



>gb|KCW77830.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=370

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 121/170 (71%), Gaps = 10/170 (6%)
 Frame = -2

Query  732  KTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEER  553
            KT  +EKQ + ED  DA+K+ P NE EEKEPE+KEMTLEEYEKV EE RK+LLA K EER
Sbjct  201  KTGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEER  260

Query  552  KVCLDKEFASMQLLSNKKND-EEVFIKLGSekekkkeagekvkktK---NINEFLKPAEG  385
            KV LDK+  SMQ LSNKK D  ++FIKLGSEK+K+KEA EK ++ K   +INEFLKPAEG
Sbjct  261  KVELDKDLKSMQQLSNKKKDNNDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEG  320

Query  384  ENyy------rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            E YY      R  GRG   G G GG GG      APSIED GQFP+LG K
Sbjct  321  ERYYNPGGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGGK  370



>gb|KCW77831.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=369

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 118/169 (70%), Gaps = 9/169 (5%)
 Frame = -2

Query  732  KTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEER  553
            K V +EKQ   E+  DA+K++P NE EEKEPE+KEMTLEEYEKV EEKRKALL  K EER
Sbjct  201  KNVGSEKQLVDEEAADASKENPLNEPEEKEPEDKEMTLEEYEKVREEKRKALLVLKAEER  260

Query  552  KVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPAEGE  382
            KV +DKE  SMQ LS+KK + ++FIKLGS   ++++  E  E+ KK+ +INEFLKPAEGE
Sbjct  261  KVEVDKELKSMQQLSSKKENHDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGE  320

Query  381  Nyy------rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
             YY      R  GRG   G G GG GG      APSIED GQFP+LG K
Sbjct  321  RYYNPGGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGGK  369



>ref|XP_009368155.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Pyrus x bretschneideri]
Length=359

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 119/163 (73%), Gaps = 3/163 (2%)
 Frame = -2

Query  732  KTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEER  553
            K V  EKQ+ + +  DA K+   NETEEKEPEEKEMTLEEY+KVLEEKRKALLA K EER
Sbjct  197  KNVSAEKQSGENEAADANKEDAVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEER  256

Query  552  KVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPAEGE  382
            KV +DK+  +MQLLSNKK ++E+FIKLGS   ++++  E  E+ KK+ +INEFLKPAEGE
Sbjct  257  KVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGE  316

Query  381  NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
             YY   GRGRGRG   G  GG   +   PSI D GQFP+LG K
Sbjct  317  RYYGGRGRGRGRGPRGGYSGGPGGNAAPPSIGDPGQFPSLGGK  359



>ref|XP_007218155.1| hypothetical protein PRUPE_ppa007410mg [Prunus persica]
 gb|EMJ19354.1| hypothetical protein PRUPE_ppa007410mg [Prunus persica]
Length=369

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 113/170 (66%), Gaps = 6/170 (4%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            N  E+ +  EK   + D  D  K++P NE EEKEPE+KEMTLEEYEKVLEEKRKAL A K
Sbjct  200  NVTERNLGDEKPVGEVDAADGNKETPANEPEEKEPEDKEMTLEEYEKVLEEKRKALQALK  259

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK---NINEFLKP  394
              E +    KEFAS+Q LSNKK ++++FIKLGS+K+KKKEA EK +K+K   +INEFLKP
Sbjct  260  TSEERKVDTKEFASLQQLSNKKGNDDIFIKLGSDKDKKKEAAEKEEKSKKSVSINEFLKP  319

Query  393  AEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE   N    G       RG      S  S  APSIED GQFPTLG K
Sbjct  320  AEGERFYNPGGRGRGRGRGPRGGFSNNYSHGSAAAPSIEDPGQFPTLGAK  369



>ref|XP_008232490.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Prunus mume]
Length=369

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 113/170 (66%), Gaps = 6/170 (4%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            N  E+ +  EK   + D  D  K++P NE EEKEPE+KEMTLEEYEKVLEEKRKAL A K
Sbjct  200  NVTERNLGDEKPVGEVDAADGNKETPANEPEEKEPEDKEMTLEEYEKVLEEKRKALQALK  259

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK---NINEFLKP  394
              E +    KEFAS+Q LSNKK ++++FIKLGS+K+KKKEA EK +K+K   +INEFLKP
Sbjct  260  TSEERKVDTKEFASLQQLSNKKGNDDIFIKLGSDKDKKKEAAEKEEKSKKSVSINEFLKP  319

Query  393  AEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE   N    G       RG      S  S  APSIED GQFPTLG K
Sbjct  320  AEGERFYNPGGRGRGRGRGPRGGFSNNYSHGSAAAPSIEDPGQFPTLGGK  369



>ref|XP_006853790.1| hypothetical protein AMTR_s00056p00215280 [Amborella trichopoda]
 gb|ERN15257.1| hypothetical protein AMTR_s00056p00215280 [Amborella trichopoda]
Length=403

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 115/183 (63%), Gaps = 17/183 (9%)
 Frame = -2

Query  735  EKTVDTEKQTSQEDTGDATKD--SPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EK    EKQ  QED  DA K+  +  NE EEKEPE+KEMTLEEYEKV EEKRKALLA KP
Sbjct  216  EKNPTPEKQPEQEDGVDAGKEKENAVNEPEEKEPEDKEMTLEEYEKVREEKRKALLAMKP  275

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK-----NINEFLK  397
            EERKV +DKEF SMQ LS KK ++++FIKLGS+K+  +      K  +     +INEFLK
Sbjct  276  EERKVDVDKEFKSMQQLSLKKGNDDIFIKLGSDKDSNRRKDSAEKDERVKKSLSINEFLK  335

Query  396  PAEGE---NyyrsggrgrgrgrgrggyggSLSSVD---APSIEDVGQFPTLGKK*VMNDA  235
            PAEGE   +    G       RG    G + SS +   APSIED GQFPTLG     ND+
Sbjct  336  PAEGEKYYSPGGRGRGRGRGDRGGYRGGYTGSSANVALAPSIEDPGQFPTLG----GNDS  391

Query  234  TLF  226
              F
Sbjct  392  LHF  394



>ref|XP_003552493.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=370

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 117/175 (67%), Gaps = 11/175 (6%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK +  EK   +ED  D  KDSP NETEEKEPE+KEMTLEEYEKVLEE+RKA  A 
Sbjct  197  VNETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEEYEKVLEERRKAFQAL  256

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLK  397
            K EERKV   KEF SMQ LS+KK++ ++FIKLGS+K+K+KEA    EK KK+ +I EFLK
Sbjct  257  KTEERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKEAFEKEEKSKKSVSITEFLK  315

Query  396  PAEGE-------NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE          R  G   G G G    G S ++  APSIED G FP LG K
Sbjct  316  PAEGEAYYNPGRGRGRGRGSRGGGGGGGVYRGSSTNNAPAPSIEDPGHFPNLGAK  370



>gb|ABK94426.1| unknown [Populus trichocarpa]
Length=370

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 93/120 (78%), Gaps = 4/120 (3%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALL+ K EERKV LDK+  SMQ LS+KK+++E+FIKLGS   +++   +  ++
Sbjct  252  VLEEKRKALLSLKAEERKVGLDKDLQSMQQLSSKKSNDEIFIKLGSEKDKRKDAADKEDR  311

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
             KK  +INEFLKPA G + Y + GRGRGRGRGRGGYGG+   V+APSIED GQFPTLG K
Sbjct  312  AKKAVSINEFLKPA-GGDRYYNPGRGRGRGRGRGGYGGNTRDVEAPSIEDPGQFPTLGGK  370



>ref|XP_006368965.1| nuclear RNA-binding family protein [Populus trichocarpa]
 gb|ERP65534.1| nuclear RNA-binding family protein [Populus trichocarpa]
Length=374

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 93/120 (78%), Gaps = 4/120 (3%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALL+ K EERKV LDK+  SMQ LS+KK+++E+FIKLGS   +++   +  ++
Sbjct  256  VLEEKRKALLSLKAEERKVGLDKDLQSMQQLSSKKSNDEIFIKLGSEKDKRKDAADKEDR  315

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
             KK  +INEFLKPA G + Y + GRGRGRGRGRGGYGG+   V+APSIED GQFPTLG K
Sbjct  316  AKKAVSINEFLKPA-GGDRYYNPGRGRGRGRGRGGYGGNTRDVEAPSIEDPGQFPTLGGK  374



>ref|XP_011047584.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=364

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 4/120 (3%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALL+ K EERKV LDK+  SMQ LS+KK++ E+FIKLGS   +++   +  ++
Sbjct  246  VLEEKRKALLSLKAEERKVGLDKDLQSMQQLSSKKSNAEIFIKLGSEKDKRKDAADKEDR  305

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
             KK  +INEFLKPA G + + + GRGRGRGRGRGGYGG+   V+APSIED GQFPTLG K
Sbjct  306  AKKAVSINEFLKPA-GGDRHYNPGRGRGRGRGRGGYGGNTRDVEAPSIEDPGQFPTLGGK  364



>ref|XP_009368154.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Pyrus x bretschneideri]
Length=362

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 113/166 (68%), Gaps = 6/166 (4%)
 Frame = -2

Query  732  KTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEER  553
            K V  EKQ+ + +  DA K+   NETEEKEPEEKEMTLEEY+KVLEEKRKALLA K EER
Sbjct  197  KNVSAEKQSGENEAADANKEDAVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEER  256

Query  552  KVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKPA---  391
            KV +DK+  +MQLLSNKK ++E+FIKLGS   ++++  E  E+ KK+ +INEFLKPA   
Sbjct  257  KVDVDKDLKAMQLLSNKKENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGE  316

Query  390  EGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
                    G     RG   GG GG  S+  APSI D GQFP+LG K
Sbjct  317  RYYGGRGRGRGRGPRGGYSGGPGGYSSNAAAPSIGDPGQFPSLGGK  362



>gb|KDO57094.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=342

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 123/171 (72%), Gaps = 7/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E E T + EK + +E+  DA K++P +E EEKEPEEKEMTLEEYEKVLEEKRKALLA 
Sbjct  173  VAETENT-NAEKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLAL  231

Query  567  K-PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFL  400
            K  EERKV +D+EF SMQ LSNKK++++VFIK+GS   +++   +  EK KK+ +INEFL
Sbjct  232  KTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFL  291

Query  399  KPAEGENy--yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            KPAEGE Y      GRGRGRG   G  G +  +  AP IED GQFP+LG K
Sbjct  292  KPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAAAPKIEDPGQFPSLGGK  342



>ref|XP_006440206.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 ref|XP_006440207.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53446.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53447.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
Length=342

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 124/171 (73%), Gaps = 7/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E E T + EK + +E+  DA K++P +E EEKEPEEKEMTLEEYEKVLEEKRKALLA 
Sbjct  173  VAETENT-NAEKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLAL  231

Query  567  K-PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFL  400
            K  EERKV +D+EF SMQ LSNKK++++VFIK+GS   +++   +  EK KK+ +INEFL
Sbjct  232  KTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFL  291

Query  399  KPAEGENy--yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            KPAEGE Y      GRGRGRG   G  G + SS  AP IED GQFP+LG K
Sbjct  292  KPAEGERYFNPSGRGRGRGRGSRGGYGGSTSSSAAAPKIEDPGQFPSLGGK  342



>ref|XP_006477113.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Citrus sinensis]
Length=342

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 123/171 (72%), Gaps = 7/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E E T + EK + +E+  DA K++P +E EEKEPEEKEMTLEEYEKVLEEKRKALLA 
Sbjct  173  VAETENT-NAEKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLAL  231

Query  567  K-PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFL  400
            K  EERKV +D+EF SMQ LSNKK++++VFIK+GS   +++   +  EK KK+ +INEFL
Sbjct  232  KTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFL  291

Query  399  KPAEGENy--yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            KPAEGE Y      GRGRGRG   G  G +  +  AP IED GQFP+LG K
Sbjct  292  KPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAAAPKIEDPGQFPSLGGK  342



>gb|KHN40549.1| hypothetical protein glysoja_001047 [Glycine soja]
Length=363

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 117/177 (66%), Gaps = 13/177 (7%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK +  EK   +ED  D  KDSP NETEEKEPE+KEMTLEEYEKVLEE+RKA  A 
Sbjct  188  VNETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEEYEKVLEERRKAFQAL  247

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLK  397
            K EERKV   KEF SMQ LS+KK++ ++FIKLGS+K+K+KEA    EK KK+ +I EFLK
Sbjct  248  KTEERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKEAFEKEEKSKKSVSITEFLK  306

Query  396  PAEGE---------NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE            R    G G G G    G S ++  APSIED G FP LG K
Sbjct  307  PAEGEAYYNPGRGRGRGRGSRGGGGGGGGGVYRGSSTNNAPAPSIEDPGHFPNLGAK  363



>gb|KDO57096.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=364

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 123/171 (72%), Gaps = 7/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E E T + EK + +E+  DA K++P +E EEKEPEEKEMTLEEYEKVLEEKRKALLA 
Sbjct  195  VAETENT-NAEKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLAL  253

Query  567  K-PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFL  400
            K  EERKV +D+EF SMQ LSNKK++++VFIK+GS   +++   +  EK KK+ +INEFL
Sbjct  254  KTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFL  313

Query  399  KPAEGENy--yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            KPAEGE Y      GRGRGRG   G  G +  +  AP IED GQFP+LG K
Sbjct  314  KPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAAAPKIEDPGQFPSLGGK  364



>ref|XP_006477112.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Citrus sinensis]
Length=364

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 123/171 (72%), Gaps = 7/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E E T + EK + +E+  DA K++P +E EEKEPEEKEMTLEEYEKVLEEKRKALLA 
Sbjct  195  VAETENT-NAEKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLAL  253

Query  567  K-PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFL  400
            K  EERKV +D+EF SMQ LSNKK++++VFIK+GS   +++   +  EK KK+ +INEFL
Sbjct  254  KTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFL  313

Query  399  KPAEGENy--yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            KPAEGE Y      GRGRGRG   G  G +  +  AP IED GQFP+LG K
Sbjct  314  KPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAAAPKIEDPGQFPSLGGK  364



>ref|XP_006440205.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53445.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
Length=364

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 124/171 (73%), Gaps = 7/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E E T + EK + +E+  DA K++P +E EEKEPEEKEMTLEEYEKVLEEKRKALLA 
Sbjct  195  VAETENT-NAEKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLAL  253

Query  567  K-PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFL  400
            K  EERKV +D+EF SMQ LSNKK++++VFIK+GS   +++   +  EK KK+ +INEFL
Sbjct  254  KTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFL  313

Query  399  KPAEGENy--yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            KPAEGE Y      GRGRGRG   G  G + SS  AP IED GQFP+LG K
Sbjct  314  KPAEGERYFNPSGRGRGRGRGSRGGYGGSTSSSAAAPKIEDPGQFPSLGGK  364



>ref|XP_010053520.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW77832.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=352

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 119/174 (68%), Gaps = 14/174 (8%)
 Frame = -2

Query  732  KTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEER  553
            KT  +EKQ + ED  DA+K+ P NE EEKEPE+KEMTLEEYEKV EE RK+LLA K EER
Sbjct  179  KTGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEER  238

Query  552  KVCLDKEFASMQLLSNKKNDE-EVFIKLGSekekkkeagekvkktK---NINEFLKPAEG  385
            KV LDK+  SMQ LSNKK D  ++FIKLG EK+K+KEA EK +K K   +INEFLKPAEG
Sbjct  239  KVELDKDLKSMQQLSNKKKDNNDIFIKLGCEKDKRKEAAEKEEKAKKSVSINEFLKPAEG  298

Query  384  ENyyr----------sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            E YY               G G G G GG GG    V APSIED GQFP+LG K
Sbjct  299  ERYYNPGGRGRGRGRGARGGYGGGGGGGGGGGYARDVSAPSIEDPGQFPSLGGK  352



>gb|KHN00198.1| hypothetical protein glysoja_034729 [Glycine soja]
Length=128

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKAL A K E RKV + KEFASMQ LSNKK ++E+FIKLGS   +++   E  EK
Sbjct  9    VLEEKRKALQAQKTEARKVDI-KEFASMQPLSNKKENDEIFIKLGSDKDKRKDALEKEEK  67

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggygg-SLSSVDAPSIEDVGQFPTLGK  256
             KK+ NI EFLKPAEGE YY  G         RGGY G + S+  APSIED G FP+LG 
Sbjct  68   SKKSVNITEFLKPAEGERYYPGGRGRGRGRGSRGGYSGNAYSNAPAPSIEDPGHFPSLGG  127

Query  255  K  253
            K
Sbjct  128  K  128



>ref|XP_010053519.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X1 [Eucalyptus grandis]
Length=374

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 119/174 (68%), Gaps = 14/174 (8%)
 Frame = -2

Query  732  KTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEER  553
            KT  +EKQ + ED  DA+K+ P NE EEKEPE+KEMTLEEYEKV EE RK+LLA K EER
Sbjct  201  KTGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEER  260

Query  552  KVCLDKEFASMQLLSNKKNDE-EVFIKLGSekekkkeagekvkktK---NINEFLKPAEG  385
            KV LDK+  SMQ LSNKK D  ++FIKLG EK+K+KEA EK +K K   +INEFLKPAEG
Sbjct  261  KVELDKDLKSMQQLSNKKKDNNDIFIKLGCEKDKRKEAAEKEEKAKKSVSINEFLKPAEG  320

Query  384  ENyyr----------sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            E YY               G G G G GG GG    V APSIED GQFP+LG K
Sbjct  321  ERYYNPGGRGRGRGRGARGGYGGGGGGGGGGGYARDVSAPSIEDPGQFPSLGGK  374



>ref|XP_009373211.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Pyrus x bretschneideri]
Length=372

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 119/172 (69%), Gaps = 8/172 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             N  EK +  EK   + D  D  KD+P NE  EKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  202  ANVTEKNLGDEKPGEEGDAADGNKDTPANEPGEKEPEDKEMTLEEYEKVLEEKRKALQAL  261

Query  567  K-PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK--NINEFLK  397
            K  EERKV   KEF S Q LSNKK ++E+FIKLGS+K+KKK+A ++ K  K  +INEFLK
Sbjct  262  KTTEERKVDA-KEFESFQQLSNKKANDEIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLK  320

Query  396  PAEGENyyrsggrgrgrgrgrg----gyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE  Y  GGRGRGRGRG          S SS  APSIED GQFPTLG K
Sbjct  321  PAEGERSYNPGGRGRGRGRGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  372



>ref|XP_006375155.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 ref|XP_006375156.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 gb|ERP52952.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 gb|ERP52953.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
Length=373

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 117/179 (65%), Gaps = 17/179 (9%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            NE EK +  +K   +E   D  K++P NE EEKEPE+K MTLEEYEKVLEEKRKAL A K
Sbjct  197  NEGEKNLGDDKPV-EEAAADRKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALK  255

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKP  394
             EERKV   KEF SMQ LSNKK + +VFIKLGS   ++++  E  EK KK+ +INEFLKP
Sbjct  256  TEERKVDT-KEFQSMQQLSNKKENNDVFIKLGSDKDKRKEAYEKDEKAKKSVSINEFLKP  314

Query  393  AEGENyyrsggrgrg------------rgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE YY SG RGRG                  G    +SSV APSIED GQFPTLG K
Sbjct  315  AEGERYYGSGSRGRGRGRGARGFGNRDGMSSGFGNRDGMSSVPAPSIEDPGQFPTLGGK  373



>gb|ABK94354.1| unknown [Populus trichocarpa]
Length=373

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 117/179 (65%), Gaps = 17/179 (9%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            NE EK +  +K   +E   D  K++P NE EEKEPE+K MTLEEYEKVLEEKRKAL A K
Sbjct  197  NEGEKNLGDDKPV-EEAAADRKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALK  255

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLKP  394
             EERKV   KEF SMQ LSNKK + +VFIKLGS   ++++  E  EK KK+ +INEFLKP
Sbjct  256  TEERKVDT-KEFQSMQQLSNKKENNDVFIKLGSDKDKRKEAYEKDEKAKKSVSINEFLKP  314

