BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF020I14

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06636.1|  unnamed protein product                                132   1e-32   Coffea canephora [robusta coffee]
ref|XP_006341048.1|  PREDICTED: probable ADP-ribosylation factor ...    124   1e-29   Solanum tuberosum [potatoes]
ref|NP_001275129.1|  uncharacterized protein LOC102577536               122   3e-29   Solanum tuberosum [potatoes]
ref|XP_009787987.1|  PREDICTED: probable ADP-ribosylation factor ...    122   4e-29   Nicotiana sylvestris
ref|XP_009611524.1|  PREDICTED: probable ADP-ribosylation factor ...    122   6e-29   Nicotiana tomentosiformis
gb|KDO44653.1|  hypothetical protein CISIN_1g0124232mg                  116   8e-29   Citrus sinensis [apfelsine]
ref|XP_004246418.1|  PREDICTED: probable ADP-ribosylation factor ...    120   1e-28   Solanum lycopersicum
ref|XP_006480784.1|  PREDICTED: probable ADP-ribosylation factor ...    116   5e-27   Citrus sinensis [apfelsine]
ref|XP_010253251.1|  PREDICTED: probable ADP-ribosylation factor ...    110   9e-25   Nelumbo nucifera [Indian lotus]
ref|XP_011094839.1|  PREDICTED: probable ADP-ribosylation factor ...    109   2e-24   Sesamum indicum [beniseed]
gb|EYU41704.1|  hypothetical protein MIMGU_mgv1a005908mg                108   2e-24   Erythranthe guttata [common monkey flower]
gb|KHG27901.1|  ADP-ribosylation factor GTPase-activating AGD7 -l...    107   6e-24   Gossypium arboreum [tree cotton]
gb|EYU26574.1|  hypothetical protein MIMGU_mgv11b004906mg               107   9e-24   Erythranthe guttata [common monkey flower]
ref|XP_009804190.1|  PREDICTED: probable ADP-ribosylation factor ...    107   1e-23   Nicotiana sylvestris
ref|XP_004137765.1|  PREDICTED: LOW QUALITY PROTEIN: ADP-ribosyla...    106   1e-23   
ref|XP_004302746.1|  PREDICTED: probable ADP-ribosylation factor ...    106   1e-23   Fragaria vesca subsp. vesca
gb|KJB16885.1|  hypothetical protein B456_002G255000                    106   2e-23   Gossypium raimondii
ref|XP_008442564.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    106   2e-23   Cucumis melo [Oriental melon]
ref|XP_010037851.1|  PREDICTED: probable ADP-ribosylation factor ...    105   4e-23   Eucalyptus grandis [rose gum]
ref|XP_010111497.1|  hypothetical protein L484_021322                   104   5e-23   
ref|XP_010253247.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    105   5e-23   
ref|XP_003542460.1|  PREDICTED: probable ADP-ribosylation factor ...    105   6e-23   Glycine max [soybeans]
ref|XP_010529843.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...    104   8e-23   Tarenaya hassleriana [spider flower]
gb|KGN58883.1|  hypothetical protein Csa_3G734360                       104   9e-23   Cucumis sativus [cucumbers]
ref|XP_004167174.1|  PREDICTED: probable ADP-ribosylation factor ...    104   9e-23   
ref|XP_007144453.1|  hypothetical protein PHAVU_007G157400g             103   2e-22   Phaseolus vulgaris [French bean]
ref|XP_007205139.1|  hypothetical protein PRUPE_ppa005179mg             103   2e-22   Prunus persica
gb|KHN05918.1|  ADP-ribosylation factor GTPase-activating protein...    101   3e-22   Glycine soja [wild soybean]
ref|XP_007027080.1|  ARF-GAP domain 7 isoform 1                         102   5e-22   
ref|XP_008241285.1|  PREDICTED: probable ADP-ribosylation factor ...    102   8e-22   
ref|XP_006429044.1|  hypothetical protein CICLE_v10013094mg           96.7    1e-21   
ref|XP_004249530.1|  PREDICTED: probable ADP-ribosylation factor ...    100   2e-21   Solanum lycopersicum
ref|XP_002527750.1|  arf gtpase-activating protein, putative            100   2e-21   Ricinus communis
ref|XP_006339030.1|  PREDICTED: probable ADP-ribosylation factor ...  99.0    1e-20   Solanum tuberosum [potatoes]
ref|XP_002881515.1|  hypothetical protein ARALYDRAFT_482750           98.2    1e-20   
ref|NP_181291.1|  ADP-ribosylation factor GTPase-activating prote...  97.1    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403662.1|  hypothetical protein EUTSA_v10010333mg           97.4    4e-20   Eutrema salsugineum [saltwater cress]
ref|XP_003537172.1|  PREDICTED: probable ADP-ribosylation factor ...  97.4    4e-20   Glycine max [soybeans]
ref|XP_009621199.1|  PREDICTED: probable ADP-ribosylation factor ...  95.9    1e-19   Nicotiana tomentosiformis
dbj|BAE71192.1|  putative Asp1                                        95.9    1e-19   Trifolium pratense [peavine clover]
ref|XP_006410942.1|  hypothetical protein EUTSA_v10016645mg           95.5    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_009374672.1|  PREDICTED: probable ADP-ribosylation factor ...  95.1    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_008366719.1|  PREDICTED: probable ADP-ribosylation factor ...  95.1    3e-19   
ref|XP_004495006.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  95.1    3e-19   Cicer arietinum [garbanzo]
ref|XP_004253319.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  94.4    4e-19   
ref|XP_010427029.1|  PREDICTED: probable ADP-ribosylation factor ...  94.4    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010504141.1|  PREDICTED: probable ADP-ribosylation factor ...  94.0    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010515873.1|  PREDICTED: probable ADP-ribosylation factor ...  94.0    6e-19   Camelina sativa [gold-of-pleasure]
ref|NP_190939.1|  putative ADP-ribosylation factor GTPase-activat...  93.2    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KJB76702.1|  hypothetical protein B456_012G102200                  92.8    1e-18   Gossypium raimondii
ref|XP_009338772.1|  PREDICTED: probable ADP-ribosylation factor ...  92.8    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_008345448.1|  PREDICTED: probable ADP-ribosylation factor ...  92.4    2e-18   
ref|XP_006291063.1|  hypothetical protein CARUB_v10017178mg           92.4    2e-18   
ref|XP_011019883.1|  PREDICTED: probable ADP-ribosylation factor ...  92.4    3e-18   Populus euphratica
ref|XP_002877936.1|  hypothetical protein ARALYDRAFT_485760           92.0    3e-18   
gb|KEH42388.1|  ADP-ribosylation factor GTPase-activating protein...  92.0    4e-18   Medicago truncatula
ref|XP_010937673.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  91.7    5e-18   Elaeis guineensis
ref|XP_008812043.1|  PREDICTED: probable ADP-ribosylation factor ...  88.2    5e-18   Phoenix dactylifera
ref|XP_009116065.1|  PREDICTED: probable ADP-ribosylation factor ...  91.3    6e-18   Brassica rapa