Query  393  AEGENyyrsggrgrg------------rgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE YY SG RGRG                  G    +SSV APSIED GQFPTLG K
Sbjct  315  AEGERYYGSGSRGRGRGRGARGFGNRDGMSSGFGNRDGMSSVPAPSIEDPGQFPTLGGK  373



>ref|XP_006398418.1| hypothetical protein EUTSA_v10000938mg [Eutrema salsugineum]
 gb|ESQ39871.1| hypothetical protein EUTSA_v10000938mg [Eutrema salsugineum]
Length=359

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 114/176 (65%), Gaps = 15/176 (9%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   EKQ+ ++DT DA KD+P +E EEKE E+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  185  EVEKSPVAEKQSGEDDTTDAKKDAPADEQEEKEAEDKEMTLEEYEKILEEKKKALQATKV  244

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK-NINEFLKPAEG  385
            EERKV   K F SMQ LSNKK++EE+FIKLGSEK+K+    E+  K   +INEFLKPA+G
Sbjct  245  EERKVDT-KVFESMQQLSNKKSNEEIFIKLGSEKDKRTTEKEEKAKKSLSINEFLKPADG  303

Query  384  ENyyrsggrgrgrgrgrggyggSL-------------SSVDAPSIEDVGQFPTLGK  256
            E Y   GG    RGR   G  G                   AP I D  QFP+LGK
Sbjct  304  ETYNPRGGYRGSRGREGRGGQGQRGGGVNGRGNPRHGGEAAAPKIGDSAQFPSLGK  359



>ref|XP_008344404.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=367

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 116/171 (68%), Gaps = 8/171 (5%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            N  EK +  EK   + D  D  KD+P NE EEKEPE+KEMTLEEY+KVLEEKRKAL A K
Sbjct  198  NVTEKHLGDEKPVEEGDAADGKKDTPANEPEEKEPEDKEMTLEEYQKVLEEKRKALQALK  257

Query  564  -PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK--NINEFLKP  394
              EERKV   KEF S Q LSNKK ++E+FIKLGS+K+KKK++ ++ K  K  +INEFLKP
Sbjct  258  TTEERKVDA-KEFESFQQLSNKKANDEIFIKLGSDKDKKKDSEKEEKSKKSVSINEFLKP  316

Query  393  AEGEN----yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE       R  GRGRG   G      S SS  APSIED GQFPTLG K
Sbjct  317  AEGERFYNPGGRGRGRGRGSKGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  367



>emb|CDP21265.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 123/171 (72%), Gaps = 7/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQT-SQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLA  571
            +NE EK  + EKQ   +EDT D +K++P NE+EEKEPE KEMTLEEYEKVLEEKRK L  
Sbjct  195  VNEGEKNPNAEKQPPGEEDTADGSKETPANESEEKEPENKEMTLEEYEKVLEEKRKTLQT  254

Query  570  SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK---NINEFL  400
             K EERKV   K FASMQ L+NKK +E+VFIKLGS+K+KKKEA EK +K K   +INEFL
Sbjct  255  LKTEERKVDA-KAFASMQQLANKKANEDVFIKLGSDKDKKKEANEKEEKAKKSLSINEFL  313

Query  399  KPAEGEN--yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            KPAEGE        GRGRGRG    G G S  +V+ PSIED+  FP+LG K
Sbjct  314  KPAEGEKFYNPGGRGRGRGRGSRGYGGGNSYGNVETPSIEDLVLFPSLGSK  364



>gb|KJB25494.1| hypothetical protein B456_004G194400 [Gossypium raimondii]
Length=353

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 110/159 (69%), Gaps = 5/159 (3%)
 Frame = -2

Query  720  TEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEERKVCL  541
            TEKQ  +ED  DA K++  NE EEKEPE K    E  + +LEEKRKAL A K E RKV +
Sbjct  197  TEKQFGEEDAADANKENAANEAEEKEPENKMTLEEYEK-ILEEKRKALDALKTEGRKVDV  255

Query  540  DKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK--NINEFLKPAEGENyyrs  367
             KEF SMQ LSNKK+++++FIKLGSEK+K+K+A ++ K  K  +INEFLKPAEGE YY  
Sbjct  256  -KEFESMQQLSNKKSNDDIFIKLGSEKDKRKDADKEEKAKKSVSINEFLKPAEGERYYGP  314

Query  366  ggrgrgrgrgrggyggSLSS-VDAPSIEDVGQFPTLGKK  253
            G         RGGYGG+ +S V APSI D G FP+LG K
Sbjct  315  GRGRGRGRGPRGGYGGNTASNVQAPSIADPGHFPSLGGK  353



>ref|XP_011465242.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=384

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 120/176 (68%), Gaps = 13/176 (7%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK VD EK   + +  DA K++  +E +EKEPEEKEMTLEEYEKVLEEKRKAL A K 
Sbjct  209  EVEKDVDAEKPLGENEAADANKENAEDEPKEKEPEEKEMTLEEYEKVLEEKRKALAALKT  268

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK---NINEFLKPA  391
            EERKV LDKE  SMQ LS+KK ++E+FIKLGSEK+K+KEA EK ++ K   +INEFLKPA
Sbjct  269  EERKVDLDKELKSMQQLSSKKTNDEIFIKLGSEKDKRKEAAEKEERAKKVVSINEFLKPA  328

Query  390  EGENyyr----------sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            EGE+              G RG   G G GG+  + ++  APSI D   FP+LG K
Sbjct  329  EGESQRHYSGRNRGRGGRGSRGGYSGEGHGGHSSNANAKPAPSIADTALFPSLGGK  384



>ref|XP_004300342.1| PREDICTED: intracellular hyaluronan-binding protein 4-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=385

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 120/176 (68%), Gaps = 13/176 (7%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK VD EK   + +  DA K++  +E +EKEPEEKEMTLEEYEKVLEEKRKAL A K 
Sbjct  210  EVEKDVDAEKPLGENEAADANKENAEDEPKEKEPEEKEMTLEEYEKVLEEKRKALAALKT  269

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK---NINEFLKPA  391
            EERKV LDKE  SMQ LS+KK ++E+FIKLGSEK+K+KEA EK ++ K   +INEFLKPA
Sbjct  270  EERKVDLDKELKSMQQLSSKKTNDEIFIKLGSEKDKRKEAAEKEERAKKVVSINEFLKPA  329

Query  390  EGENyyr----------sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            EGE+              G RG   G G GG+  + ++  APSI D   FP+LG K
Sbjct  330  EGESQRHYSGRNRGRGGRGSRGGYSGEGHGGHSSNANAKPAPSIADTALFPSLGGK  385



>ref|XP_010924482.1| PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1-like 
protein [Elaeis guineensis]
Length=376

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 115/179 (64%), Gaps = 15/179 (8%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQED--TGDATKDSPPNeteekepeekemtl-eeyeKVLEEKRKAL  577
            +N  +K V TEKQ  QED  + +A KD      EE++  E +    EEYEK+ EEKRKAL
Sbjct  198  VNADDKLVATEKQQEQEDAPSSEANKDKDVQTNEEEKEPEDKEMTLEEYEKIREEKRKAL  257

Query  576  LASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeagekvkktKNI  412
            LA K EERKV +D+E  SMQ LS+KK +E+VFIKLGS     +K+   +  E+ KK+ +I
Sbjct  258  LALKIEERKVEIDRELQSMQQLSSKKGNEDVFIKLGSDKDMGKKKDVADRDERGKKSVSI  317

Query  411  NEFLKPAEGENyyrsggrgrgrgrgrggyggSL-------SSVDAPSIEDVGQFPTLGK  256
            N+FLKPAEGE YY + GRGRGRGRG  G            +   APSIED GQFPTLGK
Sbjct  318  NQFLKPAEGERYYSATGRGRGRGRGGRGPFRGGFGGGDTSAPAAAPSIEDPGQFPTLGK  376



>ref|XP_008347095.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=236

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 115/171 (67%), Gaps = 8/171 (5%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            N  EK +  EK   + D  D  KD+P  E  EKEPE+KEMTLEEYEKVLEEKRKAL A K
Sbjct  67   NVTEKNLGDEKLVEEGDAADGNKDTPAKEPGEKEPEDKEMTLEEYEKVLEEKRKALQALK  126

Query  564  -PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK--NINEFLKP  394
              EERKV   KEF S Q LSNKK ++E+FIKLGS+K+KKK+A ++ K  K  +INEFLKP
Sbjct  127  TTEERKVDA-KEFESFQQLSNKKANDEIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKP  185

Query  393  AEGENyy----rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE  Y    R  GRGRG   G      S SS  APSIED GQFPTLG K
Sbjct  186  AEGERSYNPGGRGRGRGRGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  236



>dbj|BAE71297.1| hypothetical protein [Trifolium pratense]
Length=371

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 120/172 (70%), Gaps = 11/172 (6%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQED-TGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            NE EK V  EK    ED T +  KD+P NE EEKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  198  NEPEKNVAEEKPAGGEDATAEGNKDAPANEAEEKEPEDKEMTLEEYEKVLEEKRKALQAL  257

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea--gekvkktKNINEFLKP  394
            K E RKV   KEF SM+ LS KK ++E+F KLGS+K+K+K+A   EK KK  +INEFLKP
Sbjct  258  KTEGRKVDT-KEFESMKPLSCKKENDEIFAKLGSDKDKRKDAFEKEKAKKALSINEFLKP  316

Query  393  AEGENyy-------rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLG  259
            AEGE YY       R G  GRG  RG G  G + S+V APSIED GQFPTLG
Sbjct  317  AEGEKYYNPGGRGGRGGRGGRGGSRGGGYGGNAYSNVPAPSIEDPGQFPTLG  368



>ref|XP_004515346.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cicer arietinum]
Length=371

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 118/171 (69%), Gaps = 9/171 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             NE EK +  EK   +E+  D +K++P NE EEKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  199  ANETEKNLGEEKPAGEEEAADVSKETPANEAEEKEPEDKEMTLEEYEKVLEEKRKALQAL  258

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea--gekvkktKNINEFLKP  394
            K E RKV   KEF SM+ LS KK++ E+F KLGS+K+K+KEA   EK KK  +INEFLKP
Sbjct  259  KTEGRKVDA-KEFESMKPLSCKKDNVEIFAKLGSDKDKRKEAFDKEKSKKALSINEFLKP  317

Query  393  AEGE------NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLG  259
            A+GE           GGRG    RG G  G + S+V APSIED GQFPTLG
Sbjct  318  ADGEKFYNPGGRGGRGGRGGRGSRGGGFGGNAYSNVPAPSIEDPGQFPTLG  368



>ref|XP_004150996.1| PREDICTED: uncharacterized protein LOC101210473 [Cucumis sativus]
 ref|XP_004166647.1| PREDICTED: uncharacterized LOC101210473 [Cucumis sativus]
 gb|KGN46514.1| hypothetical protein Csa_6G105680 [Cucumis sativus]
Length=360

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 125/172 (73%), Gaps = 9/172 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             NE +K  D EK   ++DT     ++P  E+EEKEPE+KEMTLEEYEK+L+EKRK+LLA 
Sbjct  191  ANESQKLGD-EKPVHEDDTAGVNTENPAKESEEKEPEDKEMTLEEYEKLLDEKRKSLLAL  249

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLK  397
            K EERKV   KEFAS+Q LS+KK ++++FIKLGS   ++++  +  E+ KK+ +INEFLK
Sbjct  250  KTEERKVDP-KEFASLQQLSSKKENQDIFIKLGSDKDKRKETADKEERTKKSVSINEFLK  308

Query  396  PAEGENyyrsggrgrgrgrgrggyggSLSS----VDAPSIEDVGQFPTLGKK  253
            PAEGE +Y  GGRGRGRGRG  G G   SS    V APSIED GQFPTLG K
Sbjct  309  PAEGEKHYTPGGRGRGRGRGSRGGGYVGSSMSSNVAAPSIEDPGQFPTLGAK  360



>ref|XP_010918620.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Elaeis guineensis]
Length=369

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 82/128 (64%), Gaps = 12/128 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            + EEKRKALLA K EERKV +DKE  SMQ LS KK +++VFIKLGS     +K+   +  
Sbjct  242  IREEKRKALLAMKTEERKVEIDKELQSMQQLSLKKGNDDVFIKLGSDKDMGKKKDVADRD  301

Query  438  ekvkktKNINEFLKPAEGENyyr-------sggrgrgrgrgrggyggSLSSVDAPSIEDV  280
            E+ KK  +INEFLKPAEGE YY         G   RG  RG  G  G+ +   APSIED 
Sbjct  302  ERAKKPVSINEFLKPAEGERYYSPVGRGRGRGRGDRGPFRGGFGGRGTSTPATAPSIEDP  361

Query  279  GQFPTLGK  256
            GQFPTLGK
Sbjct  362  GQFPTLGK  369



>ref|XP_007139646.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris]
 gb|ESW11640.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris]
Length=365

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 118/171 (69%), Gaps = 8/171 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK +  EK  + E+  D  KDSP NETEEKEPE+KEMTLEEYEKVLEE+RKA  A 
Sbjct  197  VNETEKNLGDEK-PAVEEVADGNKDSPANETEEKEPEDKEMTLEEYEKVLEERRKAFQAL  255

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLK  397
            K E RKV   KEF +MQ LS+KK + ++FIKLGS+K+K+KEA    EK KK+ +I EFLK
Sbjct  256  KTEGRKVDA-KEFETMQPLSSKKTNHDIFIKLGSDKDKRKEALEKEEKSKKSVSITEFLK  314

Query  396  PAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE   N    G    GRG   G  GG+ ++  APSIED G FPTLG K
Sbjct  315  PAEGETYYNPGGRGRGRGGRGSRGGYRGGATNNAPAPSIEDPGHFPTLGAK  365



>ref|XP_008375773.1| PREDICTED: LOW QUALITY PROTEIN: plasminogen activator inhibitor 
1 RNA-binding protein-like [Malus domestica]
Length=373

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 118/171 (69%), Gaps = 8/171 (5%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            N  EK +  EK   + D  D  KD+P  E  EKEPE+KEMTLEEYEKVLEEKRKAL A K
Sbjct  204  NVTEKNLGDEKLVEEGDAADGNKDTPXKEPGEKEPEDKEMTLEEYEKVLEEKRKALQALK  263

Query  564  -PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK--NINEFLKP  394
              EERKV   KEF S Q LSNKK ++E+FIKLGS+K+KKK+A ++ K  K  +INEFLKP
Sbjct  264  TTEERKVDA-KEFESFQQLSNKKANDEIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKP  322

Query  393  AEGENyyrsggrgrgrgrgrg----gyggSLSSVDAPSIEDVGQFPTLGKK  253
            AEGE  Y  GGRGRGRGRG          S SS  APSIED GQFPTLG K
Sbjct  323  AEGERSYNPGGRGRGRGRGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  373



>ref|XP_002458112.1| hypothetical protein SORBIDRAFT_03g027110 [Sorghum bicolor]
 gb|EES03232.1| hypothetical protein SORBIDRAFT_03g027110 [Sorghum bicolor]
Length=366

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 82/128 (64%), Gaps = 11/128 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALL  KPEERKV +DKE  SMQ LS KK  +E+FIKLGS   +K++  E  E+
Sbjct  239  VLEEKRKALLGLKPEERKVEVDKELQSMQQLSVKKGADEIFIKLGSDKDKKKENTERDER  298

Query  432  vkktKNINEFLKPAEGENyyr--------sggrgrgrgrgrggyggSLSSVDAPSIEDVG  277
             KK+ +INEFLKPAEG+ YY           GRG   G   G     +++  AP+I+D  
Sbjct  299  AKKSVSINEFLKPAEGQRYYSPGGRGRGRGRGRGDRGGFRGGYSPREVAAAPAPAIQDQA  358

Query  276  QFPTLGKK  253
            QFP+LG K
Sbjct  359  QFPSLGGK  366



>gb|ABY60453.1| putative nuclear RNA binding protein, partial [Adonis aestivalis 
var. palaestina]
Length=154

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 88/128 (69%), Gaps = 11/128 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALLA K EERKV +DK+F SMQ LS KKN++E+F KLGS   +K++  E  EK
Sbjct  26   VLEEKRKALLALKVEERKVTVDKDFESMQQLSGKKNNDEIFAKLGSDKDKKKEIAEKEEK  85

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS--------SVDAPSIEDVG  277
             KK  +INEFLKPA GE YY  GGRGRGRG   G  GG           +V+APSIED G
Sbjct  86   AKKAVSINEFLKPAGGEKYYSPGGRGRGRGGRGGARGGGAGGFSGGVSKNVEAPSIEDPG  145

Query  276  QFPTLGKK  253
            +FP L KK
Sbjct  146  EFPNLLKK  153



>ref|XP_004306983.1| PREDICTED: circumsporozoite protein-like [Fragaria vesca subsp. 
vesca]
Length=387

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 120/171 (70%), Gaps = 7/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            ++  EK +  EK   + +  D +K++P NE EEKEPEEKEMTLEEYEKVLEEKRKAL A 
Sbjct  218  VDATEKNLGEEKLVGEVEAADGSKETPANEPEEKEPEEKEMTLEEYEKVLEEKRKALQAL  277

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK---NINEFLK  397
            K EERKV   KEF S+Q +SNKK +++VFIKLGS+K+KKKE+ EK +K K   +INEFLK
Sbjct  278  KTEERKVDT-KEFESLQQISNKKGNDDVFIKLGSDKDKKKESAEKEEKAKKSVSINEFLK  336

Query  396  PAEGENyyrsggrgrgrgrgrggyggS---LSSVDAPSIEDVGQFPTLGKK  253
            PAEGE +      GRGRGRG  G   S    SSV AP IED   FPTLG K
Sbjct  337  PAEGERFSYPSRGGRGRGRGPRGGSSSNYPQSSVRAPPIEDPSHFPTLGGK  387



>ref|XP_003624316.1| Transcription factor [Medicago truncatula]
Length=625

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 116/170 (68%), Gaps = 8/170 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK +  EK   + D  +  KDSP NE EEKEPE+KEMTLEEYEKVLEEKRKAL   
Sbjct  208  MNEGEKNLGDEKPAVEADVAEGNKDSPANEAEEKEPEDKEMTLEEYEKVLEEKRKALQTL  267

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLK  397
            K EERKV   K F +MQ LS KK++ E+F KLG+   ++++  +  EK KK+ +INEFLK
Sbjct  268  KTEERKVDT-KAFETMQALSCKKDNTEIFAKLGADKDKRKEAYDKEEKAKKSVSINEFLK  326

Query  396  PAEGENyyrs----ggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLG  259
            PAEGE++Y S     GRG    RG G  G S S+V APSIED G FPTLG
Sbjct  327  PAEGESHYNSGGRGRGRGGRGARGGGFRGNSYSNVPAPSIEDPGHFPTLG  376



>ref|XP_006654864.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=379

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 79/130 (61%), Gaps = 13/130 (10%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS----ekekkkeage  436
            VLEEKRKALLA K EERKV +DKE  SMQ LS KK++EEVFIKLGS    +K++  E  E
Sbjct  250  VLEEKRKALLALKAEERKVEVDKELQSMQQLSVKKDNEEVFIKLGSDKDLKKKEIAERDE  309

Query  435  kvkktKNINEFLKPAEGENyy---------rsggrgrgrgrgrggyggSLSSVDAPSIED  283
            + KK+ +INEFLKPAEGE YY           G        G     G      AP+IED
Sbjct  310  RAKKSLSINEFLKPAEGERYYNPSGRGRGRGRGRGEHRGFYGGFNGNGGRRHASAPAIED  369

Query  282  VGQFPTLGKK  253
              QFP+LG K
Sbjct  370  QAQFPSLGGK  379



>gb|KDO57095.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=363

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 122/171 (71%), Gaps = 8/171 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E E T + EK + +E+  DA K++P +E EEKEPEEKEMTLEEYEKVLEEKRKALLA 
Sbjct  195  VAETENT-NAEKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLAL  253

Query  567  K-PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFL  400
            K  EERKV +D+EF SMQ LSNKK++++VFIK GS   +++   +  EK KK+ +INEFL
Sbjct  254  KTAEERKVDVDEEFKSMQPLSNKKSNDDVFIK-GSEKDKRKDAADKEEKAKKSVSINEFL  312

Query  399  KPAEGENy--yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            KPAEGE Y      GRGRGRG   G  G +  +  AP IED GQFP+LG K
Sbjct  313  KPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAAAPKIEDPGQFPSLGGK  363



>ref|XP_007142624.1| hypothetical protein PHAVU_007G003500g [Phaseolus vulgaris]
 gb|ESW14618.1| hypothetical protein PHAVU_007G003500g [Phaseolus vulgaris]
Length=358

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 121/173 (70%), Gaps = 9/173 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQED-TGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLA  571
            INE  K     K + ++D   D  K++P NE EEKEPE+KEMTLEEYEKVLEE+RKAL A
Sbjct  187  INETAKNFSEVKPSGEDDVAADGNKENPANEAEEKEPEDKEMTLEEYEKVLEERRKALQA  246

Query  570  SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFL  400
             K EERKV   K F SMQ LSNKK++ ++FIKLGSEK+K+KE     EK KK+ +INEFL
Sbjct  247  LKTEERKVDT-KVFESMQQLSNKKDNFDIFIKLGSEKDKRKETLEKEEKAKKSVSINEFL  305

Query  399  KPAEGEN----yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            KP EGE+      R  GRGRGRG   G  G + ++V APSIED GQFPTLG K
Sbjct  306  KPPEGESFYSAGGRGRGRGRGRGARGGFGGYATANVTAPSIEDPGQFPTLGVK  358



>gb|ABR26138.1| salt tolerance protein 2 [Oryza sativa Indica Group]
Length=175

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 81/128 (63%), Gaps = 9/128 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALL+ K EERKV +DKE  SMQ LS KK+ +EVFIKLGS   +K++  E  E+
Sbjct  47   VLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKENVERDER  106

Query  432  vkktKNINEFLKPAEGENyyr------sggrgrgrgrgrggyggSLSSVDAPSIEDVGQF  271
             +K+ +INEFLKPAEGE YY         GRGRG   G      S   V AP IED  QF
Sbjct  107  TRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAAPRIEDQAQF  166

Query  270  PTLGKK*V  247
            P L  + V
Sbjct  167  PGLAGRLV  174



>emb|CDY40563.1| BnaC02g33290D [Brassica napus]
Length=330

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 124/170 (73%), Gaps = 9/170 (5%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   EK+  ++DT DA KD+P +E +EKEPE+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  162  EVEKSPVAEKEGGEDDTTDAKKDTPADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKV  221

Query  561  EERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK---NINEFLKP  394
            EERKV   K F SMQ LS+KK N+EE+FIKLGS+K+K+K+A EK +K K   +INEFLKP
Sbjct  222  EERKVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKP  280

Query  393  AEGENyyrsggrgrgrgrgrggyggSLSSVD----APSIEDVGQFPTLGK  256
            A+GE Y   GG  RGRG   GG G     V+    AP+I D  QFP+LGK
Sbjct  281  ADGERYNPRGGGYRGRGGRNGGRGQRDEKVNEGAPAPAIGDSAQFPSLGK  330



>ref|XP_006644341.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=370

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 84/126 (67%), Gaps = 9/126 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkk---eagek  433
            VLEEKRKALL+ K EERKV +DKE  SMQ LS KK+ +EVFIKLGS+K+KKK   E  E+
Sbjct  245  VLEEKRKALLSLKAEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKENVERDER  304

Query  432  vkktKNINEFLKPAEGENyyr------sggrgrgrgrgrggyggSLSSVDAPSIEDVGQF  271
             +K+ +INEFLKPAEGE YY         GRGRG   G      S   V AP+IED  QF
Sbjct  305  TRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAAPAIEDQAQF  364

Query  270  PTLGKK  253
            P+L  K
Sbjct  365  PSLAGK  370



>ref|XP_009395730.1| PREDICTED: keratin, type II cytoskeletal 2 epidermal-like [Musa 
acuminata subsp. malaccensis]
Length=381

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 85/129 (66%), Gaps = 12/129 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            V EEKRKAL A K EERKV +DK+  SM+ LS KK ++++F+KLGS+K+  K+     + 
Sbjct  253  VREEKRKALAAMKSEERKVEMDKDLQSMKQLSLKKENDDIFVKLGSDKDTGKKKENTDRD  312

Query  423  tKN-----INEFLKPAEGENyyrsggrgrgrgrgrggyggSLS-------SVDAPSIEDV  280
             +N     INEFLKPAEGE YY SGGRGRGRGRG  G             + DAPSIED 
Sbjct  313  ERNKKPMSINEFLKPAEGERYYNSGGRGRGRGRGGRGQFRGGFMGGVSTFTTDAPSIEDP  372

Query  279  GQFPTLGKK  253
            GQFPTLG K
Sbjct  373  GQFPTLGGK  381



>ref|XP_010104826.1| hypothetical protein L484_024026 [Morus notabilis]
 gb|EXC02062.1| hypothetical protein L484_024026 [Morus notabilis]
Length=463

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 84/121 (69%), Gaps = 7/121 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALLA K EERKV   KEF SMQ LS+KK ++E+FIKLGS   ++++  E  EK
Sbjct  270  VLEEKRKALLALKTEERKVD-SKEFESMQQLSSKKGNDEIFIKLGSEKDKRKEAAEKEEK  328

Query  432  vkktKNINEFLKPAEGENyyr---sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTL  262
             KK+ +INEFLKPAEGE YY     G       RG  G G S S+V APSIED GQFPTL
Sbjct  329  AKKSLSINEFLKPAEGERYYTPGGRGRGRGRGSRGGYGGGYSSSNVAAPSIEDPGQFPTL  388

Query  261  G  259
            G
Sbjct  389  G  389



>gb|AFK43517.1| unknown [Lotus japonicus]
Length=370

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 118/173 (68%), Gaps = 10/173 (6%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             NE EK +  EK  + ED  D  K+S  NE EEKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  200  ANETEKNLSDEK-PAVEDVADGNKESSANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQ  258

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLK  397
            K E RKV + KEF SMQ LS KK++ ++F KLGS+K+K+KEA    EK KK+ +INEFLK
Sbjct  259  KTEGRKVDI-KEFESMQPLSCKKDNNDIFAKLGSDKDKRKEAFEKEEKAKKSVSINEFLK  317

Query  396  PAEGENyy-----rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE YY     R  GRG   G G    G + S+  APSIED G FPTLG K
Sbjct  318  PAEGETYYPSGRGRGRGRGSRGGGGGSFRGNATSNAPAPSIEDPGHFPTLGGK  370



>gb|AES80534.2| nuclear RNA-binding-like protein [Medicago truncatula]
Length=583

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 115/169 (68%), Gaps = 8/169 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK +  EK   + D  +  KDSP NE EEKEPE+KEMTLEEYEKVLEEKRKAL   
Sbjct  208  MNEGEKNLGDEKPAVEADVAEGNKDSPANEAEEKEPEDKEMTLEEYEKVLEEKRKALQTL  267

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLK  397
            K EERKV   K F +MQ LS KK++ E+F KLG+   ++++  +  EK KK+ +INEFLK
Sbjct  268  KTEERKVDT-KAFETMQALSCKKDNTEIFAKLGADKDKRKEAYDKEEKAKKSVSINEFLK  326

Query  396  PAEGENyyrs----ggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTL  262
            PAEGE++Y S     GRG    RG G  G S S+V APSIED G FPTL
Sbjct  327  PAEGESHYNSGGRGRGRGGRGARGGGFRGNSYSNVPAPSIEDPGHFPTL  375



>gb|ABD65038.1| nuclear RNA binding protein, putative [Brassica oleracea]
Length=336

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 123/170 (72%), Gaps = 9/170 (5%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   EK+  ++DT DA KD P +E +EKEPE+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  168  EVEKSPVAEKEGGEDDTTDAKKDPPADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKV  227

Query  561  EERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK---NINEFLKP  394
            EERKV   K F SMQ LS+KK N+EE+FIKLGS+K+K+K+A EK +K K   +INEFLKP
Sbjct  228  EERKVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEKEEKAKKSFSINEFLKP  286

Query  393  AEGENyyrsggrgrgrgrgrggyggSLSSVD----APSIEDVGQFPTLGK  256
            A+GE Y   GG  RGRG   GG G     V+    AP+I D  QFP+LGK
Sbjct  287  ADGERYNPRGGGYRGRGGRNGGRGQRDEKVNEGAPAPAIGDSAQFPSLGK  336



>ref|XP_009101440.1| PREDICTED: suppressor protein STM1 [Brassica rapa]
Length=333

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 116/172 (67%), Gaps = 11/172 (6%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   E    ++DT DA KDSP  E EEKEPE+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  163  EVEKSPVAENDGGEDDTTDAKKDSPAAEQEEKEPEDKEMTLEEYEKILEEKKKALQATKV  222

Query  561  EERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK---NINEFLKP  394
            EERKV   K F SMQ LSNKK N+EE+FIKLGS+K+K+K+A EK +KTK   +INEFLKP
Sbjct  223  EERKVDT-KVFESMQQLSNKKTNNEEIFIKLGSDKDKRKDAAEKEEKTKKSLSINEFLKP  281

Query  393  AEGEN------yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGK  256
            A+GE        YR  G   G    R G         AP+I D  QFP+LGK
Sbjct  282  ADGERYNNPRGGYRGRGGRGGGRGQRDGGNQRHGGAPAPAIGDSAQFPSLGK  333



>ref|XP_008810382.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Phoenix dactylifera]
Length=373

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 81/129 (63%), Gaps = 13/129 (10%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekk-----keag  439
            + EEKRKALLA K EERKV +D+E  SMQ LS KK +++VF+KLGS+K+        +  
Sbjct  245  IREEKRKALLALKTEERKVEIDQELQSMQQLSLKKRNDDVFMKLGSDKDTGKKKDVADRD  304

Query  438  ekvkktKNINEFLKPAEGENyyr--------sggrgrgrgrgrggyggSLSSVDAPSIED  283
            E+ KK  +INEFLKPAEGE YY         + G       G GG  GS +   APSIED
Sbjct  305  ERAKKPVSINEFLKPAEGERYYSPVGRGRGRARGDRGQFRGGFGGGRGSGAPATAPSIED  364

Query  282  VGQFPTLGK  256
             GQFPTLGK
Sbjct  365  PGQFPTLGK  373



>ref|XP_008811725.1| PREDICTED: uncharacterized protein LOC103722810 [Phoenix dactylifera]
Length=140

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 83/125 (66%), Gaps = 15/125 (12%)
 Frame = -2

Query  582  ALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagek-----vkktK  418
            ALLASKPEERKV LDK+F SMQLLS KK +++VF+KLG++K+  K+         VKK+ 
Sbjct  16   ALLASKPEERKVELDKDFESMQLLSLKKGNDDVFMKLGTDKDSGKKRDNADREERVKKSF  75

Query  417  NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS----------SVDAPSIEDVGQFP  268
            +I EFLKPAEGE YY  GGRG GRGRGRG                 +  APSIED GQFP
Sbjct  76   SITEFLKPAEGERYYSPGGRGFGRGRGRGRGDRRPFGDGFGSGVTVNATAPSIEDPGQFP  135

Query  267  TLGKK  253
            TLG K
Sbjct  136  TLGGK  140



>gb|AAF14244.1|AF110228_1 nuclear RNA binding protein A [Spinacia oleracea]
Length=356

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 82/124 (66%), Gaps = 7/124 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALLA K EERKV +DK+F SMQL + KK D+EVFI+L S   +K++  E  EK
Sbjct  232  VLEEKRKALLALKAEERKVDVDKDFESMQLKTKKKVDDEVFIQLNSDKDKKKEAAEKEEK  291

Query  432  vkktKNINEFLKPAEG----ENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPT  265
             KK+ +INEFL+PAEG    +     G  GRG   G GG G  ++   AP IED  QFPT
Sbjct  292  AKKSVSINEFLRPAEGGDQYQRRGGRGRGGRGGRGGNGGGGYGMNHATAPKIEDPNQFPT  351

Query  264  LGKK  253
            LG K
Sbjct  352  LGGK  355



>ref|XP_009776248.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana sylvestris]
Length=363

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 115/173 (66%), Gaps = 11/173 (6%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            NE EK ++ EK ++  + GD  K++P  E E+KEPE KEMTLEEYEKVLEEKR+AL A K
Sbjct  193  NEGEKNLNVEKPSADGEAGDDKKENPAAEAEDKEPENKEMTLEEYEKVLEEKRQALQALK  252

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK--NINEFLKPA  391
             EERKV + KEF SMQ LS K +D+ +FIKLG + ++++ A ++ K  K  +INEFLKPA
Sbjct  253  TEERKVDI-KEFESMQQLSKKSSDD-IFIKLGPKDKRRESAEKEEKAKKAVSINEFLKPA  310

Query  390  EGENyyr-------sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            EGE YY          GRG     G  G   + S+V+AP IED G FPTLG K
Sbjct  311  EGERYYAPGGRGRGGRGRGSRGYGGGYGGANTTSNVEAPLIEDPGHFPTLGGK  363



>emb|CAA66481.1| transcription factor [Vicia faba var. minor]
Length=370

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 118/174 (68%), Gaps = 10/174 (6%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK    EK  ++ D  +  KD+P NE EEKEPE+KEMTLEEYEK+LEEKRKAL A 
Sbjct  198  VNEAEKNFGDEKPAAENDVAEGNKDTPANEAEEKEPEDKEMTLEEYEKLLEEKRKALQAL  257

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLK  397
            K EERKV   KEF +MQ LS KK++ E+F KLGS+K+K+KEA    EK KK+ +INEFLK
Sbjct  258  KTEERKVDT-KEFETMQALSCKKDNFEIFAKLGSDKDKRKEAFDKEEKAKKSVSINEFLK  316

Query  396  PAEGENyyrsggrgrgrgrgrggygg------SLSSVDAPSIEDVGQFPTLGKK  253
            PAEGE YY  GGRG          G       S S+V APSIED G FPTLG K
Sbjct  317  PAEGEGYYNQGGRGGRGRGRGTRGGFGGFRGNSTSNVPAPSIEDPGHFPTLGAK  370



>ref|NP_001148572.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 gb|ACG32086.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=364

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 76/121 (63%), Gaps = 7/121 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS----ekekkkeage  436
            VLEEKRKALL+ K EERKV +DKE  +MQ LS KK+ +EVFIKLGS    +K++  E  E
Sbjct  243  VLEEKRKALLSLKAEERKVEIDKELQAMQQLSVKKDGDEVFIKLGSDKDLKKKESAEREE  302

Query  435  kvkktKNINEFLKPAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPT  265
            + KK+ +INEFLKPAEGE   N    G      G   G  GG      AP+IED  QFP 
Sbjct  303  RGKKSLSINEFLKPAEGERYYNPSGRGRGRGRGGFRGGYNGGYRGPAAAPAIEDQAQFPA  362

Query  264  L  262
            L
Sbjct  363  L  363



>ref|NP_001056483.1| Os05g0589600 [Oryza sativa Japonica Group]
 gb|AAT38003.1| putative nuclear RNA binding protein A [Oryza sativa Japonica 
Group]
 gb|AAT58811.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18397.1| Os05g0589600 [Oryza sativa Japonica Group]
 gb|EEE64880.1| hypothetical protein OsJ_19739 [Oryza sativa Japonica Group]
Length=383

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            VLEEKRKALLA K EERKV +DKE  +MQ LS KK +EEVFIKLGS+K+ KK+  ++  +
Sbjct  255  VLEEKRKALLALKAEERKVEVDKELQAMQQLSVKKANEEVFIKLGSDKDLKKKEKDEKDE  314

Query  423  tK----NINEFLKPAEGENyy--------rsggrgrgrgrgrggyggSLSSVDAPSIEDV  280
                  +INEFLKPAEGE YY          G   RG   G     G      AP IED 
Sbjct  315  RTKKSLSINEFLKPAEGERYYNPGRGRGRGRGRGDRGGFYGGYNGNGGRRQAAAPVIEDQ  374

Query  279  GQFPTLGKK  253
             QFP+LG K
Sbjct  375  AQFPSLGGK  383



>gb|KHN27127.1| hypothetical protein glysoja_032895 [Glycine soja]
Length=319

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 119/173 (69%), Gaps = 9/173 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGD-ATKDSPPNeteekepeekemtleeyeKVLEEKRKALLA  571
            +NE  K    EK + ++D      K++P NE EEKEPE+KEMTLEEYEKVLEE+RKAL A
Sbjct  148  VNETSKNFGDEKPSGEDDVAAIGNKENPANEAEEKEPEDKEMTLEEYEKVLEERRKALQA  207

Query  570  SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFL  400
             K EERKV   K F SMQ LSNKK+ +++FIKLGS+K+K++E     +K KK+ NINEFL
Sbjct  208  LKTEERKVDT-KVFESMQQLSNKKDIDDIFIKLGSDKDKRRETLEKEDKSKKSVNINEFL  266

Query  399  KPAEGENyy----rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            K  EGE+YY         GRGRG   G  G + +++ APSIED GQFPTLG K
Sbjct  267  KSPEGESYYNPGGHGRRHGRGRGARGGYGGYATANIPAPSIEDPGQFPTLGVK  319



>gb|AFW81314.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=365

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 76/121 (63%), Gaps = 7/121 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS----ekekkkeage  436
            VLEEKRKALL+ K EERKV +DKE  +MQ LS KK+ +EVFIKLGS    +K++  E  E
Sbjct  244  VLEEKRKALLSLKAEERKVEIDKELQAMQQLSVKKDGDEVFIKLGSDKDLKKKESAEREE  303

Query  435  kvkktKNINEFLKPAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPT  265
            + KK+ +INEFLKPAEGE   N    G      G   G  GG      AP+IED  QFP 
Sbjct  304  RGKKSLSINEFLKPAEGERYYNPSGRGRGRGRGGFRGGYNGGYRGPAAAPAIEDQAQFPA  363

Query  264  L  262
            L
Sbjct  364  L  364



>gb|EAY99238.1| hypothetical protein OsI_21200 [Oryza sativa Indica Group]
Length=383

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 78/129 (60%), Gaps = 12/129 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            VLEEKRKALLA K EERKV +DKE  +MQ LS KK +EEVFIKLGS+K+ KK+  ++  +
Sbjct  255  VLEEKRKALLALKAEERKVEVDKELQAMQQLSVKKANEEVFIKLGSDKDLKKKEKDEKDE  314

Query  423  tK----NINEFLKPAEGENyy--------rsggrgrgrgrgrggyggSLSSVDAPSIEDV  280
                  +INEFLKPAEGE YY          G   RG   G     G      AP IED 
Sbjct  315  RTKKSLSINEFLKPAEGERYYNPGRGRGRGRGRGDRGGFYGGYNGNGGRRQAAAPVIEDQ  374

Query  279  GQFPTLGKK  253
             QFP+LG K
Sbjct  375  AQFPSLGGK  383



>ref|XP_003556572.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Glycine max]
Length=332

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 119/173 (69%), Gaps = 9/173 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGD-ATKDSPPNeteekepeekemtleeyeKVLEEKRKALLA  571
            +NE  K    EK + ++D      K++P NE EEKEPE+KEMTLEEYEKVLEE+RKAL A
Sbjct  161  VNETSKNFGDEKPSGEDDVAAIGNKENPANEAEEKEPEDKEMTLEEYEKVLEERRKALQA  220

Query  570  SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFL  400
             K EERKV   K F SMQ LSNKK+ +++FIKLGS+K+K++E     +K KK+ NINEFL
Sbjct  221  LKTEERKVDT-KVFESMQQLSNKKDIDDIFIKLGSDKDKRRETLEKEDKSKKSVNINEFL  279

Query  399  KPAEGENyyr----sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            K  EGE+YY         GRGRG   G  G + +++ APSIED GQFPTLG K
Sbjct  280  KSPEGESYYNPGGHGRRHGRGRGARGGYGGYATANIPAPSIEDPGQFPTLGVK  332