ref|XP_010505344.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  90.5    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010517025.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  90.5    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006294027.1|  hypothetical protein CARUB_v10023020mg           90.1    2e-17   
gb|KHG23489.1|  ADP-ribosylation factor GTPase-activating protein...  89.4    2e-17   Gossypium arboreum [tree cotton]
emb|CDX78196.1|  BnaA09g33910D                                        89.0    3e-17   
emb|CDX79739.1|  BnaC03g20750D                                        88.2    5e-17   
ref|XP_009139382.1|  PREDICTED: probable ADP-ribosylation factor ...  88.2    6e-17   Brassica rapa
gb|KDP35606.1|  hypothetical protein JCGZ_09044                       85.5    8e-17   Jatropha curcas
ref|XP_002309050.1|  PDE1 SUPPRESSOR 1 family protein                 87.8    9e-17   Populus trichocarpa [western balsam poplar]
gb|KDP20155.1|  hypothetical protein JCGZ_00032                       85.9    4e-16   Jatropha curcas
ref|XP_011094837.1|  PREDICTED: probable ADP-ribosylation factor ...  85.5    5e-16   Sesamum indicum [beniseed]
ref|XP_009402324.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  85.5    6e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003554321.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  85.5    7e-16   Glycine max [soybeans]
emb|CDX74953.1|  BnaA05g06990D                                        85.1    7e-16   
emb|CDX73533.1|  BnaC08g24700D                                        84.3    1e-15   
ref|XP_010509321.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  84.0    2e-15   
emb|CBI30586.3|  unnamed protein product                              82.8    3e-15   Vitis vinifera
ref|XP_002262606.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  83.2    4e-15   Vitis vinifera
ref|XP_009416249.1|  PREDICTED: probable ADP-ribosylation factor ...  82.8    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010920665.1|  PREDICTED: probable ADP-ribosylation factor ...  82.8    5e-15   Elaeis guineensis
emb|CDY30849.1|  BnaC04g27040D                                        82.8    5e-15   Brassica napus [oilseed rape]
ref|XP_003521336.1|  PREDICTED: probable ADP-ribosylation factor ...  82.8    5e-15   Glycine max [soybeans]
ref|XP_009133186.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  82.0    1e-14   Brassica rapa
gb|KHG23490.1|  ADP-ribosylation factor GTPase-activating protein...  80.9    3e-14   Gossypium arboreum [tree cotton]
ref|XP_010678052.1|  PREDICTED: probable ADP-ribosylation factor ...  79.7    6e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007162658.1|  hypothetical protein PHAVU_001G1694000g          79.7    7e-14   Phaseolus vulgaris [French bean]
ref|XP_008795047.1|  PREDICTED: probable ADP-ribosylation factor ...  79.3    7e-14   Phoenix dactylifera
ref|XP_009386541.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  79.3    8e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG17006.1|AF184146_1  ARF GAP-like zinc finger-containing pro...  79.3    9e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007027081.1|  ARF-GAP domain 7 isoform 2                       78.2    1e-13   
emb|CDY69342.1|  BnaCnng63080D                                        78.2    2e-13   Brassica napus [oilseed rape]
ref|XP_010907061.1|  PREDICTED: probable ADP-ribosylation factor ...  78.2    2e-13   
emb|CDY07784.1|  BnaA03g17270D                                        77.0    4e-13   Brassica napus [oilseed rape]
ref|XP_006373937.1|  hypothetical protein POPTR_0016s11090g           72.8    1e-12   
ref|XP_009143481.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  74.3    3e-12   Brassica rapa
ref|XP_009141672.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  72.4    2e-11   Brassica rapa
ref|XP_004493890.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  70.1    9e-11   Cicer arietinum [garbanzo]
ref|XP_009409527.1|  PREDICTED: ADP-ribosylation factor GTPase-ac...  68.6    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD32193.1|  Arf GTPase activating protein                         67.0    1e-09   Medicago truncatula
ref|XP_003625498.1|  ADP-ribosylation factor GTPase-activating pr...  66.6    1e-09   
ref|XP_006651253.1|  PREDICTED: LOW QUALITY PROTEIN: probable ADP...  64.7    5e-09   Oryza brachyantha
emb|CDY26647.1|  BnaA09g46300D                                        62.0    7e-09   Brassica napus [oilseed rape]
gb|EPS67752.1|  hypothetical protein M569_07021                       63.9    9e-09   Genlisea aurea
emb|CDX88291.1|  BnaC06g37350D                                        62.0    1e-08   
gb|KHN09424.1|  Putative ADP-ribosylation factor GTPase-activatin...  60.8    1e-08   Glycine soja [wild soybean]
ref|XP_010922379.1|  PREDICTED: probable ADP-ribosylation factor ...  63.2    2e-08   Elaeis guineensis
emb|CDY16083.1|  BnaC08g40400D                                        58.9    2e-07   Brassica napus [oilseed rape]
gb|AAO72580.1|  ADP ribosylation GTPase-like protein                  59.7    2e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDY18435.1|  BnaA04g21520D                                        59.3    3e-07   Brassica napus [oilseed rape]
gb|EAY89468.1|  hypothetical protein OsI_11000                        59.3    3e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001049726.1|  Os03g0278400                                     59.3    3e-07   
ref|XP_003558222.1|  PREDICTED: probable ADP-ribosylation factor ...  55.5    7e-06   Brachypodium distachyon [annual false brome]
ref|XP_002465464.1|  hypothetical protein SORBIDRAFT_01g039320        55.1    1e-05   Sorghum bicolor [broomcorn]
ref|XP_004984751.1|  PREDICTED: probable ADP-ribosylation factor ...  55.1    1e-05   Setaria italica
ref|XP_006846038.1|  hypothetical protein AMTR_s00012p00025360        54.3    2e-05   Amborella trichopoda
ref|NP_001150760.1|  DNA binding protein                              53.9    2e-05   Zea mays [maize]
ref|XP_008654261.1|  PREDICTED: probable ADP-ribosylation factor ...  53.5    3e-05   Zea mays [maize]
gb|EMT07652.1|  hypothetical protein F775_26990                       53.5    3e-05   
gb|EMS46940.1|  putative ADP-ribosylation factor GTPase-activatin...  52.8    5e-05   Triticum urartu
dbj|BAJ88349.1|  predicted protein                                    52.8    5e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009381844.1|  PREDICTED: probable ADP-ribosylation factor ...  51.6    1e-04   
ref|XP_008780180.1|  PREDICTED: probable ADP-ribosylation factor ...  50.8    3e-04   Phoenix dactylifera
gb|KHF98429.1|  ADP-ribosylation factor GTPase-activating AGD7 -l...  50.4    3e-04   Gossypium arboreum [tree cotton]