>ref|NP_001043502.1| Os01g0603000 [Oryza sativa Japonica Group]
 dbj|BAD52651.1| putative nuclear RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAD53119.1| putative nuclear RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAF05416.1| Os01g0603000 [Oryza sativa Japonica Group]
 gb|EAZ12602.1| hypothetical protein OsJ_02509 [Oryza sativa Japonica Group]
Length=378

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 83/128 (65%), Gaps = 9/128 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkk---eagek  433
            VLEEKRKALL+ K EERKV +DKE  SMQ LS KK+ +EVFIKLGS+K+KKK   E  E+
Sbjct  250  VLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKENVERDER  309

Query  432  vkktKNINEFLKPAEGENyyr------sggrgrgrgrgrggyggSLSSVDAPSIEDVGQF  271
             +K+ +INEFLKPAEGE YY         GRGRG   G      S   V AP IED  QF
Sbjct  310  TRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAAPRIEDQAQF  369

Query  270  PTLGKK*V  247
            P L  + V
Sbjct  370  PGLAGRLV  377



>ref|XP_003567795.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brachypodium distachyon]
Length=381

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 78/132 (59%), Gaps = 15/132 (11%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS----ekekkkeage  436
            VLEEKRKALLA K EERKV +DKE  SMQ LS KK  +EVFIKLGS    +K++  E  E
Sbjct  250  VLEEKRKALLALKAEERKVEVDKELQSMQQLSVKKVADEVFIKLGSDKELKKKENAEREE  309

Query  435  kvkktKNINEFLKPAEGENy-----------yrsggrgrgrgrgrggyggSLSSVDAPSI  289
            + KK+ +INEFLKPAEGE Y              G    G   G    GG      AP+I
Sbjct  310  RAKKSLSINEFLKPAEGERYNPGGRGRGRGFRGRGELRGGYNGGGYNGGGGRRQAPAPAI  369

Query  288  EDVGQFPTLGKK  253
            ED  QFPTLG K
Sbjct  370  EDQAQFPTLGGK  381



>ref|XP_009128949.1| PREDICTED: suppressor protein STM1-like [Brassica rapa]
Length=337

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 121/177 (68%), Gaps = 16/177 (9%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   EK+  ++DT DA KD+P +E +EKEPE+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  162  EVEKSPVAEKEGGEDDTTDAKKDAPADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKV  221

Query  561  EERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK---NINEFLKP  394
            EERKV   K F SMQ LS+KK N+EE+FIKLGS+K+K+K+A EK +K K   +INEFLKP
Sbjct  222  EERKVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKP  280

Query  393  AEGENyyrsggrgrgrgrgrggyggSL-----------SSVDAPSIEDVGQFPTLGK  256
            A+GE Y   GG     GRG+   GG                 AP+I D  QFP+LGK
Sbjct  281  ADGERYNPRGGYRGRGGRGQRDGGGRNGGRGQRDEKVNGGAPAPAIGDSAQFPSLGK  337



>gb|ACL54182.1| unknown [Zea mays]
 gb|ACN34418.1| unknown [Zea mays]
Length=204

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 9/126 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            + EEKRKALLA K EERKV +DK+  S+Q LSNKK ++EVFIKLGS   +K++  E  E+
Sbjct  79   IREEKRKALLALKAEERKVEVDKDLQSLQPLSNKKENDEVFIKLGSDKDKKKENAERDER  138

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS------SVDAPSIEDVGQF  271
             KK+ +INEFLKPAEGE YY   GRGRGRG   G  GG         +  APSIED  QF
Sbjct  139  AKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYSRGPAAAAPSIEDQAQF  198

Query  270  PTLGKK  253
            P+LG K
Sbjct  199  PSLGGK  204



>gb|EAY74854.1| hypothetical protein OsI_02745 [Oryza sativa Indica Group]
Length=380

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 83/130 (64%), Gaps = 11/130 (8%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkk---eagek  433
            VLEEKRKALL+ K EERKV +DKE  SMQ LS KK+ +EVFIKLGS+K+KKK   E  E+
Sbjct  250  VLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKENVERDER  309

Query  432  vkktKNINEFLKPAEGENyyr--------sggrgrgrgrgrggyggSLSSVDAPSIEDVG  277
             +K+ +INEFLKPAEGE YY           GRGRG   G      S   V AP IED  
Sbjct  310  TRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGRGDRGGFRDGYSSRGPVAAPRIEDQA  369

Query  276  QFPTLGKK*V  247
            QFP L  + V
Sbjct  370  QFPGLAGRLV  379



>gb|KDO57093.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=335

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E E T + EK + +E+  DA K++P +E EEKEPEEKEMTLEEYEKVLEEKRKALLA 
Sbjct  195  VAETENT-NAEKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLAL  253

Query  567  K-PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFL  400
            K  EERKV +D+EF SMQ LSNKK++++VFIK+GS   +++   +  EK KK+ +INEFL
Sbjct  254  KTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFL  313

Query  399  KPAEGE  382
            KPAEGE
Sbjct  314  KPAEGE  319



>gb|EAY75654.1| hypothetical protein OsI_03559 [Oryza sativa Indica Group]
Length=332

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 84/125 (67%), Gaps = 8/125 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            + EEKRKALLA K EERKV +DK+  SMQ LS KK ++E+FIKLGS   +K++  E  E+
Sbjct  205  LREEKRKALLAFKAEERKVEVDKDLQSMQPLSTKKGNDEIFIKLGSDKDKKKENAERDER  264

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS-----SVDAPSIEDVGQFP  268
             KK+ +INEFLKPAEGE YY   GRGRGRG   G   G        S  APSIED  QFP
Sbjct  265  AKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFP  324

Query  267  TLGKK  253
            TLG K
Sbjct  325  TLGGK  329



>ref|XP_002440366.1| hypothetical protein SORBIDRAFT_09g030400 [Sorghum bicolor]
 gb|EES18796.1| hypothetical protein SORBIDRAFT_09g030400 [Sorghum bicolor]
Length=378

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 85/126 (67%), Gaps = 12/126 (10%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS----ekekkkeage  436
            VLEEKRKALLA K EERKV +DKE  SMQ LS KK+ +EVFIKLGS    +K++  E  E
Sbjct  252  VLEEKRKALLALKAEERKVEIDKELQSMQQLSVKKDADEVFIKLGSDKDLKKKENAEREE  311

Query  435  kvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD--------APSIEDV  280
            + KK+ +INEFLKPAEGE YY    RGRGRGRGRG  GG     +        AP+IED 
Sbjct  312  RAKKSLSINEFLKPAEGERYYNPSSRGRGRGRGRGERGGFRGGYNGSYRGPAAAPAIEDQ  371

Query  279  GQFPTL  262
             QFP L
Sbjct  372  AQFPAL  377



>gb|EAZ13376.1| hypothetical protein OsJ_03294 [Oryza sativa Japonica Group]
Length=332

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 84/125 (67%), Gaps = 8/125 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            + EEKRKALLA K EERKV +DK+  SMQ LS KK ++E+FIKLGS   +K++  E  E+
Sbjct  205  LREEKRKALLAFKAEERKVEVDKDLQSMQPLSTKKGNDEIFIKLGSDKDKKKENAERDER  264

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS-----SVDAPSIEDVGQFP  268
             KK+ +INEFLKPAEGE YY   GRGRGRG   G   G        S  APSIED  QFP
Sbjct  265  AKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFP  324

Query  267  TLGKK  253
            TLG K
Sbjct  325  TLGGK  329



>gb|KHN11561.1| hypothetical protein glysoja_006014 [Glycine soja]
Length=170

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEE+RKA  A K EERKV   KEF SMQ LS+KK++ ++FIKLGS   ++++  E  EK
Sbjct  49   VLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGSDKDKRKEAFEKEEK  107

Query  432  vkktKNINEFLKPAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTL  262
             KK+ +I EFLKPAEGE   N  R  GRGRG   G G +G + ++  APSIED G FPTL
Sbjct  108  SKKSVSITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGYHGSATNNAPAPSIEDPGHFPTL  167

Query  261  GKK  253
              K
Sbjct  168  SAK  170



>gb|ADE76006.1| unknown [Picea sitchensis]
Length=135

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 80/128 (63%), Gaps = 12/128 (9%)
 Frame = -2

Query  603  VLEEKRKALLA-SKPEERKVCLDKEFASMQLLSNKKNDEE-VFIKLG----Sekekkkea  442
            V EEKRKALLA  K EERKV + KEF SMQ+LSNKK DE+ +FIKLG      K+     
Sbjct  9    VREEKRKALLALKKVEERKVDV-KEFESMQVLSNKKKDEDAMFIKLGPEKEKIKKIDAAE  67

Query  441  gekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSV-----DAPSIEDVG  277
             E+V+K  +INEFLKPAEGE YY  G         RGG+ G  S       +APSIED  
Sbjct  68   NERVRKAVSINEFLKPAEGERYYSGGRVRGRGCGERGGFRGGYSGAYSNYPEAPSIEDPR  127

Query  276  QFPTLGKK  253
            QFPTLG K
Sbjct  128  QFPTLGGK  135



>ref|XP_006837401.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda]
 gb|ERN00255.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda]
Length=362

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 112/173 (65%), Gaps = 8/173 (5%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E  K    EK + +E+     KD+  NE E+KEPE KEMTL EYEKVLEEKRKAL A 
Sbjct  190  VGENGKVTSPEKPSEEENNAAVNKDNAVNEPEQKEPENKEMTLSEYEKVLEEKRKALQAL  249

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK-----NINEF  403
            K EERKV LDK+F SM  LS+KK +++VFIKLGSEK+  +      K+ +     +INEF
Sbjct  250  KNEERKVNLDKDFESMLQLSDKKANDDVFIKLGSEKDAARRKEIAEKEERIKKSVSINEF  309

Query  402  LKPAEGENyyrsggrgrgrgrgrgg---yggSLSSVDAPSIEDVGQFPTLGKK  253
            LKP +G  YY   GRGRG+GRG  G      S +S+ APSIED  QFPTL  K
Sbjct  310  LKPVDGGRYYSPRGRGRGQGRGGFGGGISSNSTNSIAAPSIEDQNQFPTLAAK  362



>ref|XP_004961407.1| PREDICTED: RNA-binding protein FUS-like [Setaria italica]
Length=374

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 85/126 (67%), Gaps = 9/126 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            + EEKRKALLA K EERKV +DK+  SMQ LSNKK ++E+F+KLGS     +K++  E  
Sbjct  249  IREEKRKALLALKTEERKVEVDKDLQSMQPLSNKKENDEIFVKLGSDKDALKKKENAERD  308

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD----APSIEDVGQF  271
            E+ KK+ +INEFLKPAEGE +Y   GRGRGRG   G  GG          AP+I+D  QF
Sbjct  309  ERAKKSVSINEFLKPAEGERFYGGRGRGRGRGDRGGFRGGYGGGYRAPPAAPAIQDQSQF  368

Query  270  PTLGKK  253
            P+LG K
Sbjct  369  PSLGGK  374



>emb|CDY33522.1| BnaA06g35510D [Brassica napus]
Length=327

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 110/163 (67%), Gaps = 14/163 (9%)
 Frame = -2

Query  705  SQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEERKVCLDKEFA  526
            +++DT DA KDSP  E EEKEPE+KEMTLEEYEK+LEEK+KAL A+K EERKV   K F 
Sbjct  166  AEDDTTDAKKDSPAAEQEEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFE  224

Query  525  SMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK---NINEFLKPAEGENy------  376
            SMQ LSNKK NDEE+FIKLGS+K+K+K+A EK +KTK   +INEFLKPA+GE Y      
Sbjct  225  SMQQLSNKKTNDEEIFIKLGSDKDKRKDAAEKEEKTKKSLSINEFLKPADGERYNNPRGG  284

Query  375  ---yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGK  256
                   G  R     R G         AP+I D  QFP+LGK
Sbjct  285  YRGRGGRGGRRDGRGQRDGGNQRHGGAPAPAIGDSAQFPSLGK  327



>gb|ABR25759.1| nuclear antigen [Oryza sativa Indica Group]
Length=243

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 3/78 (4%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkk---eagek  433
            VLEEKRKALL+ K EERKV +DKE  SMQ LS KK+ +EVFIKLGS+K+KKK   E  E+
Sbjct  138  VLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKENVERDER  197

Query  432  vkktKNINEFLKPAEGEN  379
             +K+ +INEFLKPAEGE 
Sbjct  198  TRKSLSINEFLKPAEGER  215



>ref|NP_001044098.1| Os01g0721900 [Oryza sativa Japonica Group]
 dbj|BAB84432.1| putative nuclear RNA binding protein A [Oryza sativa Japonica 
Group]
 dbj|BAF06012.1| Os01g0721900 [Oryza sativa Japonica Group]
Length=380

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 84/125 (67%), Gaps = 8/125 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            + EEKRKALLA K EERKV +DK+  SMQ LS KK ++E+FIKLGS   +K++  E  E+
Sbjct  253  LREEKRKALLAFKAEERKVEVDKDLQSMQPLSTKKGNDEIFIKLGSDKDKKKENAERDER  312

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS-----SVDAPSIEDVGQFP  268
             KK+ +INEFLKPAEGE YY   GRGRGRG   G   G        S  APSIED  QFP
Sbjct  313  AKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFP  372

Query  267  TLGKK  253
            TLG K
Sbjct  373  TLGGK  377



>gb|KJB22277.1| hypothetical protein B456_004G038700 [Gossypium raimondii]
Length=366

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 112/179 (63%), Gaps = 15/179 (8%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             NE  + +  EK     D GDA K+S  NE EEKEPEEK MTLEEYEK++EEKRKAL A 
Sbjct  189  ANEGNQNLGDEKLARDGDGGDADKESLTNELEEKEPEEKVMTLEEYEKLMEEKRKALQAL  248

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLK  397
            K E RKV   KEF SMQ LSNKK+++E+FIKLGS   ++++  E  E+ KK+ +INEFLK
Sbjct  249  KTEGRKVDA-KEFESMQQLSNKKSNDEIFIKLGSDKDKRKEAYEKEERAKKSLSINEFLK  307

Query  396  PAE----------GENyyrsggrgrgrgrgrggyggSLSSV-DAPSIEDVGQFPTLGKK  253
            PAE          G    +   +GRG      G G + SS+  APSIED   FPTLG K
Sbjct  308  PAERKRYYNPSGRGRGRVQGQDQGRGHSSRGFGGGNARSSMAAAPSIEDRSHFPTLGGK  366



>ref|XP_004961035.1| PREDICTED: insulin receptor substrate 4-like [Setaria italica]
Length=373

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 85/127 (67%), Gaps = 13/127 (10%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS----ekekkkeage  436
            VLEEKRKALLA K EERKV +DKE  SMQ LS KK+ +EVFIKLGS    +K++  E  E
Sbjct  246  VLEEKRKALLALKAEERKVEIDKELQSMQQLSIKKDADEVFIKLGSDKDLKKKENAERDE  305

Query  435  kvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS---------SVDAPSIED  283
            + KK+ +INEFLKPAEGE YY   GRGRGR RGRG  GG            +  AP+IED
Sbjct  306  RAKKSLSINEFLKPAEGERYYNPSGRGRGRSRGRGERGGFYGGYNGGYRGPAAAAPAIED  365

Query  282  VGQFPTL  262
              QFP L
Sbjct  366  QAQFPAL  372



>ref|XP_011101848.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Sesamum indicum]
Length=369

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 77/118 (65%), Gaps = 7/118 (6%)
 Frame = -2

Query  588  RKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktK  418
            RKAL A K EERKV + KEF +MQ L+NKK +++VFIKLGS   +K++  E  E+ KK+ 
Sbjct  253  RKALQALKTEERKVDV-KEFETMQQLANKKANDDVFIKLGSDKDKKKELAEKEERAKKSV  311

Query  417  NINEFLKPAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            +INEFLKPAEGE   N    G       RG    G  + + +AP+IED GQFPTLG K
Sbjct  312  SINEFLKPAEGEAYYNRGGRGRGRGRGSRGGYTGGSKMGNAEAPAIEDPGQFPTLGGK  369



>ref|XP_009416461.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=389

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 79/130 (61%), Gaps = 13/130 (10%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            + EEKRKALLA K EERKV +DKE  SMQ LS KK ++ +F+KLGS     +K++  +  
Sbjct  260  IREEKRKALLAMKAEERKVEIDKELQSMQQLSTKKENDPIFVKLGSDKDFGKKKENADRD  319

Query  438  ekvkktKNINEFLKPAEG--------ENyyrsggrgrgrgrgrggyggSLSSVDAPSIED  283
            E+ KK+ +INEFLKPAEG            R  G         GG G S ++  APSIED
Sbjct  320  ERSKKSLSINEFLKPAEGGRYYSPGGRGRGRGRGDRGPLRGSYGGGGSSFAAAAAPSIED  379

Query  282  VGQFPTLGKK  253
             GQFPTLG K
Sbjct  380  PGQFPTLGGK  389



>ref|XP_008459800.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=364

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = -2

Query  588  RKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekk---keagekvkktK  418
            RK+LLA K EERKV   KEFAS+Q LS+KK +++VFIKLGS+K+K+    +  E+ KK+ 
Sbjct  247  RKSLLALKTEERKVDP-KEFASLQQLSSKKENQDVFIKLGSDKDKRKEIADKEERTKKSV  305

Query  417  NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSS----VDAPSIEDVGQFPTLGKK  253
            +INEFLKPA+GE +Y  GGRGRGRGRG  G G   SS    V APSIED GQFPTLG K
Sbjct  306  SINEFLKPADGERHYTPGGRGRGRGRGSRGGGYVSSSMSSNVAAPSIEDPGQFPTLGAK  364



>ref|XP_006280739.1| hypothetical protein CARUB_v10026708mg [Capsella rubella]
 gb|EOA13637.1| hypothetical protein CARUB_v10026708mg [Capsella rubella]
Length=346

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 117/167 (70%), Gaps = 7/167 (4%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   EKQ  +++T DA+K++   E  +KE E+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  182  EVEKSPAAEKQGGEDET-DASKEAAAAEQAQKEAEDKEMTLEEYEKILEEKKKALQATKV  240

Query  561  EERKVCLDKEFASMQLLSNKKN-DEEVFIKLGSekekkkeagekvkktKNINEFLKPAEG  385
            EERKV   K F SMQ LSNKKN +EE+F+KLGSEK+K+K+A EK KK+ +INEFLKPA+G
Sbjct  241  EERKVDT-KVFESMQQLSNKKNTEEEIFVKLGSEKDKRKDAAEKAKKSLSINEFLKPAKG  299

Query  384  ENy----yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGK  256
            E Y       G  GRG    RGG   S     AP I D  QFP+LGK
Sbjct  300  ETYNPRGGNRGRGGRGGREQRGGGNQSHREAAAPVIGDTAQFPSLGK  346



>ref|XP_002863351.1| hypothetical protein ARALYDRAFT_494257 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39610.1| hypothetical protein ARALYDRAFT_494257 [Arabidopsis lyrata subsp. 
lyrata]
Length=363

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 82/127 (65%), Gaps = 12/127 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKN-DEEVFIKLGSekekkkeagekvk  427
            +LEEK+KAL A+K EERKV   K F SMQ LSNKKN DEE+FIKLGSEK+K+K+A EK K
Sbjct  238  ILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGSEKDKRKDAAEKTK  296

Query  426  ktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS----------SVDAPSIEDVG  277
            K+ +INEFLKPA+GE Y   GG     G G  G                +  AP+I D  
Sbjct  297  KSLSINEFLKPADGERYNGRGGHRGRGGCGGRGGREHRGDGGNQRNVKPAAPAPAIGDTA  356

Query  276  QFPTLGK  256
            QFP+LGK
Sbjct  357  QFPSLGK  363



>ref|NP_001281195.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 gb|ACF84633.1| unknown [Zea mays]
 gb|ACR38621.1| unknown [Zea mays]
 tpg|DAA57852.1| TPA: hypothetical protein ZEAMMB73_322547 [Zea mays]
Length=378

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 9/126 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            + EEKRKALLA K EERKV +DK+  S+Q LSNKK ++EVFIKLGS   +K++  E  E+
Sbjct  253  IREEKRKALLALKAEERKVEVDKDLQSLQPLSNKKENDEVFIKLGSDKDKKKENAERDER  312