>emb|CDP06636.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 111/147 (76%), Gaps = 6/147 (4%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG +TWGIMKGV ALASQKVEEY KE   SWKND   R+ESE NGYY +F  + KG N 
Sbjct  322  EIGHKTWGIMKGVMALASQKVEEYAKEGGVSWKNDGWQRSESETNGYYQEFGQDSKGWN-  380

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA----NNdswagwddakddgfdd  264
                 GQ SSGRQFNSV+SGSWD+WD+K N  +E+S      N DSWAGWDD KDDGFD+
Sbjct  381  -SPAAGQPSSGRQFNSVSSGSWDDWDSKDNRKEESSKGTASHNGDSWAGWDDNKDDGFDN  439

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            FYQSA D+K VG+NGKSD KW++GGFL
Sbjct  440  FYQSASDSKAVGYNGKSDAKWTEGGFL  466



>ref|XP_006341048.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X1 [Solanum tuberosum]
 ref|XP_006341049.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X2 [Solanum tuberosum]
 ref|XP_006341050.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X3 [Solanum tuberosum]
 ref|XP_006341051.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 isoform X4 [Solanum tuberosum]
Length=467

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 107/150 (71%), Gaps = 11/150 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ++WGIMKGV A+ASQKVEEYTKE + +WKNDS  R ESE+NGYY DFN + KG N 
Sbjct  322  EIGQKSWGIMKGVLAMASQKVEEYTKE-SPAWKNDSWQRGESEKNGYYQDFNQDSKGWN-  379

Query  431  sgggggqsssGRQFNSVNSGSWDNWD----TKGNNTKETSPANNdswagw--ddakddgf  270
                GG  SSGR  NSV+SGSWD+WD    +K N TK  +  NN +      DD +DDGF
Sbjct  380  --ASGGAQSSGRNVNSVSSGSWDDWDNEDKSKVNPTKAAAAPNNKNDDWAGWDDGQDDGF  437

Query  269  ddFYQSAHDNKHVG-HNGKSDTKWSDGGFL  183
            D+ YQSA +NKH   H GKSD+KW+DGGFL
Sbjct  438  DNHYQSASNNKHATVHAGKSDSKWTDGGFL  467



>ref|NP_001275129.1| uncharacterized protein LOC102577536 [Solanum tuberosum]
 gb|ABA46771.1| unknown [Solanum tuberosum]
Length=468

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 107/150 (71%), Gaps = 11/150 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ++WGIMKGV A+ASQKVEEYTKE + +WKNDS  R ES++NGYY DFN + KG N 
Sbjct  323  EIGQKSWGIMKGVLAMASQKVEEYTKE-SPAWKNDSWQRGESDKNGYYQDFNQDSKGWN-  380

Query  431  sgggggqsssGRQFNSVNSGSWDNWD----TKGNNTKETSPANNdswagw--ddakddgf  270
                GG  SSGR  NSV+SGSWD+WD    +K N TK  +  NN +      DD +DDGF
Sbjct  381  --ASGGAQSSGRNANSVSSGSWDDWDNEDKSKVNPTKAAAAPNNKNDDWAGWDDGQDDGF  438

Query  269  ddFYQSAHDNKHVG-HNGKSDTKWSDGGFL  183
            D+ YQSA +NKH   H GKSD+KW+DGGFL
Sbjct  439  DNHYQSASNNKHAAVHAGKSDSKWTDGGFL  468



>ref|XP_009787987.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana sylvestris]
 ref|XP_009787988.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana sylvestris]
Length=464

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 8/147 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+ WG+MKGV A+ASQKVEEYTK D+ +WKNDS  R+E+E+NGYY DFN + KG N 
Sbjct  322  EIGQKGWGLMKGVLAIASQKVEEYTK-DSPAWKNDSWERSENEKNGYYQDFNQDSKGWN-  379

Query  431  sgggggqsssGRQFNSVNSGSWDNWD----TKGNNTKETSPANNdswagwddakddgfdd  264
                GG  SSGR  NSV+SGSWD+WD    +K ++TK  + + ND WAGWDD +DDGFD+
Sbjct  380  --TSGGAQSSGRNVNSVSSGSWDDWDNEDKSKVSSTKGAAASKNDDWAGWDDGQDDGFDN  437

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             YQSA   KH  H GKSD+KW+DGGFL
Sbjct  438  HYQSASGTKHAVHAGKSDSKWTDGGFL  464



>ref|XP_009611524.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana tomentosiformis]
 ref|XP_009611525.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana tomentosiformis]
Length=464

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 8/147 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+ WG+MKGV A+ASQKVEEYTK D+ +WKNDS  R+E+E+NGYY DFN + KG N 
Sbjct  322  EIGQKGWGLMKGVLAIASQKVEEYTK-DSPTWKNDSWQRSENEKNGYYQDFNQDSKGWN-  379

Query  431  sgggggqsssGRQFNSVNSGSWDNWD----TKGNNTKETSPANNdswagwddakddgfdd  264
                GG  SSGR  NSV+SGSWD+WD    +K ++TK  + + ND WAGWDD +DDGFD+
Sbjct  380  --TSGGAQSSGRNVNSVSSGSWDDWDNEDKSKVSSTKGAASSKNDDWAGWDDGQDDGFDN  437

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             YQSA   KH  H GKSD+KW+DGGFL
Sbjct  438  HYQSASGTKHAIHGGKSDSKWTDGGFL  464



>gb|KDO44653.1| hypothetical protein CISIN_1g0124232mg, partial [Citrus sinensis]
 gb|KDO44654.1| hypothetical protein CISIN_1g0124232mg, partial [Citrus sinensis]
 gb|KDO44655.1| hypothetical protein CISIN_1g0124232mg, partial [Citrus sinensis]
Length=163

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 104/146 (71%), Gaps = 8/146 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEEYTKE    W ND+  RNESE NGYY +FNH  KG +S
Sbjct  23   EIGQRTWGIMKGVMAMASQKVEEYTKE---GWNNDNWQRNESESNGYYQEFNHGNKGQDS  79

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKG---NNTKETSPANNdswagwddakddgfddF  261
              GGG  S+     NS  S SWD+WD K    +  K T   NND+WAGWDDAKDDG+D+F
Sbjct  80   PAGGGQYSAG--HHNSYGSSSWDDWDQKDKKEDTPKGTGSGNNDAWAGWDDAKDDGYDNF  137

Query  260  YQSAHDNKHVGHNGKSDTKWSDGGFL  183
            YQSA D K +GHNGKSD  W+ GGFL
Sbjct  138  YQSASDKKALGHNGKSDATWTGGGFL  163



>ref|XP_004246418.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Solanum lycopersicum]
Length=467

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 105/150 (70%), Gaps = 11/150 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ++WGIMKGV A+ASQKVEEYTKE + +WKNDS  R ESE+NGYY DFN + KG N 
Sbjct  322  EIGQKSWGIMKGVLAMASQKVEEYTKE-SPAWKNDSWQRGESEKNGYYQDFNQDPKGWN-  379

Query  431  sgggggqsssGRQFNSVNSGSWDNWD----TKGNNTKETSPANNdswagw--ddakddgf  270
                GG  SSGR  NSV+SGSWD+WD    +K N  K  +  NN +      DD +DDGF
Sbjct  380  --ASGGAQSSGRNVNSVSSGSWDDWDNEDKSKVNPPKAAAAPNNKNDDWAGWDDGQDDGF  437