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS------SVDAPSIEDVGQF  271
             KK+ +INEFLKPAEGE YY   GRGRGRG   G  GG         +  APSIED  QF
Sbjct  313  AKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYSRGPAAAAPSIEDQAQF  372

Query  270  PTLGKK  253
            P+LG K
Sbjct  373  PSLGGK  378



>ref|XP_004969088.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Setaria italica]
Length=371

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 87/127 (69%), Gaps = 10/127 (8%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKALL  K E RKV +DKE  SMQ LS KK  +E+FIKLGS   +K++  E  E+
Sbjct  245  VLEEKRKALLGLKTEVRKVEVDKELQSMQQLSVKKGSDEIFIKLGSDKEKKKENAERDER  304

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD-------APSIEDVGQ  274
             KK+ +INEFLKPAEGE YY  GGRGRGRGRGRG  GG  S          AP+I+D  Q
Sbjct  305  AKKSVSINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRSGYSPREPGALAPAIQDQAQ  364

Query  273  FPTLGKK  253
            FP+LG K
Sbjct  365  FPSLGGK  371



>ref|XP_008675099.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Zea mays]
 gb|ACG33523.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 tpg|DAA57847.1| TPA: plasminogen activator inhibitor 1 RNA-binding protein [Zea 
mays]
Length=378

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 9/126 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            + EEKRKALLA K EERKV +DK+  S+Q LSNKK ++EVFIKLGS   +K++  E  E+
Sbjct  253  IREEKRKALLALKAEERKVEVDKDLRSLQPLSNKKENDEVFIKLGSDKDKKKENAERDER  312

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS------SVDAPSIEDVGQF  271
             KK+ +INEFLKPAEGE YY   GRGRGRG   G  GG         +  APSIED  QF
Sbjct  313  AKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYSRGPAAAAPSIEDQAQF  372

Query  270  PTLGKK  253
            P+LG K
Sbjct  373  PSLGGK  378



>emb|CDY28966.1| BnaA02g25100D [Brassica napus]
Length=340

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 120/176 (68%), Gaps = 16/176 (9%)
 Frame = -2

Query  738  VEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPE  559
            VEK+   EK+  +++T DA KD+P +E +EKEPE+KEMTLEEYEK+LEEK+KAL A+K E
Sbjct  166  VEKSPVAEKEGGEDNTTDAKKDAPADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVE  225

Query  558  ERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK---NINEFLKPA  391
            ERKV   K F SMQ LS+KK N+EE+FIKLGS+K+K+K+A EK +K K   +INEFLKPA
Sbjct  226  ERKVDT-KVFESMQQLSSKKTNNEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPA  284

Query  390  EGENyyrsggrgrgrgrgrggyggSL-----------SSVDAPSIEDVGQFPTLGK  256
            +GE Y   GG     GRG+   GG                 AP+I D  QFP+LGK
Sbjct  285  DGERYNPRGGYRGRGGRGQRDGGGRNGGRGQRDEKVNGGAPAPAIGDSAQFPSLGK  340



>dbj|BAE71280.1| putative nuclear antigen homolog [Trifolium pratense]
Length=371

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 113/169 (67%), Gaps = 7/169 (4%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            E EK +  EK   + D  +  KDS  NE EEKE E+KEMTLEEY+KVLEEKRKAL   K 
Sbjct  204  EGEKNIGDEKPAVENDAAEGNKDSAANEAEEKEAEDKEMTLEEYQKVLEEKRKALQVVKT  263

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLKPA  391
            EERKV   KEF +MQ LS KK++ E+F KLGS+K+K+KEA    EK KK+ +INEFLKPA
Sbjct  264  EERKVDT-KEFETMQALSCKKDNFEIFAKLGSDKDKRKEAFDKEEKAKKSVSINEFLKPA  322

Query  390  EGENyyrsggrgrgrgrgrggyggSLS---SVDAPSIEDVGQFPTLGKK  253
            EG+ Y+R  G      RG GG     +   +V APSIED G FPTLG K
Sbjct  323  EGDAYHRGRGGRGREARGGGGGYRGGNLNRNVRAPSIEDPGHFPTLGAK  371



>ref|NP_199532.1| Hyaluronan / mRNA binding family protein [Arabidopsis thaliana]
 dbj|BAA97154.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM98181.1| putative protein [Arabidopsis thaliana]
 gb|AAQ56814.1| At5g47210 [Arabidopsis thaliana]
 dbj|BAE98584.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95484.1| Hyaluronan / mRNA binding family protein [Arabidopsis thaliana]
Length=357

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKN-DEEVFIKLGSekekkkeagekvk  427
            +LEEK+KAL A+K EERKV   K F SMQ LSNKKN DEE+FIKLGS+KEK+K+A EK K
Sbjct  239  ILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGSDKEKRKDATEKAK  297

Query  426  ktKNINEFLKPAEGENy----yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLG  259
            K+ +INEFLKPA+G+ Y      S GRG   GRG GG         AP+I D  QFP+LG
Sbjct  298  KSLSINEFLKPADGKRYNGRGGGSRGRGGRGGRGEGGNQRYAKEAAAPAIGDTAQFPSLG  357



>ref|XP_010531668.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Tarenaya hassleriana]
Length=359

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 90/123 (73%), Gaps = 9/123 (7%)
 Frame = -2

Query  603  VLEEKRKAL--LASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---g  439
            +LEEKRKAL  LA+   ERKV L KEF SMQ LSNKK ++E+FIKLGS+K+K+K+A    
Sbjct  235  ILEEKRKALQSLATSDSERKVDL-KEFESMQQLSNKKANDEIFIKLGSDKDKRKDALDKE  293

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS---SVDAPSIEDVGQFP  268
            EK KK  +INEFLKPAEGE YY  GGRGRGRGRG G  GG      S  AP+IED  QFP
Sbjct  294  EKAKKAVSINEFLKPAEGEGYYPRGGRGRGRGRGGGSRGGGYGGYQSKAAPAIEDTAQFP  353

Query  267  TLG  259
            +LG
Sbjct  354  SLG  356



>dbj|BAE71204.1| putative nuclear antigen homolog [Trifolium pratense]
Length=371

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 113/169 (67%), Gaps = 7/169 (4%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            E EK +  EK   + D  +  KDS  NE EEKE E+KEMTLEEY+KVLEEKRKAL   K 
Sbjct  204  EGEKNIGDEKPAVENDAAEGNKDSAANEAEEKEAEDKEMTLEEYQKVLEEKRKALQVVKT  263

Query  561  EERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFLKPA  391
            EERKV   KEF +MQ LS KK++ E+F KLGS+K+K+KEA    EK KK+ +INEFLKPA
Sbjct  264  EERKVDT-KEFETMQALSCKKDNFEIFAKLGSDKDKRKEAFDKEEKAKKSVSINEFLKPA  322

Query  390  EGENyyrsggrgrgrgrgrggyggSLS---SVDAPSIEDVGQFPTLGKK  253
            EG+ YYR  G      RG GG     +   +V APSIED G FPTLG K
Sbjct  323  EGDAYYRGRGGRGREARGGGGGYRGGNLNRNVRAPSIEDPGHFPTLGAK  371



>ref|XP_010925494.1| PREDICTED: protein argonaute 2-like [Elaeis guineensis]
Length=378

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 81/121 (67%), Gaps = 14/121 (12%)
 Frame = -2

Query  582  ALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLG-----SekekkkeagekvkktK  418
            ALLA KPEERKV LDKEF SMQ LS KK D+ VF+KLG     S+K    + GE+ +K+ 
Sbjct  257  ALLALKPEERKVQLDKEFESMQQLSLKKGDD-VFVKLGTDKDSSKKRDNADRGERARKSF  315

Query  417  NINEFLKPAEGENyyrsggrgrgrgrgrgg--------yggSLSSVDAPSIEDVGQFPTL  262
            +INEFLKPAEGE YY   GRGRGRGRGRG           G   +  APSIED GQFPTL
Sbjct  316  SINEFLKPAEGERYYSPAGRGRGRGRGRGDRRTFGDGFGRGGTIAAAAPSIEDPGQFPTL  375

Query  261  G  259
            G
Sbjct  376  G  376



>gb|EMS68133.1| hypothetical protein TRIUR3_26332 [Triticum urartu]
Length=785

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 84/185 (45%), Positives = 114/185 (62%), Gaps = 16/185 (9%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNetee----kepeekemtleeyeKVLEEKRKA  580
            + + EK    EKQ + ED   A ++ P  +       ++ E+ EMTL+E+EKV+EEKRKA
Sbjct  196  LKQDEKAPAPEKQGAPEDAPQADENKPTKDGATVVEEEKEEDNEMTLDEFEKVMEEKRKA  255

Query  579  LLA-SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeagekvkktK  418
            L A  K EERKV +DK+  +MQLLS KK ++EVFIKLG+     +K++  E  E+ KK+ 
Sbjct  256  LAALKKSEERKVEIDKDLQAMQLLSTKKGNDEVFIKLGADKEALKKKENAEREERAKKSV  315

Query  417  NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD------APSIEDVGQFPTLGK  256
            +INEFLKPAEGE +Y   GRG      RGG+ G            AP+I+D  QFPTLG 
Sbjct  316  SINEFLKPAEGERFYGGRGRGGRGRGDRGGFRGGFGGGGYHGPPPAPAIQDQNQFPTLGG  375

Query  255  K*VMN  241
            K +M+
Sbjct  376  KFLMS  380



>gb|AAM63072.1| nuclear RNA binding protein A-like protein [Arabidopsis thaliana]
Length=357

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKN-DEEVFIKLGSekekkkeagekvk  427
            +LEEK+KAL A+K EERKV   K F SMQ LSNKKN DEE+FIKLGS+KEK+K+A EK K
Sbjct  239  ILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGSDKEKRKDATEKAK  297

Query  426  ktKNINEFLKPAEGENy----yrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLG  259
            K+ +INEFLKPA+G+ Y      S GRG   GRG GG         AP+I D  QFP+LG
Sbjct  298  KSLSINEFLKPADGKRYNGRGGGSRGRGGRGGRGEGGNQRYAKEAAAPAIGDTAQFPSLG  357



>ref|XP_009410905.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=387

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 83/127 (65%), Gaps = 12/127 (9%)
 Frame = -2

Query  597  EEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekk-----keagek  433
            EEKRKALLA K EERKV +D+E  SM+ LS KK +++VF+KLGS+K+        +  E+
Sbjct  261  EEKRKALLALKNEERKVEIDEELQSMKQLSVKKGNDDVFVKLGSDKDTGKKKENADRDER  320

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSS-------VDAPSIEDVGQ  274
             KK+  I EFLKPAEGE YY  GGRGRGRGRG  G  G             APSIED GQ
Sbjct  321  SKKSMRITEFLKPAEGERYYSPGGRGRGRGRGGRGQYGGGFGGGVSTFPAAAPSIEDPGQ  380

Query  273  FPTLGKK  253
            FPTLG K
Sbjct  381  FPTLGGK  387



>dbj|BAJ98247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 79/126 (63%), Gaps = 9/126 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekk---keagek  433
            VLEEKRKA+LA K EERKV +DKE  SMQ LS KK+ EEVFIKLGS+KEKK    E  E+
Sbjct  46   VLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGSDKEKKKDNAEREER  105

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVDAPS------IEDVGQF  271
             KK+ NINEFLKPAEGE Y    GRGRG        GG               IED  QF
Sbjct  106  AKKSLNINEFLKPAEGERYNGGRGRGRGFRGRGEPRGGYNGGGGGRRPAAAPAIEDQSQF  165

Query  270  PTLGKK  253
            PTLG K
Sbjct  166  PTLGGK  171



>gb|AAS75737.1| thermoinhibition-associated THB-4 protein [Tagetes minuta]
Length=115

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            VLEEKRKAL   K EERKV +DKE ASMQ LSNKK+++E+F KLG+   ++++  E  E+
Sbjct  25   VLEEKRKALETLKTEERKVEVDKELASMQQLSNKKSNDEIFAKLGTDKDKRKELAEKEER  84

Query  432  vkktKNINEFLKPAEGE  382
             KK+ +INEFLKPA GE
Sbjct  85   AKKSLSINEFLKPAAGE  101



>ref|XP_003568032.1| PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1 
[Brachypodium distachyon]
Length=376

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 87/128 (68%), Gaps = 11/128 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            VLEEKRKALLA K EERKV +DK+  +MQ LS KK ++EVFIKLGS     +K++  E  
Sbjct  249  VLEEKRKALLALKSEERKVEIDKDLQAMQQLSTKKGNDEVFIKLGSDKDALKKKENAERD  308

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD------APSIEDVG  277
            E+ KK+ +INEFLKPAEGE +Y   GRGRGRG  RGG+ G            AP+I+D  
Sbjct  309  ERAKKSVSINEFLKPAEGERFYGGRGRGRGRGGDRGGFRGGAGGGGYRGPPAAPAIQDQN  368

Query  276  QFPTLGKK  253
            QFPTLG K
Sbjct  369  QFPTLGGK  376



>ref|XP_010531670.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like [Tarenaya 
hassleriana]
Length=359

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 90/123 (73%), Gaps = 9/123 (7%)
 Frame = -2

Query  603  VLEEKRKAL--LASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---g  439
            +LEEKRKAL  LAS   ERKV L KEF SMQ LSNKK ++E+FIKLGS+K+K+K+A    
Sbjct  235  ILEEKRKALQSLASSDFERKVDL-KEFESMQQLSNKKANDEIFIKLGSDKDKRKDALDKE  293

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD---APSIEDVGQFP  268
            EK KK+ +INEFLKPAEGE YY  GGRGRGRGRG G  GG         AP+IED  QFP
Sbjct  294  EKAKKSVSINEFLKPAEGEGYYPRGGRGRGRGRGGGSRGGGYGGYQNKAAPAIEDTAQFP  353

Query  267  TLG  259
            +LG
Sbjct  354  SLG  356



>dbj|BAG90611.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 86/127 (68%), Gaps = 10/127 (8%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            + EEKRKALL+ K EERKV +DK+  SMQ LSNKK ++EVFIKLGS     +K++  E  
Sbjct  95   LREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKKKENAERD  154

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyg-----gSLSSVDAPSIEDVGQ  274
            E+ KK+ +INEFLKPAEGE YY   GRGRGRG   G  G        ++  AP I+D  Q
Sbjct  155  ERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQ  214

Query  273  FPTLGKK  253
            FPTLG+K
Sbjct  215  FPTLGRK  221



>ref|XP_009396539.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=385

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 81/128 (63%), Gaps = 11/128 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            V EEKRKALLA K EERKV +D+E  SM+ LS KK +++VF+KLGS     +K++  +  
Sbjct  258  VREEKRKALLAMKNEERKVEIDEELQSMKQLSVKKGNDDVFVKLGSDKDIGKKKENIDRD  317

Query  438  ekvkktKNINEFLKPAE------GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVG  277
            E+ KK+ +INEFLKP E      G    R  G     G G GG G + ++  APSIED G
Sbjct  318  ERSKKSMSINEFLKPTEGERNRGGRGRGRGRGGRGQFGSGFGGEGSTFAAAAAPSIEDPG  377

Query  276  QFPTLGKK  253
            QFPTLG K
Sbjct  378  QFPTLGGK  385



>gb|KFK31390.1| hypothetical protein AALP_AA6G105700 [Arabis alpina]
Length=353

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 108/176 (61%), Gaps = 18/176 (10%)
 Frame = -2

Query  747  INEVEKT-VDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLA  571
            + EVEK+ V  EKQ  +++T DA K++P      +E EEK+MTLEEYEK+ EEK+KA+  
Sbjct  184  MTEVEKSPVTAEKQEGEDETTDAKKETP-----AEEEEEKQMTLEEYEKIQEEKKKAMQG  238

Query  570  SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK-NINEFLKP  394
            +K EERKV   K F SMQ LSNKK++EE+FIKLGSEK K     E+  +   +INEFLKP
Sbjct  239  AKVEERKVDT-KVFESMQQLSNKKSNEEIFIKLGSEKRKDATEKEEKARKSLSINEFLKP  297

Query  393  AEGENyyrsggrgrgrgrgrggyggSLSSVD----------APSIEDVGQFPTLGK  256
            A+GE+Y   GG     G   G  G      +          AP+I D  QFPTLGK
Sbjct  298  ADGESYNPRGGYRGRGGGRGGRGGQRDGRGNGGGNQRFGGAAPAIGDNAQFPTLGK  353



>ref|NP_001056139.1| Os05g0533100 [Oryza sativa Japonica Group]
 dbj|BAF18053.1| Os05g0533100, partial [Oryza sativa Japonica Group]
Length=286

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 86/127 (68%), Gaps = 10/127 (8%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            + EEKRKALL+ K EERKV +DK+  SMQ LSNKK ++EVFIKLGS     +K++  E  
Sbjct  160  LREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKKKENAERD  219

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyg-----gSLSSVDAPSIEDVGQ  274
            E+ KK+ +INEFLKPAEGE YY   GRGRGRG   G  G        ++  AP I+D  Q
Sbjct  220  ERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQ  279

Query  273  FPTLGKK  253
            FPTLG+K
Sbjct  280  FPTLGRK  286



>dbj|BAJ96699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 80/126 (63%), Gaps = 9/126 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            VLEEKRKA+LA K EERKV +DKE  SMQ LS KK+ EEVFIKLGS+KEKKK+  E+ ++
Sbjct  244  VLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGSDKEKKKDNAEREER  303

Query  423  tK---NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVDAPS------IEDVGQF  271
             K   NINEFLKPAEGE Y    GRGRG        GG               IED  QF
Sbjct  304  AKKSLNINEFLKPAEGERYNGGRGRGRGFRGRGEPRGGYNGGGGGRRPAAAPAIEDQSQF  363

Query  270  PTLGKK  253
            PTLG K
Sbjct  364  PTLGGK  369



>ref|XP_010919740.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Elaeis guineensis]
Length=375

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 71/124 (57%), Gaps = 9/124 (7%)
 Frame = -2

Query  603  VLEEKRKALLA-SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk  427
            +LEEKRKAL A  + EERKV +DKEF  MQ LS KKND++VFIKLGSE++  +      +
Sbjct  250  LLEEKRKALQALQRTEERKVDVDKEFEFMQQLSAKKNDDDVFIKLGSERDSARRRDTADR  309

Query  426  ktKN-----INEFLKPAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQF  271
            +        IN FL+PAE E   N    G    GR  G G       +   PSIED G F
Sbjct  310  EDLTRRPAIINTFLRPAEEERQHNPGGRGRGRGGRDGGIGSGRTGAMNTTPPSIEDPGHF  369

Query  270  PTLG  259
            PTLG
Sbjct  370  PTLG  373



>gb|EMT08444.1| hypothetical protein F775_29168 [Aegilops tauschii]
Length=833

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 87/182 (48%), Positives = 112/182 (62%), Gaps = 18/182 (10%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDT-----GDATKDSPPNeteekepeekemtleeyeKVLEEKRK  583
            + + EK    EKQ + ED        ATKD      EE++ E+ EMTL+E+EKV+EEKRK
Sbjct  216  LKQDEKAPAPEKQGAPEDAPQADENKATKDGAA-VVEEEKEEDNEMTLDEFEKVMEEKRK  274

Query  582  ALLA-SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeagekvkkt  421
            AL A  K EERKV +DK+  +MQLLS KK ++EVFIKLG+     +K++  E  E+ KK+
Sbjct  275  ALAALKKSEERKVEIDKDLQAMQLLSTKKGNDEVFIKLGADKEALKKKENAEREERAKKS  334

Query  420  KNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD------APSIEDVGQFPTLG  259
             +INEFLKPAEGE +Y   GRG      RGG+ G            AP+I+D  QFPTLG
Sbjct  335  VSINEFLKPAEGERFYGGRGRGGRGRGDRGGFRGGFGGGGYHGPPPAPAIQDQNQFPTLG  394

Query  258  KK  253
             K
Sbjct  395  GK  396



>ref|XP_010919739.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Elaeis guineensis]
Length=376

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 71/124 (57%), Gaps = 9/124 (7%)
 Frame = -2