Query  269  ddFYQSAHDNKHVG-HNGKSDTKWSDGGFL  183
            D+ YQSA +N H   H GKSD+KW+DGGFL
Sbjct  438  DNHYQSASNNNHAAVHAGKSDSKWTDGGFL  467



>ref|XP_006480784.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like isoform X1 [Citrus sinensis]
 ref|XP_006480785.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like isoform X2 [Citrus sinensis]
Length=464

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 106/148 (72%), Gaps = 12/148 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEEYTKE    W ND+  RNESE NGYY +FNH  KG +S
Sbjct  324  EIGQRTWGIMKGVMAMASQKVEEYTKE---GWNNDNWQRNESESNGYYQEFNHGNKGQDS  380

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP-----ANNdswagwddakddgfd  267
              GGG  S+     NS  S SWD+WD K  + KE +P      NND+WAGWDDAKDDG+D
Sbjct  381  PAGGGQYSAG--HHNSYGSSSWDDWDQK--DKKEDTPKGTGSGNNDAWAGWDDAKDDGYD  436

Query  266  dFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            +FYQSA D K +GHNGKSD  W+ GGFL
Sbjct  437  NFYQSASDKKALGHNGKSDATWTGGGFL  464



>ref|XP_010253251.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nelumbo nucifera]
Length=466

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 94/147 (64%), Gaps = 8/147 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+TWGIMKGV A+ASQKVEEYTKE   +WK D+  +N+SE+NGYY +F    KG N 
Sbjct  324  EIGQKTWGIMKGVMAMASQKVEEYTKEGI-TWKADNWQQNDSERNGYYQEFRQESKGWN-  381

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddFYQS  252
                GG SSSGRQFNSV+SGSWD+WD+K N   E     +          DD  DD Y+S
Sbjct  382  --SSGGYSSSGRQFNSVSSGSWDDWDSKDNRKDEPRKGASSQNGDSWTGWDDAKDDSYES  439

Query  251  AHDNKHV----GHNGKSDTKWSDGGFL  183
             +         G NGKSD +W++GGFL
Sbjct  440  FYSGSSSKTLGGQNGKSDAQWTEGGFL  466



>ref|XP_011094839.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Sesamum indicum]
Length=471

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 93/149 (62%), Gaps = 9/149 (6%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV ALASQKVEE+TKE +G WKNDS  + ES+ NGY  +F    +G N 
Sbjct  326  EIGQRTWGIMKGVMALASQKVEEFTKEGSG-WKNDSWQQKESDTNGYSQEFGPESRGWN-  383

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswa------gwddakddgf  270
                G QSSSGRQFNSV+  SWD+WDTK +  +ET                     DDG+
Sbjct  384  -SSAGAQSSSGRQFNSVSHSSWDDWDTKDSRKEETPKGTTSQDEDGWAGWDDAKDDDDGY  442

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            D+ Y S  D K  G+N KSD  W+DGGF+
Sbjct  443  DNSYDSKSDQKTKGYNEKSDANWTDGGFI  471



>gb|EYU41704.1| hypothetical protein MIMGU_mgv1a005908mg [Erythranthe guttata]
Length=465

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 103/147 (70%), Gaps = 12/147 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+TWG+M+GV ALASQKVEE+TKE   +W      R ESE NGYY DFNH+    + 
Sbjct  327  EIGQKTWGLMRGVMALASQKVEEFTKEGGSAWP-----RKESESNGYYQDFNHDSSKGSI  381

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKE----TSPANNdswagwddakddgfdd  264
            +   G QSS+ +QF   +S SWD+W+TK +  +E    T P N DSWAGWDD KDDGFD 
Sbjct  382  NTSTGAQSSTDKQF---SSNSWDDWETKDSKKEEQSKGTKPHNGDSWAGWDDGKDDGFDS  438

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            FYQSA D+K   HNGKSD+ W+DGGFL
Sbjct  439  FYQSASDHKTKDHNGKSDSNWADGGFL  465



>gb|KHG27901.1| ADP-ribosylation factor GTPase-activating AGD7 -like protein 
[Gossypium arboreum]
Length=469

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 101/148 (68%), Gaps = 8/148 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSX-XRNESEQNGYYXDFNHNXKGLN  435
            EIGQ+TWGIMKGV A+ASQKVEEYTK D  +WKND    RN+SE+NGYY +F    KG N
Sbjct  325  EIGQKTWGIMKGVMAIASQKVEEYTK-DGMNWKNDGNWQRNDSEKNGYYQEFKQENKGWN  383

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGN----NTKETSPANNdswagwddakddgfd  267
            S+ GG   S     +NS NS SWD+WDTK N     TK T+  +ND WAGWDD KDDG+D
Sbjct  384  STSGGQTSSGVN--YNSYNSNSWDDWDTKDNRKEHTTKVTASHSNDGWAGWDDPKDDGYD  441

Query  266  dFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             FY  A D   VG NGKSD  W+ GGFL
Sbjct  442  SFYNGASDKNAVGRNGKSDAAWTGGGFL  469



>gb|EYU26574.1| hypothetical protein MIMGU_mgv11b004906mg [Erythranthe guttata]
Length=461

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 99/151 (66%), Gaps = 16/151 (11%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+TWG+MKGV ALASQKVEE+TKE +G        RNE++  GYY +F H+ KG N 
Sbjct  319  EIGQKTWGLMKGVMALASQKVEEFTKEGSGP------QRNENDSTGYYQEFGHDSKGWN-  371

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETS---PANNdswagw----ddakddg  273
                G QSSS RQFNSV+S +WD+WD K +  +++S   PA            DD KDDG
Sbjct  372  -SSTGAQSSSTRQFNSVSSSAWDDWDVKDSRKEDSSKGAPAPPSKGDESWTGWDDGKDDG  430

Query  272  fddFYQSAHDNKHVGHNGKS-DTKWSDGGFL  183
            +D FY SA D   VG+NGKS D+KW+ GGFL
Sbjct  431  YDSFYHSAPDKNSVGYNGKSDDSKWTGGGFL  461



>ref|XP_009804190.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana sylvestris]
Length=454

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 99/147 (67%), Gaps = 10/147 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+ WGIMKGV ALASQKVEEY  E   + K++S  R+E+ QNGYY +FN   KGLN 
Sbjct  314  EIGQKGWGIMKGVLALASQKVEEYA-EGGSNGKDNSWQRSENGQNGYYQEFNKESKGLN-  371

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETS----PANNdswagwddakddgfdd  264
                GG  SSGR  NSV+SGSWD+WD+K +N K+TS     ++ND      D   D   D
Sbjct  372  --SSGGAQSSGRHSNSVSSGSWDDWDSK-DNRKQTSTKGATSSNDDGWAGWDDGKDDGYD  428

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             +QSA  NKH GH GKS++KW+DGGFL
Sbjct  429  NFQSASINKH-GHGGKSESKWTDGGFL  454



>ref|XP_004137765.1| PREDICTED: LOW QUALITY PROTEIN: ADP-ribosylation factor GTPase-activating 
protein AGD7-like [Cucumis sativus]
Length=457

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 96/153 (63%), Gaps = 11/153 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIM+GV A+ASQKVEEY K D  +WKND   RNE+E+NGYY +F H+ KG NS
Sbjct  306  EIGQRTWGIMRGVMAMASQKVEEYAK-DGMNWKNDGWQRNENEKNGYYQEFEHDNKGWNS  364

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdda---------kd  279
            S G G  S SG   NS NS SWD+WDTK N  +ET+   + +    +++         + 
Sbjct  365  SSGTGQSSGSGHHNNSYNSSSWDDWDTKDNRKEETTTKVSGTNNNNNNSNDGWAGWDDQK  424

Query  278  dgfddFYQSAHDNKHVGHNGKS-DTKWSDGGFL  183
            D   D Y  A D K VG NGK+    WS+GGFL
Sbjct  425  DDGYDHYYQASDRKTVGQNGKAGGGTWSEGGFL  457



>ref|XP_004302746.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Fragaria vesca subsp. vesca]
Length=461

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 97/148 (66%), Gaps = 11/148 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE +KE  G+WK D+  R++SEQNGYY DFN    G N 
Sbjct  318  EIGQRTWGIMKGVMAMASQKVEELSKE--GNWKTDNWQRDDSEQNGYYQDFNKQETGWN-  374

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw------ddakddgf  270
            S  G GQSSS    NS NS SWD+WDTK +N KE S                DD KDDGF
Sbjct  375  SSSGRGQSSSSEHINSYNSNSWDDWDTK-DNRKEVSTKGTGGSNSSDGWAGWDDGKDDGF  433

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGF  186
            D  YQSA   K VGHNGKSD+ W+ GGF
Sbjct  434  DSGYQSAP-TKGVGHNGKSDSTWTGGGF  460



>gb|KJB16885.1| hypothetical protein B456_002G255000 [Gossypium raimondii]
 gb|KJB16886.1| hypothetical protein B456_002G255000 [Gossypium raimondii]
 gb|KJB16887.1| hypothetical protein B456_002G255000 [Gossypium raimondii]
Length=469

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 101/148 (68%), Gaps = 8/148 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSX-XRNESEQNGYYXDFNHNXKGLN  435
            EIGQ+TWG+MKGV A+ASQKVEEYTK D  +WKND    RN+SE+NGYY +F    KG N
Sbjct  325  EIGQKTWGMMKGVMAIASQKVEEYTK-DGMNWKNDGNWQRNDSEKNGYYQEFKQENKGWN  383

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGN----NTKETSPANNdswagwddakddgfd  267
            S+ GG   S     +NS NS SWD+WDTK N     TK T+  +ND WAGWDD KDDG+D
Sbjct  384  STSGGQTSSGVN--YNSYNSNSWDDWDTKDNRKEHTTKVTASHSNDGWAGWDDPKDDGYD  441

Query  266  dFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             FY  A D   VG NGKSD  W+ GGFL
Sbjct  442  SFYNGASDKNAVGRNGKSDAAWTGGGFL  469



>ref|XP_008442564.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Cucumis melo]
 ref|XP_008442565.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Cucumis melo]
Length=466

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 95/154 (62%), Gaps = 12/154 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIM+GV A+ASQKVEEY K D  +WKND   RNE+E+NGYY +F H+ KG NS
Sbjct  314  EIGQRTWGIMRGVMAMASQKVEEYAK-DGMNWKNDGWQRNENEKNGYYQEFEHDNKGWNS  372

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwdda----------k  282
            S G G  S SG   NS NS SWD+WDTK N  +ET+   + +    ++           +
Sbjct  373  SSGTGQSSGSGHHNNSYNSSSWDDWDTKDNRKEETTTKVSGTHNNNNNNSNDGWAGWDDQ  432

Query  281  ddgfddFYQSAHDNKHVGHNGKS-DTKWSDGGFL  183
             D   D Y  A D K VG NGK+    WS+GGFL
Sbjct  433  KDDGYDHYYQASDRKTVGQNGKAGGGTWSEGGFL  466



>ref|XP_010037851.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Eucalyptus grandis]
 ref|XP_010037852.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Eucalyptus grandis]
 gb|KCW49632.1| hypothetical protein EUGRSUZ_K03154 [Eucalyptus grandis]
 gb|KCW49633.1| hypothetical protein EUGRSUZ_K03154 [Eucalyptus grandis]
Length=466

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 104/147 (71%), Gaps = 7/147 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEEYTK D  SW N++  RN++E+NGYY +F    KG N+
Sbjct  323  EIGQRTWGIMKGVMAIASQKVEEYTK-DGVSWNNENWQRNDNERNGYYQEFKQENKGWNA  381

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKET----SPANNdswagwddakddgfdd  264
            S GG   SS   Q  + +S SWD+WD K N  +ET    +  NND WAGWDDAK+DG D+
Sbjct  382  SSGGQSSSSGNVQ--TFSSTSWDDWDHKDNKKEETTKGGTSGNNDGWAGWDDAKEDGHDN  439

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            +YQSA +    GHNGKSD  W++GGFL
Sbjct  440  WYQSAPNKGTAGHNGKSDATWTEGGFL  466



>ref|XP_010111497.1| hypothetical protein L484_021322 [Morus notabilis]
 gb|EXC31020.1| hypothetical protein L484_021322 [Morus notabilis]
Length=366

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 103/147 (70%), Gaps = 8/147 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+TWGIMKGV A+ASQKVEEYT+E   + K D+  RN++E NGYY +F  N +    
Sbjct  224  EIGQKTWGIMKGVMAIASQKVEEYTRE-GANLKADNWQRNDNENNGYYQEFKQNKE---W  279

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGN----NTKETSPANNdswagwddakddgfdd  264
            +   GGQSSS   FNS NS SWD+WD K N    +TK  S  NND WAGWDD KDDG+D 
Sbjct  280  NSTSGGQSSSSGHFNSFNSSSWDDWDQKDNRKEESTKGKSSHNNDGWAGWDDPKDDGYDG  339

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            FYQSA + K VGHNGKSD  W+ GGFL
Sbjct  340  FYQSASNTKPVGHNGKSDATWTGGGFL  366



>ref|XP_010253247.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
 ref|XP_010253248.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
 ref|XP_010253249.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
 ref|XP_010253250.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Nelumbo nucifera]
Length=463

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 107/147 (73%), Gaps = 7/147 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+TWGIMKGV A+ASQKVEEYTKE   +WK D+  RN++E+NGYY +F    + +  
Sbjct  320  EIGQKTWGIMKGVMAMASQKVEEYTKE-GINWKADNWQRNDNEKNGYYQEFRQ--ESMGW  376

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKET----SPANNdswagwddakddgfdd  264
            +  GGG SSSGRQFNSV+SGSWD+WD K +   E+    S  N DSWAGWDDAKDD +D+
Sbjct  377  NSSGGGYSSSGRQFNSVSSGSWDDWDNKDDRKDESRKGASSQNGDSWAGWDDAKDDDYDN  436