Query  603  VLEEKRKALLA-SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk  427
            +LEEKRKAL A  + EERKV +DKEF  MQ LS KKND++VFIKLGSE++  +      +
Sbjct  251  LLEEKRKALQALQRTEERKVDVDKEFEFMQQLSAKKNDDDVFIKLGSERDSARRRDTADR  310

Query  426  ktKN-----INEFLKPAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQF  271
            +        IN FL+PAE E   N    G    GR  G G       +   PSIED G F
Sbjct  311  EDLTRRPAIINTFLRPAEEERQHNPGGRGRGRGGRDGGIGSGRTGAMNTTPPSIEDPGHF  370

Query  270  PTLG  259
            PTLG
Sbjct  371  PTLG  374



>ref|XP_010481347.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
Length=349

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 116/172 (67%), Gaps = 11/172 (6%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
              EVEK+   EKQ  +++T DA K++   E  +KE E+KEMTLEEYEK+LEEK+KAL A+
Sbjct  181  TTEVEKSPVAEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEYEKILEEKKKALQAT  238

Query  567  KPEERKVCLDKEFASMQLLSNKKN-DEEVFIKLGSekekkkeagekvkktKNINEFLKPA  391
            K EERKV   K F SMQ LSNKK  +EE+F+KLGS+K+K+K+A EK KK+ +INEFLKPA
Sbjct  239  KVEERKVDT-KVFESMQQLSNKKTTEEEIFVKLGSDKDKRKDAAEKTKKSLSINEFLKPA  297

Query  390  EGENyyrsggrgrgrgrgrggyggSLSSVD-------APSIEDVGQFPTLGK  256
            +G      GGRG   GRG     G  +  +       AP+I D  QFP+LGK
Sbjct  298  DGARGGYRGGRGGRGGRGGRDQRGGGNGGENQRRGPSAPAIGDTAQFPSLGK  349



>gb|KDP28866.1| hypothetical protein JCGZ_14637 [Jatropha curcas]
Length=384

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 113/183 (62%), Gaps = 19/183 (10%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLA-  571
            INE EK +  EK   +++ GD  K+S  N+ EEK+P+EKEMTLEEYEK LEEKR+AL A 
Sbjct  203  INEGEKNLGDEKPVGEDEAGDGNKESSANDPEEKKPQEKEMTLEEYEKKLEEKRRALQAL  262

Query  570  SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFL  400
             K EERKV   KEF SM  LS+KK  ++VFIKLGS+K+K+KEA    EK KK+  INEFL
Sbjct  263  KKAEERKVDA-KEFESMLQLSSKKGTDDVFIKLGSDKDKRKEAFDKDEKAKKSVTINEFL  321

Query  399  KPAEGEN--------------yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTL  262
            KPAEGE                   G               ++S+V APSIED G+FPTL
Sbjct  322  KPAEGERYFNPGGRGRGRGRGSRGFGNTDAMSNVVAPSSTDAMSNVVAPSIEDRGEFPTL  381

Query  261  GKK  253
            G K
Sbjct  382  GGK  384



>ref|XP_010481348.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=349

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 116/172 (67%), Gaps = 11/172 (6%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
              EVEK+   EKQ  +++T DA K++   E  +KE E+KEMTLEEYEK+LEEK+KAL A+
Sbjct  181  TTEVEKSPVAEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEYEKILEEKKKALQAT  238

Query  567  KPEERKVCLDKEFASMQLLSNKKN-DEEVFIKLGSekekkkeagekvkktKNINEFLKPA  391
            K EERKV   K F SMQ LSNKK  +EE+F+KLGS+K+K+K+A EK KK+ +INEFLKPA
Sbjct  239  KVEERKVDT-KVFESMQQLSNKKTTEEEIFVKLGSDKDKRKDAAEKTKKSLSINEFLKPA  297

Query  390  EGENyyrsggrgrgrgrgrggyggSLSSVD-------APSIEDVGQFPTLGK  256
            +G      GGRG   GRG     G  +  +       AP+I D  QFP+LGK
Sbjct  298  DGARGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTAQFPSLGK  349



>emb|CAC85227.1| salt tolerance protein 1 [Beta vulgaris]
Length=356

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 116/165 (70%), Gaps = 4/165 (2%)
 Frame = -2

Query  735  EKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEE  556
            EK ++ E   + ED  D  K+  P+ETEEKEPEEKEMTLEEYEK+LEEKRKAL A K EE
Sbjct  192  EKKLNPENLPAVEDAADGIKEGQPDETEEKEPEEKEMTLEEYEKLLEEKRKALSALKAEE  251

Query  555  RKVCLDKEFASMQLLSNKKNDEE-VFIKLGS--ekekkkeagekvkktKNINEFLKPAE-  388
            RKV +DK+F SMQ L NKK DE+ VFIKLGS  +K+K+    EKVKK+ +INEFLKPAE 
Sbjct  252  RKVEVDKDFESMQQLINKKKDEDSVFIKLGSDKDKKKEAAEKEKVKKSVSINEFLKPAEG  311

Query  387  GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
                 R  GRGRG   G  G G  + S  AP+IED G+FPTLG K
Sbjct  312  DRYGGRGRGRGRGPRGGGYGGGNRMFSTSAPAIEDPGEFPTLGGK  356



>ref|XP_010441486.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=349

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 116/172 (67%), Gaps = 11/172 (6%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
              EVEK+   EKQ  +++T DA K++   E  +KE E+KEMTLEEYEK+LEEK+KAL A+
Sbjct  181  TTEVEKSPVAEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEYEKILEEKKKALQAT  238

Query  567  KPEERKVCLDKEFASMQLLSNKKN-DEEVFIKLGSekekkkeagekvkktKNINEFLKPA  391
            K EERKV   K F SMQ LSNKK  +EE+F+KLGS+K+K+K+A EK KK+ +INEFLKPA
Sbjct  239  KVEERKVDT-KVFESMQQLSNKKTTEEEIFVKLGSDKDKRKDAAEKTKKSLSINEFLKPA  297

Query  390  EGENyyrsggrgrgrgrgrggyggSLSSVD-------APSIEDVGQFPTLGK  256
            +G      GGRG   GRG     G  +  +       AP+I D  QFP+LGK
Sbjct  298  DGARGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTAQFPSLGK  349



>ref|XP_004969787.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
A-like [Setaria italica]
Length=375

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 78/124 (63%), Gaps = 7/124 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            + EEKRKALLA K EER+V +DK+  S+Q LSNKK ++EVFIKLGS   +K++  E  E+
Sbjct  252  IREEKRKALLALKAEERRVEVDKDLQSLQPLSNKKENDEVFIKLGSDKDKKKESAERDER  311

Query  432  vkktKNINEFLKPA----EGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPT  265
             KK+ +INEFLKPA          R  GRG   GRG    G       AP+IED  QFP+
Sbjct  312  AKKSVSINEFLKPAEGERYYGGRGRGRGRGERGGRGGYFGGYHRGPAAAPAIEDQAQFPS  371

Query  264  LGKK  253
            LG K
Sbjct  372  LGGK  375



>ref|XP_010692032.1| PREDICTED: uncharacterized protein DDB_G0288133-like [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 116/165 (70%), Gaps = 4/165 (2%)
 Frame = -2

Query  735  EKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPEE  556
            EK ++ E   + ED  D  K+  P+ETEEKEPEEKEMTLEEYEK+LEEKRKAL A K EE
Sbjct  192  EKKLNPENLPAVEDAADGIKEGQPDETEEKEPEEKEMTLEEYEKLLEEKRKALSALKAEE  251

Query  555  RKVCLDKEFASMQLLSNKKNDEE-VFIKLGS--ekekkkeagekvkktKNINEFLKPAE-  388
            RKV +DK+F SMQ L NKK DE+ VFIKLGS  +K+K+    EKVKK+ +INEFLKPAE 
Sbjct  252  RKVEVDKDFESMQQLINKKKDEDSVFIKLGSDKDKKKEAAEKEKVKKSVSINEFLKPAEG  311

Query  387  GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
                 R  GRGRG   G  G G  + S  AP+IED G+FPTLG K
Sbjct  312  DRYGGRGRGRGRGPRGGGYGGGNRMFSTAAPAIEDPGEFPTLGGK  356



>ref|XP_010494951.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=349

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 115/170 (68%), Gaps = 11/170 (6%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   EKQ  +++T DA K++   E  +KE E+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  183  EVEKSPVAEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEYEKILEEKKKALQATKV  240

Query  561  EERKVCLDKEFASMQLLSNKKN-DEEVFIKLGSekekkkeagekvkktKNINEFLKPAEG  385
            EERKV   K F SMQ LSNKK  +EE+F+KLGS+K+K+K+  EK KK+ +INEFLKPA+G
Sbjct  241  EERKVDT-KVFDSMQQLSNKKTTEEEIFVKLGSDKDKRKDTAEKTKKSLSINEFLKPADG  299

Query  384  ENyyrsggrgrgrgrgrggyggSLSSVD-------APSIEDVGQFPTLGK  256
                  GGRG   GRG     G  +  +       AP+I D  QFP+LGK
Sbjct  300  ARGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTAQFPSLGK  349



>emb|CDY43435.1| BnaAnng07070D [Brassica napus]
Length=339

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 114/177 (64%), Gaps = 20/177 (11%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   EK+  ++ T DA K++P     E+EPE+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  166  EVEKSPVAEKEGGEDATTDAKKEAP---EVEQEPEDKEMTLEEYEKILEEKKKALQATKV  222

Query  561  EERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK---NINEFLKP  394
            EERKV   K F SMQ LSNKK NDEE+FIKLGS+K+K+K+A EK +K K   +INEFLKP
Sbjct  223  EERKVDT-KVFESMQQLSNKKTNDEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKP  281

Query  393  AEGENyyrsggrgrgrg------------rgrggyggSLSSVDAPSIEDVGQFPTLG  259
            A GE Y   GG     G             G G      +S  AP+I D  QFP+LG
Sbjct  282  ANGETYNPRGGYRGRGGRSGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQFPSLG  338



>ref|XP_004492923.1| PREDICTED: intracellular hyaluronan-binding protein 4-like [Cicer 
arietinum]
Length=373

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 119/171 (70%), Gaps = 7/171 (4%)
 Frame = -2

Query  747  INEVEK-TVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLA  571
            +NE EK +   EK   + +  +  KD+P NETEEKE E+KEMTLEEYEK+LEEKRK L A
Sbjct  204  VNEAEKKSSGDEKPAVENEVAEGNKDNPANETEEKEAEDKEMTLEEYEKLLEEKRKVLQA  263

Query  570  SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---gekvkktKNINEFL  400
             K E RKV   KEF SMQ LS KK++ E+F KLGS+K+K+KEA    EK KK+ +INEFL
Sbjct  264  LKTEARKVDT-KEFESMQALSCKKDNTEIFAKLGSDKDKRKEALDKEEKAKKSVSINEFL  322

Query  399  KPAEGENyy--rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            KPAEGE YY     GRGRGR    G  G S S++ APSIED G FPTLG K
Sbjct  323  KPAEGEAYYNPGGHGRGRGRATRGGIRGNSFSNIPAPSIEDPGHFPTLGAK  373



>emb|CDY65881.1| BnaAnng21260D [Brassica napus]
Length=333

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 80/123 (65%), Gaps = 8/123 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvk  427
            VLEEKRKAL A+K EERKV   K F +MQ LS+KK N++EVFIKLG++K+K+    E+  
Sbjct  212  VLEEKRKALQATKIEERKVDT-KAFETMQQLSSKKSNNDEVFIKLGTDKDKRPVEKEEKT  270

Query  426  ktK-NINEFLKPAEGENyyrsggrgrgrgrgrggyggSL-----SSVDAPSIEDVGQFPT  265
            K   +INEFLKPA GE Y  +   GRGRG   GG G        ++  AP IED   FPT
Sbjct  271  KKSLSINEFLKPANGERYRGADEGGRGRGAEGGGRGPKGGADRKAAAPAPKIEDAAHFPT  330

Query  264  LGK  256
            LGK
Sbjct  331  LGK  333



>ref|XP_001760974.1| predicted protein [Physcomitrella patens]
 gb|EDQ74363.1| predicted protein [Physcomitrella patens]
Length=343

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 76/146 (52%), Gaps = 29/146 (20%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            V+EEKRK L ASK  ERKV +DK F  MQL+SNKK +E++FIKLG EKEK K    + ++
Sbjct  198  VMEEKRKTLEASKASERKVEVDKAFEKMQLVSNKKREEDIFIKLGQEKEKSKREAAEREE  257

Query  423  tK----NINEFLKPAEGE-------------------------Nyyrsggrgrgrgrgrg  331
                  +IN+FLKPAEGE                             S       GRG G
Sbjct  258  KSRKPVSINQFLKPAEGEKSYFPSNRGRGGRGGRDDRRESGGRGNRESTRSNFSAGRGGG  317

Query  330  gyggSLSSVDAPSIEDVGQFPTLGKK  253
            G G +     AP IED  QFPTLG K
Sbjct  318  GRGSAAGDASAPKIEDQAQFPTLGAK  343



>gb|EEE64473.1| hypothetical protein OsJ_19323 [Oryza sativa Japonica Group]
Length=392

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 86/127 (68%), Gaps = 10/127 (8%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            + EEKRKALL+ K EERKV +DK+  SMQ LSNKK ++EVFIKLGS     +K++  E  
Sbjct  266  LREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKKKENAERD  325

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyg-----gSLSSVDAPSIEDVGQ  274
            E+ KK+ +INEFLKPAEGE YY   GRGRGRG   G  G        ++  AP I+D  Q
Sbjct  326  ERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQ  385

Query  273  FPTLGKK  253
            FPTLG+K
Sbjct  386  FPTLGRK  392



>gb|EEC79581.1| hypothetical protein OsI_20751 [Oryza sativa Indica Group]
Length=381

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 86/127 (68%), Gaps = 10/127 (8%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            + EEKRKALL+ K EERKV +DK+  SMQ LSNKK ++EVFIKLGS     +K++  E  
Sbjct  255  LREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKKKENAERD  314

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyg-----gSLSSVDAPSIEDVGQ  274
            E+ KK+ +INEFLKPAEGE YY   GRGRGRG   G  G        ++  AP I+D  Q
Sbjct  315  ERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQ  374

Query  273  FPTLGKK  253
            FPTLG+K
Sbjct  375  FPTLGRK  381



>ref|XP_009114287.1| PREDICTED: uncharacterized protein LOC103839539 [Brassica rapa]
Length=343

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 114/177 (64%), Gaps = 20/177 (11%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   EK+  ++ T DA K++P     E+EPE+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  170  EVEKSPVAEKEGGEDATTDAKKEAP---EVEQEPEDKEMTLEEYEKILEEKKKALQATKV  226

Query  561  EERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK---NINEFLKP  394
            EERKV   K F SMQ LSNKK NDEE+FIKLGS+K+K+K+A EK +K K   +IN+FLKP
Sbjct  227  EERKVDT-KAFESMQQLSNKKTNDEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINQFLKP  285

Query  393  AEGENyyrsggrgrgrg------------rgrggyggSLSSVDAPSIEDVGQFPTLG  259
            A GE Y   GG     G             G G      +S  AP+I D  QFP+LG
Sbjct  286  ANGETYNPRGGYRGRGGRSGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQFPSLG  342



>ref|XP_003569708.1| PREDICTED: RNA-binding protein FUS-like [Brachypodium distachyon]
Length=377

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 84/126 (67%), Gaps = 9/126 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagek  433
            + EEKRKALLA K EERKV LDK+  S+Q LS KK ++E+FIKLGS   +K++  E  E+
Sbjct  252  IREEKRKALLALKTEERKVELDKDLQSLQPLSTKKANDEIFIKLGSDKDKKKESAERDER  311

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD------APSIEDVGQF  271
             KK+ +INEFLKPAEGE YY   GRGRG    RGG+ G            APSI+D  +F
Sbjct  312  AKKSVSINEFLKPAEGERYYGGRGRGRGGRGDRGGFRGGYGGGGYQRGPAAPSIQDQAEF  371

Query  270  PTLGKK  253
            PTLG K
Sbjct  372  PTLGGK  377



>ref|XP_010531669.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Tarenaya hassleriana]
Length=359

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 88/123 (72%), Gaps = 9/123 (7%)
 Frame = -2

Query  603  VLEEKRKAL--LASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea---g  439
            +LEEKRKAL  LAS   ERKV L KEF SMQ LSNKK ++E FIKLGS+K+K+K+A    
Sbjct  235  ILEEKRKALQSLASSDFERKVDL-KEFESMQQLSNKKANDEFFIKLGSDKDKRKDALDKE  293

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD---APSIEDVGQFP  268
            EK KK  +INEFLKPA+GE YY  GGRGRGRGRG G  GG         AP+IED  QFP
Sbjct  294  EKAKKAVSINEFLKPADGEGYYPRGGRGRGRGRGGGSRGGGYGGYQNKAAPAIEDTAQFP  353

Query  267  TLG  259
            +LG
Sbjct  354  SLG  356



>gb|AAT47083.1| unknown protein [Oryza sativa Japonica Group]
Length=390

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 86/127 (68%), Gaps = 10/127 (8%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            + EEKRKALL+ K EERKV +DK+  SMQ LSNKK ++EVFIKLGS     +K++  E  
Sbjct  264  LREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKKKENAERD  323

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyg-----gSLSSVDAPSIEDVGQ  274
            E+ KK+ +INEFLKPAEGE YY   GRGRGRG   G  G        ++  AP I+D  Q
Sbjct  324  ERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQ  383

Query  273  FPTLGKK  253
            FPTLG+K
Sbjct  384  FPTLGRK  390



>gb|KHG04303.1| hypothetical protein F383_01005 [Gossypium arboreum]
Length=364

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 112/177 (63%), Gaps = 13/177 (7%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             NE ++ +  EK     D GDA K+S  NE EEKEPEEK MTLEEYE+++EEKRKAL A 
Sbjct  189  ANEGKQNLGDEKLARDGDGGDADKESLTNELEEKEPEEKVMTLEEYEELMEEKRKALQAL  248

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS---ekekkkeagekvkktKNINEFLK  397
            K E RKV   KEF SMQ LSNKK+++E+FIKLGS   ++++  E  E+ KK+ +INEFLK
Sbjct  249  KTEGRKVDA-KEFESMQQLSNKKSNDEIFIKLGSDKDKRKEAYEKEERAKKSLSINEFLK  307

Query  396  PAE--------GENyyrsggrgrgrgrgrggyggSLSSV-DAPSIEDVGQFPTLGKK  253
            P E        G    R   +GRG      G G + SS+  APSIED   FPTLG K
Sbjct  308  PVERKRYYNQSGRGRGRGQDQGRGHSSRGFGGGNARSSMAAAPSIEDRSHFPTLGGK  364



>gb|ABD64914.1| nuclear RNA binding protein, putative [Brassica oleracea]
Length=336

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 114/172 (66%), Gaps = 16/172 (9%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   EK+  ++ T DA K++P     E+EPE+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  167  EVEKSPVAEKEGGEDATTDAKKEAP---EVEQEPEDKEMTLEEYEKILEEKKKALQATKV  223

Query  561  EERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK---NINEFLKP  394
            EERKV   K F SMQ LSNKK NDEE+FIKLGS+K+K+K+A EK +K K   +INEFLKP
Sbjct  224  EERKVDT-KVFESMQQLSNKKSNDEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKP  282

Query  393  AEGENyyrsggrgrgrgrgrggyg--------gSLSSVDAPSIEDVGQFPTL  262
            A GE Y   GG     GRG+               +S  AP+I D  QFP+L
Sbjct  283  ANGETYNPRGGYRGRGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQFPSL  334



>gb|EMT12851.1| hypothetical protein F775_28068 [Aegilops tauschii]
Length=288

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekk---keagek  433
            VLEEKRKA+LA K EERKV +DKE  SMQ LS KK+ EEVFIKLGS+KEKK    E  E+
Sbjct  162  VLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGSDKEKKKENTEREER  221

Query  432  vkktKNINEFLKPAE-------GENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQ  274
             KK+ +INEFLKPAE               GRG  RG   GG GG      AP+IED  Q
Sbjct  222  AKKSLSINEFLKPAEGERYSGGRGRGRGFRGRGEARGGYNGGGGGGRRPAAAPAIEDQSQ  281

Query  273  FPTLGKK  253
            FPTLG K
Sbjct  282  FPTLGGK  288



>ref|XP_001756282.1| predicted protein [Physcomitrella patens]
 gb|EDQ78678.1| predicted protein [Physcomitrella patens]
Length=393

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            VLEEKRKAL A+K  ERKV +DK F  MQL+ NKK +E+VFIKLG EKEK K    + ++
Sbjct  242  VLEEKRKALEATKASERKVEMDKAFEKMQLVENKKREEDVFIKLGQEKEKIKRDAAEREE  301

Query  423  tK----NINEFLKPAEGE  382
                  +INEFLKPAEGE
Sbjct  302  KSRKPVSINEFLKPAEGE  319



>gb|EYU40365.1| hypothetical protein MIMGU_mgv1a008102mg [Erythranthe guttata]
Length=385

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 95/127 (75%), Gaps = 11/127 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKP--EERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeage-  436
            VLEEKRK+LLA K   E RKV + KEF SMQ LS+KK +++++FIKLGSEK+KKKE  E 
Sbjct  259  VLEEKRKSLLALKADSEARKVDV-KEFESMQQLSSKKRSNDDIFIKLGSEKDKKKELAEK  317

Query  435  --kvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS----SVDAPSIEDVGQ  274
              + KK+ +INEFLKPAEGE +Y SGGRGRGRGRG  G GG       +V AP+IED GQ
Sbjct  318  EERAKKSVSINEFLKPAEGERHYSSGGRGRGRGRGSRGGGGYGVGGNENVRAPAIEDPGQ  377

Query  273  FPTLGKK  253
            FPTLG K
Sbjct  378  FPTLGGK  384



>ref|XP_010440090.1| PREDICTED: uncharacterized protein LOC104723416 [Camelina sativa]
Length=132

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 82/125 (66%), Gaps = 9/125 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            +LEEK+KAL +    ERKV   K F SMQ LSNKK ++E+FIKLGS+K+K+K+  E+  K
Sbjct  9    ILEEKKKALQSLTTSERKVD-TKVFESMQQLSNKKANDEIFIKLGSDKDKRKDDKEEKAK  67

Query  423  tK-NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD-------APSIEDVGQFP  268
               +INEFLKPAEGENYYR G  GRGRG    G GG  S          AP+I D  QFP
Sbjct  68   KAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGVSSEEHGGYRNEAAPAIGDTAQFP  127

Query  267  TLGKK  253
            +LG K
Sbjct  128  SLGGK  132



>gb|EPS72575.1| hypothetical protein M569_02184 [Genlisea aurea]
Length=362

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 75/118 (64%), Gaps = 5/118 (4%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekk---keagek  433
            VLEEKRK L + K EERKV   KEF +MQ LSNKK  + +FIKLGSEK++K    E  E+
Sbjct  247  VLEEKRKGLQSLKTEERKVDA-KEFEAMQQLSNKKTGDHIFIKLGSEKDRKKEVAEKEER  305

Query  432  vkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLG  259
             KK+ +INEFLK  EGE  Y +              GG++  V APSIED G+FP+LG
Sbjct  306  AKKSVSINEFLKAGEGEK-YYNNPSRGRGRGRGSRGGGNVGGVQAPSIEDPGEFPSLG  362



>emb|CDY67886.1| BnaCnng56800D [Brassica napus]
Length=361

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 114/172 (66%), Gaps = 16/172 (9%)
 Frame = -2

Query  741  EVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKP  562
            EVEK+   EK+  ++ T DA K++P     E+EPE+KEMTLEEYEK+LEEK+KAL A+K 
Sbjct  192  EVEKSPVAEKEGGEDATTDAKKEAP---EVEQEPEDKEMTLEEYEKILEEKKKALQATKV  248

Query  561  EERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK---NINEFLKP  394
            EERKV   K F SMQ LSNKK NDEE+FIKLGS+K+K+K+A EK +K K   +INEFLKP
Sbjct  249  EERKVDT-KVFESMQQLSNKKSNDEEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKP  307

Query  393  AEGENyyrsggrgrgrgrgrggyg--------gSLSSVDAPSIEDVGQFPTL  262
            A GE Y   GG     GRG+               +S  AP+I D  QFP+L
Sbjct  308  ANGETYNPRGGYRGRGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQFPSL  359



>ref|XP_010449710.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=263

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 80/125 (64%), Gaps = 9/125 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            +LEEK+KAL +    ERKV   K F SMQ LSNKK ++E+FIKLGS+K+K+K+  E+  K
Sbjct  140  ILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKANDEIFIKLGSDKDKRKDDKEEKAK  198

Query  423  tK-NINEFLKPAEGENyyrsggrgrgrgrg-------rggyggSLSSVDAPSIEDVGQFP  268
               +INEFLKPAEGENYYR G  GRGRG                  +  AP+IED  QFP
Sbjct  199  KAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGVSNEEHVGYRNEAAPAIEDTAQFP  258

Query  267  TLGKK  253
            +LG K
Sbjct  259  SLGGK  263



>gb|EMT09866.1| hypothetical protein F775_32096 [Aegilops tauschii]
Length=339

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 79/129 (61%), Gaps = 12/129 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            + EE+RKALLA K EERKV +DK+  S+Q LS KK ++EVFIKLGS+KEKKKE+ E+ ++
Sbjct  211  IREEQRKALLALKTEERKVEVDKDLQSLQPLSTKKANDEVFIKLGSDKEKKKESTERDER  270

Query  423  tK---NINEFLKPA---------EGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDV  280
             K   +INEFLKPA                 G   RG  RG  G G       APSIED 
Sbjct  271  AKKSLSINEFLKPAEGERYYGGRGRGRGRGEGRGDRGGFRGGFGGGYQHGQAAAPSIEDQ  330

Query  279  GQFPTLGKK  253
             QFPTLG K
Sbjct  331  SQFPTLGGK  339



>ref|XP_008798814.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Phoenix dactylifera]
Length=372

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 71/124 (57%), Gaps = 9/124 (7%)
 Frame = -2

Query  603  VLEEKRKALLA-SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk  427
            +LEEKRKAL A  K EERKV +DKEF  MQ LS KKN+++VFIKLGSE+E  +      +
Sbjct  247  LLEEKRKALQALQKIEERKVDVDKEFEFMQQLSAKKNNDDVFIKLGSERESARRRDAADR  306

Query  426  ktKN-----INEFLKPAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQF  271
            +        IN FL+PAE E   N    G    GRG   G       +   PSIED G F
Sbjct  307  EDSARRPAIINTFLRPAEEERHYNPGGRGRGRGGRGARGGFGRTGTMNTPPPSIEDPGHF  366

Query  270  PTLG  259
            PTLG
Sbjct  367  PTLG  370



>ref|XP_008798813.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Phoenix dactylifera]
Length=373

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 71/124 (57%), Gaps = 9/124 (7%)
 Frame = -2

Query  603  VLEEKRKALLA-SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvk  427
            +LEEKRKAL A  K EERKV +DKEF  MQ LS KKN+++VFIKLGSE+E  +      +
Sbjct  248  LLEEKRKALQALQKIEERKVDVDKEFEFMQQLSAKKNNDDVFIKLGSERESARRRDAADR  307

Query  426  ktKN-----INEFLKPAEGE---NyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQF  271
            +        IN FL+PAE E   N    G    GRG   G       +   PSIED G F
Sbjct  308  EDSARRPAIINTFLRPAEEERHYNPGGRGRGRGGRGARGGFGRTGTMNTPPPSIEDPGHF  367

Query  270  PTLG  259
            PTLG
Sbjct  368  PTLG  371



>ref|XP_009406178.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=384

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 75/122 (61%), Gaps = 12/122 (10%)
 Frame = -2

Query  582  ALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeage-----kvkktK  418
            ALLA K EERKV +DKE  SMQ LS KK ++ +F+KLGS+K+  K+        + KK+ 
Sbjct  263  ALLAMKSEERKVEIDKELQSMQQLSTKKENDPIFVKLGSDKDSGKKKENIDRDERSKKSL  322

Query  417  NINEFLKPAEG-----ENyyrsggrgrgrgrgrggyggSLSS--VDAPSIEDVGQFPTLG  259
            +INEFLKPAEG      +    G     RG  RG YG  +SS    APSIED GQFPTLG
Sbjct  323  SINEFLKPAEGGRYYGPSGRGRGRGRGDRGPFRGSYGSGVSSFMAAAPSIEDPGQFPTLG  382

Query  258  KK  253
             K
Sbjct  383  GK  384



>gb|EMS59053.1| hypothetical protein TRIUR3_33029 [Triticum urartu]
Length=296

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 79/129 (61%), Gaps = 12/129 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            + EE+RKALLA K EERKV +DK+  S+Q LS KK ++EVFIKLGS+KEKKKE+ E+ ++
Sbjct  168  IREEQRKALLALKTEERKVEVDKDLQSLQPLSTKKANDEVFIKLGSDKEKKKESTERDER  227

Query  423  tK---NINEFLKPA---------EGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDV  280
             K   +INEFLKPA                 G   RG  RG  G G       APSIED 
Sbjct  228  AKKSLSINEFLKPAEGERYYGGRGRGRGRGEGRGDRGGFRGGFGGGYQRGQAAAPSIEDR  287

Query  279  GQFPTLGKK  253
             QFPTLG K
Sbjct  288  SQFPTLGGK  296



>ref|XP_002440127.1| hypothetical protein SORBIDRAFT_09g026550 [Sorghum bicolor]
 gb|EES18557.1| hypothetical protein SORBIDRAFT_09g026550 [Sorghum bicolor]
Length=373

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 85/126 (67%), Gaps = 9/126 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkeag  439
            + EEKRK+LLA K EERKV +D++  SMQ L+NKK ++E+F+KLGS     +K++  +  
Sbjct  248  IREEKRKSLLALKTEERKVEVDRDLQSMQPLANKKGNDEIFVKLGSDKDALKKKENADRD  307

Query  438  ekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD----APSIEDVGQF  271
            E+ KK+ +INEFLKPAEGE YY   GRGRGRG   G  GG          AP+I+D  QF
Sbjct  308  ERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYHAPPAAPAIQDQSQF  367

Query  270  PTLGKK  253
            P+LG K
Sbjct  368  PSLGGK  373



>ref|XP_010449709.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
Length=352

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 80/125 (64%), Gaps = 9/125 (7%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            +LEEK+KAL +    ERKV   K F SMQ LSNKK ++E+FIKLGS+K+K+K+  E+  K
Sbjct  229  ILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKANDEIFIKLGSDKDKRKDDKEEKAK  287

Query  423  tK-NINEFLKPAEGENyyrsggrgrgrgrg-------rggyggSLSSVDAPSIEDVGQFP  268
               +INEFLKPAEGENYYR G  GRGRG                  +  AP+IED  QFP
Sbjct  288  KAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGVSNEEHVGYRNEAAPAIEDTAQFP  347

Query  267  TLGKK  253
            +LG K
Sbjct  348  SLGGK  352



>emb|CDM84169.1| unnamed protein product [Triticum aestivum]
Length=381

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 79/129 (61%), Gaps = 12/129 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            + EE+RKALLA K EERKV +DK+  S+Q LS KK ++EVFIKLGS+KEKKKE+ E+ ++
Sbjct  253  IREEQRKALLALKTEERKVEVDKDLQSLQPLSTKKANDEVFIKLGSDKEKKKESTERDER  312

Query  423  tK---NINEFLKPA---------EGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDV  280
             K   +INEFLKPA                 G   RG  RG  G G       APSIED 
Sbjct  313  AKKSLSINEFLKPAEGERYYGGRGRGRGRGEGRGDRGGFRGGFGGGYQRGQAAAPSIEDQ  372

Query  279  GQFPTLGKK  253
             QFPTLG K
Sbjct  373  SQFPTLGGK  381



>gb|KJB37649.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=307

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK V  EKQ+ +ED  DA K++  NE EEKEPE KEMTLEEYEK++EEKRKALLA 
Sbjct  191  VPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLAL  250

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS  466
            K EERKV   KEF SMQ LS+KK+++++FIKLGS
Sbjct  251  KTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGS  283



>gb|KJB24892.1| hypothetical protein B456_004G166300 [Gossypium raimondii]
Length=333

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
             NE E+ +  EK   +ED  +A K+S  NE EEKEPE+KEMTLEEYEKVLEEKRKAL A 
Sbjct  193  TNEGERNLGDEKPAGEEDAREANKESASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQAL  252

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS  466
            K EERKV   KEF SMQ LSNKKN++EVFIKLGS
Sbjct  253  KIEERKVDA-KEFESMQQLSNKKNNDEVFIKLGS  285



>ref|XP_009388577.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009388578.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=429

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 78/119 (66%), Gaps = 12/119 (10%)
 Frame = -2

Query  582  ALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkke----agekvkktKN  415
            ALLA KPE RKV +DK+F SMQ LS KK +++VF+KLGS+K+  +       E+ KK   
Sbjct  243  ALLAMKPEGRKVEIDKDFESMQQLSIKKGNDDVFVKLGSDKDTGRRKDNDHQEQGKKHVP  302

Query  414  INEFLKPAEGENyyrsggrgrgrgrgrggyggSLS--------SVDAPSIEDVGQFPTL  262
            I EFLKPAEGE YY  GGRG GRGRGRG  G   S        SV +PS+ED GQFP L
Sbjct  303  IPEFLKPAEGERYYSPGGRGFGRGRGRGDRGSIWSEFAGETVISVSSPSLEDPGQFPAL  361



>dbj|BAJ89734.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=375

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 83/129 (64%), Gaps = 12/129 (9%)
 Frame = -2

Query  603  VLEEKRKALLA-SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS-----ekekkkea  442
            V+EEKRKAL A  K EERKV +DK+  +MQLLS KK ++EVFIKLG+     +K++  E 
Sbjct  247  VMEEKRKALDALKKSEERKVEIDKDLQAMQLLSTKKGNDEVFIKLGADKEALKKKENAER  306

Query  441  gekvkktKNINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD------APSIEDV  280
             E+ KK+ +INEFLKPAEGE +Y   GRG      RGG+ G            AP+I+D 
Sbjct  307  EERAKKSVSINEFLKPAEGERFYGGRGRGGRGRGDRGGFRGGFGGGGYHNPPPAPAIQDQ  366

Query  279  GQFPTLGKK  253
             QFPTLG K
Sbjct  367  NQFPTLGGK  375



>ref|XP_010434762.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
 ref|XP_010434763.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=347

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 80/123 (65%), Gaps = 7/123 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            +LEEK+KAL +    ERKV   K F SMQ LSNKK ++E+FIKLGS+K+K+K+  E+  K
Sbjct  226  ILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKANDEIFIKLGSDKDKRKDDKEEKAK  284

Query  423  tK-NINEFLKPAEGENyyrsggrgrgrgrg-----rggyggSLSSVDAPSIEDVGQFPTL  262
               +INEFLKPAEGENYYR G  GRGRG            G   +  AP+I D  QFP+L
Sbjct  285  KAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRVSSEEHGGYRNEAAPAIGDTAQFPSL  344

Query  261  GKK  253
            G K
Sbjct  345  GGK  347



>ref|NP_001275394.1| nuclear RNA binding protein [Solanum tuberosum]
 emb|CAR64523.1| nuclear RNA binding protein [Solanum tuberosum]
Length=360

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 120/169 (71%), Gaps = 7/169 (4%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            +E EK ++ EK +++E+ GD  K++P  E E+KEPE+KEMTLEEYEK+LEEKRKAL A K
Sbjct  194  DEGEKNLNVEKPSTEEEAGDDKKENPAAEAEDKEPEDKEMTLEEYEKLLEEKRKALQALK  253

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK--NINEFLKPA  391
             EERKV   K F SMQ +S K +D E+F+KLGS+ ++K+ A ++ K  K  +INEFLKPA
Sbjct  254  TEERKVDT-KVFESMQQISKKPSD-EIFVKLGSKDKRKESAEKEEKAKKAVSINEFLKPA  311

Query  390  EGENyyr--sggrgrgrgrgrggyggSLSSVD-APSIEDVGQFPTLGKK  253
            EGE YY     GRGRGRG        ++S+V+ AP IED G FPTLG K
Sbjct  312  EGERYYAPGGRGRGRGRGSRGYSGANTMSNVEAAPPIEDPGHFPTLGGK  360



>ref|XP_010434652.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=389

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 88/121 (73%), Gaps = 3/121 (2%)
 Frame = -2

Query  738  VEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPE  559
            VEK V  EKQ  + +  DA K++P  E  EKEPE KEMTLEEYEKVLEEK+KAL A+K E
Sbjct  188  VEKNVTVEKQGGEGEATDANKETPAEEQPEKEPENKEMTLEEYEKVLEEKKKALQATKVE  247

Query  558  ERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK-NINEFLKPAEG  385
            ERKV   K F +MQ LS+KK N++EVFIKLG+EK+K+    E+  K   +INEFLKPA G
Sbjct  248  ERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVMEREEKTKKSLSINEFLKPANG  306

Query  384  E  382
            E
Sbjct  307  E  307



>ref|XP_002870130.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46389.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 82/124 (66%), Gaps = 8/124 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            +LEEK+KAL +    ERKV   K F SMQ LSNKK+++E+FIKLGS+K+K+K+  E+  K
Sbjct  236  ILEEKKKALQSLATSERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDEKEEKAK  294

Query  423  tK-NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD------APSIEDVGQFPT  265
               +INEFLKPAEGENYYR GGRG     GRG  G S           AP+I D  QFP+
Sbjct  295  KAVSINEFLKPAEGENYYRGGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPS  354

Query  264  LGKK  253
            LG K
Sbjct  355  LGGK  358



>ref|XP_008793172.1| PREDICTED: uncharacterized protein DDB_G0288133-like [Phoenix 
dactylifera]
 ref|XP_008793173.1| PREDICTED: uncharacterized protein DDB_G0288133-like [Phoenix 
dactylifera]
Length=378

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 121/181 (67%), Gaps = 19/181 (10%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQED--TGDATKDSPP---NeteekepeekemtleeyeKVLEEKRK  583
            +N  EK V  EKQ  QED  + +A KD+     NE +EKEPEE+EMTLEEYEK+ EEKRK
Sbjct  197  VNTDEKVVSPEKQPEQEDAPSSEANKDNKEGEVNEADEKEPEEEEMTLEEYEKIKEEKRK  256

Query  582  ALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLG-----SekekkkeagekvkktK  418
            ALLA KPEERKV LDK F SMQ LS KK  E+VFIKLG     S+K +  + GE+ +K  
Sbjct  257  ALLALKPEERKVELDKAFESMQQLSLKKG-EDVFIKLGTDKDSSKKRENADRGERARKFF  315

Query  417  NINEFLKPAEGENyyrsggrgrgrgrgrgg--------yggSLSSVDAPSIEDVGQFPTL  262
            +INEFLKPAEGE YY   GRGRGRGRGRG           G   +  A SIED GQFPTL
Sbjct  316  SINEFLKPAEGERYYSPAGRGRGRGRGRGDRRTFGDGFGRGGTVTAAALSIEDPGQFPTL  375

Query  261  G  259
            G
Sbjct  376  G  376



>ref|XP_001785274.1| predicted protein [Physcomitrella patens]
 gb|EDQ49926.1| predicted protein [Physcomitrella patens]
Length=403

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 76/147 (52%), Gaps = 30/147 (20%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            VL EKRKAL  +K  ERKV  DKEF  MQL+ NKK +E++FIKLG +KEK K    + ++
Sbjct  257  VLAEKRKALEDAKAAERKVEADKEFEKMQLVDNKKREEDIFIKLGQDKEKSKREAAEKEE  316

Query  423  tK----NINEFLKPAEGENy--------------------------yrsggrgrgrgrgr  334
                  +INEFLKPAEGE                               G R  GRGR  
Sbjct  317  KSRKPVSINEFLKPAEGEKSYYPSNRGRGGRGGRGDRREGGDRREGAGRGDRDSGRGRFG  376