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            FY  +   +  G NGKSDT+W+ GGFL
Sbjct  437  FYVGSSSKRLEGQNGKSDTRWTKGGFL  463



>ref|XP_003542460.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Glycine max]
Length=481

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 111/180 (62%), Gaps = 40/180 (22%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQK+EEYTK+D  +WKND+  RNE+++NGYY DFN   KG NS
Sbjct  305  EIGQRTWGIMKGVMAMASQKIEEYTKDDP-NWKNDNWQRNENDRNGYYQDFNQENKGWNS  363

Query  431  sgggggqsssGRQFNSVNSGSWDNWD---------TKGNN--------------------  339
            S G    SS   QF + +S SWD+WD          KG++                    
Sbjct  364  SIGREQSSSG--QFKTQSSSSWDDWDHNDSRKEVPAKGSSHSSGGLFSTHNSSSWDDWEH  421

Query  338  --------TKETSPANNdswagwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
                     K ++P NN+ WAGWD+AKDDGFD++Y+ A + K VGHNGKSD  W++GGFL
Sbjct  422  RDSRKEEPAKGSAPHNNEDWAGWDNAKDDGFDNYYEGASNKKGVGHNGKSDGTWTEGGFL  481



>ref|XP_010529843.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Tarenaya hassleriana]
Length=464

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 88/149 (59%), Gaps = 14/149 (9%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE   S+K D    NE+E+N YY DF H  K  NS
Sbjct  324  EIGQRTWGIMKGVMAMASQKVEEFTKEGT-SFKADGFQPNETERNMYYQDFGHGNKAANS  382

Query  431  sgggggqsssGRQFNSVNSGSWDNW------DTKGNNTKETSPANNdswagwddakddgf  270
            S  G           S NS SWD+W      + K    K+ S +N++      +  D   
Sbjct  383  SSSGYYN-------KSNNSNSWDDWGESDNYNKKEAAQKKVSGSNDEDGWAGWEDHDAKD  435

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            D FYQSA D K VGHNGKSDT W+ GGFL
Sbjct  436  DGFYQSAPDKKSVGHNGKSDTAWTGGGFL  464



>gb|KGN58883.1| hypothetical protein Csa_3G734360 [Cucumis sativus]
Length=468

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 95/159 (60%), Gaps = 17/159 (11%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIM+GV A+ASQKVEEY K D  +WKND   RNE+E+NGYY +F H+ KG NS
Sbjct  311  EIGQRTWGIMRGVMAMASQKVEEYAK-DGMNWKNDGWQRNENEKNGYYQEFEHDNKGWNS  369

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddF---  261
            S G G  S SG   NS NS SWD+WDTK N  +ET+   + +    ++  ++   +    
Sbjct  370  SSGTGQSSGSGHHNNSYNSSSWDDWDTKDNRKEETTTKVSGTHNNNNNNNNNNNSNDGWA  429

Query  260  ------------YQSAHDNKHVGHNGKS-DTKWSDGGFL  183
                        Y  A D K VG NGK+    WS+GGFL
Sbjct  430  GWDDQKDDGYDHYYQASDRKTVGQNGKAGGGTWSEGGFL  468



>ref|XP_004167174.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Cucumis sativus]
Length=471

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 95/159 (60%), Gaps = 17/159 (11%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIM+GV A+ASQKVEEY K D  +WKND   RNE+E+NGYY +F H+ KG NS
Sbjct  314  EIGQRTWGIMRGVMAMASQKVEEYAK-DGMNWKNDGWQRNENEKNGYYQEFEHDNKGWNS  372

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddF---  261
            S G G  S SG   NS NS SWD+WDTK N  +ET+   + +    ++  ++   +    
Sbjct  373  SSGTGQSSGSGHHNNSYNSSSWDDWDTKDNRKEETTTKVSGTHNNNNNNNNNNNSNDGWA  432

Query  260  ------------YQSAHDNKHVGHNGKS-DTKWSDGGFL  183
                        Y  A D K VG NGK+    WS+GGFL
Sbjct  433  GWDDQKDDGYDHYYQASDRKTVGQNGKAGGGTWSEGGFL  471



>ref|XP_007144453.1| hypothetical protein PHAVU_007G157400g [Phaseolus vulgaris]
 gb|ESW16447.1| hypothetical protein PHAVU_007G157400g [Phaseolus vulgaris]
Length=482

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 106/179 (59%), Gaps = 37/179 (21%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQK+EEYT++D  +WK D+  RN+S++NGYY DFN   KGLNS
Sbjct  305  EIGQRTWGIMKGVMAMASQKIEEYTRDDP-NWKTDNWQRNDSDRNGYYQDFNQQNKGLNS  363

Query  431  sgggggqsssGR--------------------------------QFNSVNSGSWDNWD--  354
            S G    SS                                   Q ++ NS SWD+W+  
Sbjct  364  SPGRDQSSSGQYKTHSSSSLDDWDHRDSRKEVPAKGTAPYSSGGQSSTYNSSSWDDWEHT  423

Query  353  --TKGNNTKETSPANNdswagwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
               K    K  +P NND WAGWD+AKDDGFD FYQ A + K VGHNGKSD  W++GGFL
Sbjct  424  DSRKQEPAKAAAPHNNDDWAGWDNAKDDGFDHFYQDASNKKGVGHNGKSDGTWTEGGFL  482



>ref|XP_007205139.1| hypothetical protein PRUPE_ppa005179mg [Prunus persica]
 gb|EMJ06338.1| hypothetical protein PRUPE_ppa005179mg [Prunus persica]
Length=473

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 92/146 (63%), Gaps = 8/146 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSX-XRNESEQNGYYXDFNHNXKGLN  435
            EIG RTWGIMKGV A+ASQKVEEYTK D  +WK D+   RN+SEQNGYY +F    K  N
Sbjct  331  EIGHRTWGIMKGVMAMASQKVEEYTK-DGTAWKADNNWQRNDSEQNGYYQEFKQENKQWN  389

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP---ANNdswagwddakddgfdd  264
            SSGGG   S +   FNS  S SWD+WD K N  +ET+    +N+       D   D   D
Sbjct  390  SSGGGQSSSGN---FNSYGSSSWDDWDQKDNRKQETTKGTGSNSSDGWAGWDDGKDDGFD  446

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGF  186
             YQSA  +K  GHNGKSD+ W+ GGF
Sbjct  447  HYQSASVSKAAGHNGKSDSTWTGGGF  472



>gb|KHN05918.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Glycine 
soja]
Length=301

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 107/178 (60%), Gaps = 36/178 (20%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQK+EEYTK+D  +WKND+  RNE++ NGYY DFN   KG NS
Sbjct  125  EIGQRTWGIMKGVMAMASQKIEEYTKDDP-NWKNDNWQRNENDTNGYYQDFNQEKKGWNS  183

Query  431  sgggggqsssGR-------------------------------QFNSVNSGSWDNWDTKG  345
            S G    SS                                  QF++ NS SWD+W+ K 
Sbjct  184  STGREQSSSGEYKTQSSSSWDDWDHKDSRKEEPAKGSTHSSGGQFSTYNSSSWDDWEHKD  243

Query  344  NNTKE----TSPANNdswagwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            +  +E    ++P NND WAGWD+AKDDGFD+ Y+ A + K VGH GKSD  W++ GFL
Sbjct  244  SRKEEPAKGSAPHNNDDWAGWDNAKDDGFDNIYEGASNKKGVGHKGKSDGTWTEEGFL  301



>ref|XP_007027080.1| ARF-GAP domain 7 isoform 1 [Theobroma cacao]
 gb|EOY07582.1| ARF-GAP domain 7 isoform 1 [Theobroma cacao]
Length=467

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEEYTK D  +WKN++  RN+SE+NGYY +F    KG NS
Sbjct  324  EIGQRTWGIMKGVMAIASQKVEEYTK-DGMNWKNENWQRNDSEKNGYYQEFKQENKGWNS  382

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGN----NTKETSPANNdswagwddakddgfdd  264
            + GG   S      NS +S SWD+WD+K N    +TK T+  +ND WAGWDDAKDDG+D 
Sbjct  383  TSGGQSSSGGSY--NSYSSSSWDDWDSKDNRKKDSTKVTASQSNDGWAGWDDAKDDGYDH  440

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            FY  A D K VGHNGKSD  W+ GGFL
Sbjct  441  FYSGASDKKTVGHNGKSDATWTGGGFL  467



>ref|XP_008241285.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Prunus mume]
 ref|XP_008241292.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Prunus mume]
Length=473

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 92/146 (63%), Gaps = 8/146 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSX-XRNESEQNGYYXDFNHNXKGLN  435
            EIG RTWGIMKGV A+ASQKVEEYTK D  +WK D+   RN+SEQNGYY +F    K  +
Sbjct  331  EIGHRTWGIMKGVMAMASQKVEEYTK-DGTTWKADNNWQRNDSEQNGYYQEFKQENKQWD  389

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP---ANNdswagwddakddgfdd  264
            SSGGG   S +   FNS  S SWD+WD K N  +ET+    +N+       D   D   D
Sbjct  390  SSGGGQSSSGN---FNSHGSSSWDDWDQKDNRKQETTKGTGSNSSDGWAGWDDAKDDGFD  446

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGF  186
             YQSA  +K  GHNGKSD+ W+ GGF
Sbjct  447  HYQSASVSKAAGHNGKSDSSWTGGGF  472



>ref|XP_006429044.1| hypothetical protein CICLE_v10013094mg [Citrus clementina]
 ref|XP_006429045.1| hypothetical protein CICLE_v10013094mg [Citrus clementina]
 gb|ESR42284.1| hypothetical protein CICLE_v10013094mg [Citrus clementina]
 gb|ESR42285.1| hypothetical protein CICLE_v10013094mg [Citrus clementina]
Length=132

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 97/139 (70%), Gaps = 12/139 (9%)
 Frame = -3

Query  584  MKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNssgggggqss  405
            MKGV A+ASQKVEEYTKE    W ND+  RNESE NGYY +FNH  KG +S  GGG  S+
Sbjct  1    MKGVMAMASQKVEEYTKE---GWNNDNWQRNESESNGYYQEFNHGNKGQDSPAGGGQYSA  57

Query  404  sGRQFNSVNSGSWDNWDTKGNNTKETSP-----ANNdswagwddakddgfddFYQSAHDN  240
                 NS  S SWD+WD K  + KE +P      NND+WAGWDDAKDDG+D+FYQSA D 
Sbjct  58   G--HHNSYGSSSWDDWDQK--DKKEDTPKGTGSGNNDAWAGWDDAKDDGYDNFYQSASDK  113

Query  239  KHVGHNGKSDTKWSDGGFL  183
            K +GHNGKSD  W+ GGFL
Sbjct  114  KALGHNGKSDATWTGGGFL  132



>ref|XP_004249530.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Solanum lycopersicum]
Length=459

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 95/146 (65%), Gaps = 8/146 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+ WGIMKGV ALASQKVEE+ +  N   ++DS  R+E+E+NG+Y + +   KG N 
Sbjct  319  EIGQKGWGIMKGVLALASQKVEEFAEGPNP--RDDSWQRSENERNGHYKESSQASKGWN-  375

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGN---NTKETSPANNdswagwddakddgfddF  261
                GG  SSGRQ N+V+S SWD+WD+K N   N    + ++ND      D   D   D 
Sbjct  376  --SSGGAQSSGRQANAVSSASWDDWDSKDNKKENPTGGATSSNDDGWAGWDDGKDDGFDN  433

Query  260  YQSAHDNKHVGHNGKSDTKWSDGGFL  183
            +Q A +NKHV H GKS++KW+DGGFL
Sbjct  434  FQRAPNNKHVAHGGKSESKWTDGGFL  459



>ref|XP_002527750.1| arf gtpase-activating protein, putative [Ricinus communis]
 gb|EEF34663.1| arf gtpase-activating protein, putative [Ricinus communis]
Length=457

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 95/149 (64%), Gaps = 14/149 (9%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFN-HNXKGLN  435
            EIGQ+TWGIMKGV A+ASQKVEEY KE  G W+     RNESE NGYY +FN    KG N
Sbjct  317  EIGQKTWGIMKGVMAIASQKVEEYAKE--GGWQ-----RNESESNGYYQEFNKQENKGWN  369

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKG----NNTKETSPANNds-wagwddakddgf  270
            SS  GG  SSSG  +NS +S SWD+WD K     ++ K T   NND      D   +   
Sbjct  370  SSSAGGQSSSSG-HYNSYSSNSWDDWDQKDTRKEDSIKVTGSHNNDGWAGWDDAKDEGFD  428

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            D+FYQSA D K VGHNGKSD  W+ GGFL
Sbjct  429  DNFYQSAPDKKAVGHNGKSDATWTGGGFL  457



>ref|XP_006339030.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Solanum tuberosum]
Length=459

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 94/146 (64%), Gaps = 8/146 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+ WGIMKGV ALASQKVEE+ +  N   ++DS  ++E+E+N +Y + +   KG NS
Sbjct  319  EIGQKGWGIMKGVLALASQKVEEFAEGPNP--RDDSWQQSENERNSHYKESSQASKGWNS  376

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGN---NTKETSPANNdswagwddakddgfddF  261
            SGG        RQ NSV+S SWD+WD+K N   N    + ++ND      D   D   D 
Sbjct  377  SGGAQSSG---RQANSVSSASWDDWDSKDNRKENPTGGATSSNDDGWAGWDDGKDDGFDN  433

Query  260  YQSAHDNKHVGHNGKSDTKWSDGGFL  183
            +QSA +NKHV H GKS++KW+DGGFL
Sbjct  434  FQSAPNNKHVAHGGKSESKWTDGGFL  459