Query  333  ggyggSLSSVDAPSIEDVGQFPTLGKK  253
            GG G +     AP IED  QFPTLG K
Sbjct  377  GGRGSAPGGASAPKIEDQAQFPTLGGK  403



>ref|XP_009145376.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Brassica rapa]
 ref|XP_009145384.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Brassica rapa]
 emb|CDY42945.1| BnaA01g18090D [Brassica napus]
Length=304

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvk  427
            +LEEKRKAL +    ERKV   K F SMQ LSNKK +++E+FIKLGS+K+K+K+  E+  
Sbjct  185  ILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKA  243

Query  426  ktK-NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD--APSIEDVGQFPTLGK  256
            K   +INEFLKPAEGENYYR G  GRGRG      GG   +    AP+I D  QFP+LG 
Sbjct  244  KKAVSINEFLKPAEGENYYRGGRGGRGRGGRVSSGGGFSGNRSEAAPAIADTAQFPSLGG  303

Query  255  K  253
            K
Sbjct  304  K  304



>ref|XP_002870099.1| hypothetical protein ARALYDRAFT_493124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46358.1| hypothetical protein ARALYDRAFT_493124 [Arabidopsis lyrata subsp. 
lyrata]
Length=372

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -2

Query  738  VEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPE  559
            V+K +  EKQ  + +  DA K++P     E++PE+KEMTLEEYEKVLEEK+KAL A+K E
Sbjct  181  VDKNLTVEKQGGEGEATDANKETPAEVQAEEKPEDKEMTLEEYEKVLEEKKKALQATKVE  240

Query  558  ERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK-NINEFLKPAEG  385
            ERKV   K F +MQ LS+KK N++EVFIKLG+EK+K+    E+  +   +INEFLKPA+G
Sbjct  241  ERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVTEREEKTRKSLSINEFLKPADG  299

Query  384  EN  379
            +N
Sbjct  300  KN  301



>ref|XP_002991714.1| hypothetical protein SELMODRAFT_448524 [Selaginella moellendorffii]
 gb|EFJ07285.1| hypothetical protein SELMODRAFT_448524 [Selaginella moellendorffii]
Length=421

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 69/118 (58%), Gaps = 2/118 (2%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            V+EEKRKAL A K EERKV  D EF  MQL+ +KK DE++FIKLG++K KKKE  +  K 
Sbjct  305  VMEEKRKALTAMKSEERKVVADSEFQKMQLV-DKKADEDIFIKLGADKAKKKEGEKDDKT  363

Query  423  tKNINEFLKPAEGENyy-rsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
             K++    + +E EN Y   GG               LSS  AP I D  QFP+LG K
Sbjct  364  KKSVPIEFRKSEAENQYGGRGGNRGRGRGRGLNNNTRLSSSSAPEIADFQQFPSLGGK  421



>ref|XP_010449600.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 [Camelina 
sativa]
Length=387

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 88/121 (73%), Gaps = 3/121 (2%)
 Frame = -2

Query  738  VEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPE  559
            VEK V  +KQ  + +  DA K++P  E  EKEPE KEMTLEEYEKVLEEK+KAL A+K E
Sbjct  185  VEKNVTVDKQGGEGEATDANKETPAEEQPEKEPENKEMTLEEYEKVLEEKKKALQATKVE  244

Query  558  ERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK-NINEFLKPAEG  385
            ERKV   K F +MQ LS+KK N++EVFIKLG+EK+K+    E+  K   +INEFLKPA G
Sbjct  245  ERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVTEREEKTKKSLSINEFLKPANG  303

Query  384  E  382
            E
Sbjct  304  E  304



>ref|XP_009145362.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Brassica rapa]
 ref|XP_009145369.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Brassica rapa]
Length=335

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 5/121 (4%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvk  427
            +LEEKRKAL +    ERKV   K F SMQ LSNKK +++E+FIKLGS+K+K+K+  E+  
Sbjct  216  ILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKA  274

Query  426  ktK-NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD--APSIEDVGQFPTLGK  256
            K   +INEFLKPAEGENYYR G  GRGRG      GG   +    AP+I D  QFP+LG 
Sbjct  275  KKAVSINEFLKPAEGENYYRGGRGGRGRGGRVSSGGGFSGNRSEAAPAIADTAQFPSLGG  334

Query  255  K  253
            K
Sbjct  335  K  335



>emb|CDY35615.1| BnaC01g21370D [Brassica napus]
Length=338

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 83/128 (65%), Gaps = 12/128 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvk  427
            +LEEKRKAL +    ERKV   K F SMQ LSNKK +++E+FIKLGS+K+K+K+  E+  
Sbjct  212  ILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKP  270

Query  426  ktK-NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD---------APSIEDVG  277
            K   +INEFLKPA+GENYYR G  GRGRG       G+ +S           AP+I D  
Sbjct  271  KKAVSINEFLKPADGENYYRGGRGGRGRGGRESRDRGARASSGGYGGNRSEAAPAIADTA  330

Query  276  QFPTLGKK  253
            QFP+LG K
Sbjct  331  QFPSLGGK  338



>ref|XP_006414296.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
 gb|ESQ55749.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
Length=359

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 82/126 (65%), Gaps = 10/126 (8%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            +LEEK+KAL +    ERKV   K F SMQ LSNKK+++E+FIKLGS+K+K+K+  E+  K
Sbjct  235  ILEEKKKALQSQTTSERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAK  293

Query  423  tK-NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLS--------SVDAPSIEDVGQF  271
               +INEFLKPAEGENYYR GGRG     GRG   G  S        S  AP I D  QF
Sbjct  294  KAVSINEFLKPAEGENYYRGGGRGGRERGGRGRGRGGASSGGFGGHRSEAAPVIGDTAQF  353

Query  270  PTLGKK  253
            P+LG K
Sbjct  354  PSLGGK  359



>gb|KEH17858.1| nuclear RNA-binding-like protein [Medicago truncatula]
Length=373

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 111/174 (64%), Gaps = 13/174 (7%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTG--DATKDSPPNeteekepeekemtleeyeKVLEEKRKALLA  571
            NE EK V  +K   +ED    D  K++P  E EEKEPE+KEMTLEEYEKVLEEKRKAL  
Sbjct  198  NETEKNVAEDKPVGEEDAAAADGNKETPAPEAEEKEPEDKEMTLEEYEKVLEEKRKALNV  257

Query  570  SKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkea--gekvkktKNINEFLK  397
                 RKV   KEF S++ LS KK ++E+F KLGS+K+++K+A   EK +K  +INEFLK
Sbjct  258  KTDGGRKVDT-KEFESLKPLSCKKENDEIFAKLGSDKDRRKDAIEKEKARKALSINEFLK  316

Query  396  PAEGENyyr--------sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLG  259
            PAEGE YY           G   G   G G  G +  +V APSIED GQFPTLG
Sbjct  317  PAEGEKYYNPGGRGGRGGRGGRGGSRGGGGYGGNAYGNVSAPSIEDPGQFPTLG  370



>ref|XP_009605755.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana tomentosiformis]
Length=363

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 114/173 (66%), Gaps = 11/173 (6%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            NE EK ++ EK +++ + GD  K++P  E E+KEPE KEMTLEEYEK+LEEKR+AL A K
Sbjct  193  NEGEKNLNVEKLSTEGEAGDDKKENPAAEAEDKEPENKEMTLEEYEKLLEEKRQALQALK  252

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK--NINEFLKPA  391
             EERKV   KEF SMQ LS KK+ +++FIKL  + ++++ A ++ K  K  +INEFLKPA
Sbjct  253  TEERKVDT-KEFESMQQLS-KKSSDDIFIKLAPKDKRRESAEKEEKAKKAVSINEFLKPA  310

Query  390  EGENyyr-------sggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTLGKK  253
            EGE YY          GRG        G   + S+V+AP IED G FPTLG K
Sbjct  311  EGERYYAPGGRGRGGRGRGSRGYGEDYGGVNTTSNVEAPPIEDPGHFPTLGGK  363



>gb|KFK22256.1| hypothetical protein AALP_AAs66747U001100 [Arabis alpina]
Length=374

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 85/127 (67%), Gaps = 11/127 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            +LEEK+KAL +    ERKV   K F SMQ LSNKK+++E+FIKLGS+K+K+K+  E+  K
Sbjct  249  ILEEKKKALQSETVSERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAK  307

Query  423  tK-NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD---------APSIEDVGQ  274
               +INEFLKPAEGENY+R GGRG     GRGG GG+ +            AP+I D  Q
Sbjct  308  KAVSINEFLKPAEGENYHRGGGRGGRGRGGRGGRGGNSTGGGGFAGYRNEPAPAIADTAQ  367

Query  273  FPTLGKK  253
            FP+LG K
Sbjct  368  FPSLGGK  374



>gb|AAF14245.1|AF110229_1 nuclear RNA binding protein B [Spinacia oleracea]
Length=240

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 115/171 (67%), Gaps = 6/171 (4%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + + EK V++E  T+ ED     K+  P E EEKEPEEKEMTLEEYEK+LEEKRKALLA 
Sbjct  70   VEQTEKNVNSENLTAVEDAAVGNKEGQPEEAEEKEPEEKEMTLEEYEKLLEEKRKALLAL  129

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS--ekekkkeagekvkktKNINEFLKP  394
            K EE KV +DKE  SMQ LS +++D  VFIKLGS  +K+K+    EKVKK+ +INEFLKP
Sbjct  130  KSEEPKVVVDKELESMQQLSKQQDDSSVFIKLGSDKDKKKEALEKEKVKKSVSINEFLKP  189

Query  393  AEGENyyrsggrgrgrgrgrggygg----SLSSVDAPSIEDVGQFPTLGKK  253
            AEGE +   G    GRG   G YGG       S  AP+I D G+FPTLG K
Sbjct  190  AEGERFGGRGRGRGGRGSRGGEYGGGGGNRTYSAPAPAIGDPGEFPTLGGK  240



>ref|XP_004229741.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum lycopersicum]
Length=360

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 118/169 (70%), Gaps = 7/169 (4%)
 Frame = -2

Query  744  NEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASK  565
            +E EK ++ EK +++E+ G   K++P  E  +KEPE+KEMTLEEYEK+LEEKRKAL A K
Sbjct  194  DEGEKNLNVEKPSTEEEAGVDKKENPAAEAADKEPEDKEMTLEEYEKLLEEKRKALQALK  253

Query  564  PEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkktK--NINEFLKPA  391
             EERKV   K F SMQ +S K +D E+F+KLGS+ ++K+ A ++ K  K  +INEFLKPA
Sbjct  254  TEERKVDT-KVFESMQQISKKSSD-EIFVKLGSKDKRKESAEKEEKAKKAVSINEFLKPA  311

Query  390  EGENyyr--sggrgrgrgrgrggyggSLSSVD-APSIEDVGQFPTLGKK  253
            EGE YY     GRGRGRG        ++S+V+ AP IED G FPTLG K
Sbjct  312  EGERYYAPGGRGRGRGRGSRGYSEANTMSNVEAAPPIEDPGHFPTLGGK  360



>ref|XP_010439990.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like [Camelina 
sativa]
Length=390

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 88/121 (73%), Gaps = 3/121 (2%)
 Frame = -2

Query  738  VEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLASKPE  559
            VEK V  EKQ+ + +   A K++P  E  EKEPE KEMTLEEYEKVLEEK+KAL A+K E
Sbjct  188  VEKNVTVEKQSGEGEATIANKETPAEEQPEKEPENKEMTLEEYEKVLEEKKKALQATKVE  247

Query  558  ERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvkktK-NINEFLKPAEG  385
            ERKV   K F +MQ LS+KK N++EVFIKLG+EK+K+    E+  K   +INEFLKPA G
Sbjct  248  ERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRVTEREEKTKKSLSINEFLKPANG  306

Query  384  E  382
            E
Sbjct  307  E  307



>gb|AAF14246.1|AF110230_1 nuclear RNA binding protein C [Spinacia oleracea]
Length=247

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + + EK V++E  T+ ED     K+  P E EEKEPEEKEMTLEEYEK+LEEKRKALLA 
Sbjct  81   VEQTEKNVNSENLTAVEDAAVGNKEGQPEEAEEKEPEEKEMTLEEYEKLLEEKRKALLAL  140

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS--ekekkkeagekvkktKNINEFLKP  394
            K EE KV +DKE  SMQ LSNKK+D+ VFIKLGS  +K+K+    EKVKK+ +INEFLKP
Sbjct  141  KSEEPKVVVDKELESMQQLSNKKDDDSVFIKLGSDKDKKKEALEKEKVKKSVSINEFLKP  200

Query  393  A  391
            A
Sbjct  201  A  201



>ref|XP_006284012.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
 gb|EOA16910.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
Length=354

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 77/123 (63%), Gaps = 7/123 (6%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkkeagekvkk  424
            +LEEK+KAL +    ERKV   K F SMQ LSNKK+++E+FIKLGS+K+K+K+  E+  K
Sbjct  233  ILEEKKKALQSLTTTERKVDT-KVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAK  291

Query  423  tK-NINEFLKPAEGEN-----yyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQFPTL  262
               +INEFLKPAEG+N         G  GRGRG       G   +  AP+I D   FP+L
Sbjct  292  KAVSINEFLKPAEGQNFYRGGRGGRGRGGRGRGGVSSEEHGGYRNEPAPAIGDTTHFPSL  351

Query  261  GKK  253
            G K
Sbjct  352  GGK  354



>ref|XP_002511578.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF50247.1| RNA binding protein, putative [Ricinus communis]
Length=295

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            +NE EK +  EK   + +  D  K+SP NE EEK+PE+KEMTLEEYEKVLEEKRKAL A+
Sbjct  198  VNEGEKNMGDEKPVGEGEAVDGKKESPTNEPEEKQPEDKEMTLEEYEKVLEEKRKALQAT  257

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKL  472
            K EERKV   KEFASMQ LS+KK  +++FIKL
Sbjct  258  KAEERKVDT-KEFASMQQLSSKKGGDDIFIKL  288



>gb|KJB37650.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=284

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = -2

Query  747  INEVEKTVDTEKQTSQEDTGDATKDSPPNeteekepeekemtleeyeKVLEEKRKALLAS  568
            + E EK V  EKQ+ +ED  DA K++  NE EEKEPE KEMTLEEYEK++EEKRKALLA 
Sbjct  191  VPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLAL  250

Query  567  KPEERKVCLDKEFASMQLLSNKKNDEEVFIKL  472
            K EERKV   KEF SMQ LS+KK+++++FIKL
Sbjct  251  KTEERKVDT-KEFESMQQLSSKKSNDDIFIKL  281



>gb|ACG24258.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=360

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 79/138 (57%), Gaps = 23/138 (17%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvk  427
            VLEEK+KAL A+K EERKV   K F +MQ LS+KK N++EVFIKLG+EK+K+    E+  
Sbjct  224  VLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREEKT  282

Query  426  ktK-NINEFLKPAEG--------------------ENyyrsggrgrgrgrgrggyggSLS  310
            +   +INEFLKPA+G                    E   R GGR +  G      GG+ +
Sbjct  283  RKSLSINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNQREGGRNQRDGGAAA  342

Query  309  SVDAPSIEDVGQFPTLGK  256
                P+I D  QFPTLGK
Sbjct  343  QAPTPAIGDSAQFPTLGK  360



>gb|AAM64962.1| nuclear RNA binding protein A-like protein [Arabidopsis thaliana]
Length=360

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 79/138 (57%), Gaps = 23/138 (17%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvk  427
            VLEEK+KAL A+K EERKV   K F +MQ LS+KK N++EVFIKLG+EK+K+    E+  
Sbjct  224  VLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREEKT  282

Query  426  ktK-NINEFLKPAEG--------------------ENyyrsggrgrgrgrgrggyggSLS  310
            +   +INEFLKPA+G                    E   R GGR +  G      GG+ +
Sbjct  283  RKSLSINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNQREGGRNQRDGGAAA  342

Query  309  SVDAPSIEDVGQFPTLGK  256
                P+I D  QFPTLGK
Sbjct  343  QAPTPAIGDSAQFPTLGK  360



>ref|XP_010231993.1| PREDICTED: uncharacterized protein LOC100831026 [Brachypodium 
distachyon]
 ref|XP_010231994.1| PREDICTED: uncharacterized protein LOC100831026 [Brachypodium 
distachyon]
Length=127

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 3/75 (4%)
 Frame = -2

Query  594  EKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGSekekkke---agekvkk  424
            EKRKALL  K EERKV + KE  SMQ LS KK+ ++VFIKLGS+KEK+K      E+ KK
Sbjct  11   EKRKALLPLKAEERKVEVGKELRSMQQLSVKKDSDKVFIKLGSDKEKRKGNIERDERAKK  70

Query  423  tKNINEFLKPAEGEN  379
            + +INEFLKPA+GE 
Sbjct  71   SLSINEFLKPADGER  85



>gb|EMS56112.1| hypothetical protein TRIUR3_18406 [Triticum urartu]
Length=199

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKKNDEEVFIKLGS  466
            VLEEKRKA+LA K EERKV +DKE  SMQ LS KK+ EEVFIKLGS
Sbjct  116  VLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGS  161



>emb|CDY38403.1| BnaC01g10120D [Brassica napus]
Length=336

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 73/126 (58%), Gaps = 11/126 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvk  427
            VLEEKRKAL A+K EERKV   K F +MQ LS+KK N++EVFIKLG++K+K+    E+  
Sbjct  212  VLEEKRKALQATKIEERKVDT-KAFETMQQLSSKKSNNDEVFIKLGTDKDKRPVEKEEKT  270

Query  426  ktK-NINEFLKPA--------EGENyyrsggrgrgrgrgrggyggSLSSVDAPSIEDVGQ  274
            K   +INEFLKPA              R        GRG  G     ++  AP IED   
Sbjct  271  KKSLSINEFLKPANGERYRGGYRGGRGRGPRGADEGGRGPKGGADRKAAAPAPKIEDAAH  330

Query  273  FPTLGK  256
            FPTLGK
Sbjct  331  FPTLGK  336



>ref|XP_009108277.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Brassica rapa]
Length=273

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 87/128 (68%), Gaps = 12/128 (9%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvk  427
            +LEEK+K+L +    ERKV   K F SMQ LSNKK +++E+FIKLGS+K+K+K+  E+  
Sbjct  147  ILEEKKKSLQSQTTSERKVDT-KVFESMQQLSNKKKSNDEIFIKLGSDKDKRKDDKEEKA  205

Query  426  ktK-NINEFLKPAEGENyyrsggrgrgrgrgrggyggSLSSVD---------APSIEDVG  277
            K   +INEFLKPAEGENYYR GGRG GRGRGRGG    + S           AP+I D  
Sbjct  206  KKAVSINEFLKPAEGENYYRGGGRGGGRGRGRGGRDRGVVSGGGFDGYRSEAAPAIGDTA  265

Query  276  QFPTLGKK  253
            QFP+LG K
Sbjct  266  QFPSLGGK  273



>ref|NP_193485.1| hyaluronan / mRNA binding family [Arabidopsis thaliana]
 emb|CAB10532.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78755.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL09735.1| AT4g17520/dl4795w [Arabidopsis thaliana]
 gb|AAL91151.1| unknown protein [Arabidopsis thaliana]
 gb|AAN65040.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83906.1| hyaluronan / mRNA binding family [Arabidopsis thaliana]
Length=360

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 78/138 (57%), Gaps = 23/138 (17%)
 Frame = -2

Query  603  VLEEKRKALLASKPEERKVCLDKEFASMQLLSNKK-NDEEVFIKLGSekekkkeagekvk  427
            VLEEK+KAL A+K EERKV   K F +MQ LS+KK N++EVFIKLG+EK+K+    E+  
Sbjct  224  VLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREEKT  282

Query  426  ktK-NINEFLKPAEG--------------------ENyyrsggrgrgrgrgrggyggSLS  310
            +   +INEFLKPA+G                    E   R GGR    G      GG+ +
Sbjct  283  RKSLSINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNLREGGRNQRDGGAAA  342

Query  309  SVDAPSIEDVGQFPTLGK  256
                P+I D  QFPTLGK
Sbjct  343  QAPTPAIGDSAQFPTLGK  360



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840