>ref|XP_002881515.1| hypothetical protein ARALYDRAFT_482750 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57774.1| hypothetical protein ARALYDRAFT_482750 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 90/150 (60%), Gaps = 11/150 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N++E NGYY +     K  NS
Sbjct  311  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTWNQ----QNKTEGNGYYQNSGIGNKTANS  366

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw-------ddakddg  273
            S GG   SSSG   +  NS SWD+W  + N  KE +P  + S           DD     
Sbjct  367  SFGGSQSSSSGHNNSYRNSNSWDDWGEENNTKKEPAPKVSTSNDDDDGGWAGWDDNDAKD  426

Query  272  fddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             D +YQSA D K VGHNGKSDT W+ GGFL
Sbjct  427  DDFYYQSASDKKSVGHNGKSDTAWTGGGFL  456



>ref|NP_181291.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
 ref|NP_001031503.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
 sp|O80925.1|AGD7_ARATH RecName: Full=ADP-ribosylation factor GTPase-activating protein 
AGD7; Short=ARF GAP AGD7; AltName: Full=Protein ARF-GAP DOMAIN 
7; Short=AtAGD7; AltName: Full=Protein PDE1 SUPPRESSOR 
1 [Arabidopsis thaliana]
 gb|AAL32010.1|AF436828_1 At2g37550/F13M22.5 [Arabidopsis thaliana]
 gb|AAC23626.1| putative ADP ribosylation factor 1 GTPase activating protein 
[Arabidopsis thaliana]
 dbj|BAA75744.1| Asp1 [Arabidopsis thaliana]
 gb|AAK59488.1| putative ADP ribosylation factor 1 GTPase activating protein 
[Arabidopsis thaliana]
 gb|AAL34251.1| putative ADP ribosylation factor 1 GTPase activating protein 
[Arabidopsis thaliana]
 gb|AAM65362.1| At2g37550/F13M22.5 [Arabidopsis thaliana]
 gb|AEC09414.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
 gb|AEC09415.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Arabidopsis 
thaliana]
Length=456

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 90/150 (60%), Gaps = 11/150 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N++E NGYY +     K  NS
Sbjct  311  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTWNQ----QNKTEGNGYYQNSGIGNKTANS  366

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw-------ddakddg  273
            S GG   SSSG   +  NS SWD+W  + N+ KE +P  + S           DD     
Sbjct  367  SFGGSQSSSSGHNNSYRNSNSWDDWGEENNSKKEAAPKVSTSNDDDDGGWAGWDDNDAKD  426

Query  272  fddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             D +YQ A D K VGHNGKSDT W+ GGFL
Sbjct  427  DDFYYQPASDKKSVGHNGKSDTAWTGGGFL  456



>ref|XP_006403662.1| hypothetical protein EUTSA_v10010333mg [Eutrema salsugineum]
 gb|ESQ45115.1| hypothetical protein EUTSA_v10010333mg [Eutrema salsugineum]
Length=476

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 89/156 (57%), Gaps = 17/156 (11%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+A+QKVEEYTKE   SW      +NE+E NGYY +F +  K  NS
Sbjct  325  EIGQRTWGIMKGVMAIATQKVEEYTKEGTTSW----NQQNENESNGYYQNFGNGNKAANS  380

Query  431  sg---ggggqsssGRQFNSVNSGSWDNWDTKGNNTKE-----TSPANNdswagwddakdd  276
            S    G    SSSG   NS  S SWD+W    +  KE      S A+ND          D
Sbjct  381  SVGGGGRQESSSSGHDNNSHKSNSWDDWGEDESKKKEAVAPKASSASNDDDGWTGWDDHD  440

Query  275  gfddF-----YQSAHDNKHVGHNGKSDTKWSDGGFL  183
              DD      YQSA D K VGHNGKSDT W+ GGFL
Sbjct  441  PKDDDGFDGYYQSAGDKKSVGHNGKSDTAWTGGGFL  476



>ref|XP_003537172.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Glycine max]
Length=479

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 108/178 (61%), Gaps = 37/178 (21%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQK+EEYTK+D  +WKND+  RNE++ NGYY DFN   KG NS
Sbjct  304  EIGQRTWGIMKGVMAMASQKIEEYTKDDP-NWKNDNWQRNENDTNGYYQDFNREKKGWNS  362

Query  431  sg-------------------------------ggggqsssGRQFNSVNSGSWDNWDTKG  345
            S                                  G   SSG QF++ NS SWD+W+ K 
Sbjct  363  STGREQSSSGEYKTESSSSWDDWDHKDSRKEEPAKGSTHSSGGQFSTYNSSSWDDWEHKD  422

Query  344  NNTKE----TSPANNdswagwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            +  +E    ++P NND WAGWD+AKDDGFD+ Y+ A + K VGH GKSD  W++ GFL
Sbjct  423  SRKEEPAKGSAPHNNDDWAGWDNAKDDGFDNIYEGA-NKKGVGHKGKSDGTWTEEGFL  479



>ref|XP_009621199.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Nicotiana tomentosiformis]
Length=457

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 98/147 (67%), Gaps = 9/147 (6%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+ WGIMKGV ALASQKVEEY  E   + K++S  RNE+ QNGYY +F+   KG NS
Sbjct  316  EIGQKGWGIMKGVLALASQKVEEYA-EGGPNGKDNSWQRNENGQNGYYQEFSKESKGWNS  374

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP----ANNdswagwddakddgfdd  264
            SGG           +SV+SGSWD+WD+K +N K+TS     ++ND      D   D   D
Sbjct  375  SGGAQSSGRHS---SSVSSGSWDDWDSK-DNRKQTSTKGATSSNDDGWAGWDDGKDDGYD  430

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             +QSA +NKHVGH GKS++KW+DGGFL
Sbjct  431  NFQSASNNKHVGHGGKSESKWTDGGFL  457



>dbj|BAE71192.1| putative Asp1 [Trifolium pratense]
 dbj|BAE71286.1| putative Asp1 [Trifolium pratense]
Length=477

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 106/180 (59%), Gaps = 38/180 (21%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWG+MKGV ALASQKVEEYTKE++ S  N+   RNE+++NGYY DFN   KG+NS
Sbjct  299  EIGQRTWGLMKGVMALASQKVEEYTKENSNSTTNN-WQRNENDRNGYYQDFNQENKGINS  357

Query  431  sgggggqsssGRQFNSVNS--------------------------------GSWDNWDTK  348
            + G     S   + NS NS                                 SWD+WD K
Sbjct  358  TTGREQSLSGQFKTNSSNSWDDWDHKNSWKEGQTKGSTPYSSGGQSGTHNPSSWDDWDNK  417

Query  347  GNNTKE----TSPANNdsw-agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             +  +E    ++P NND+  AGWD+AKDDGFD+FY  A + K VGHNGKSD  W+ GGFL
Sbjct  418  DSRKEEPAKGSAPHNNDAGWAGWDNAKDDGFDNFYDGASNKKTVGHNGKSDDAWTGGGFL  477



>ref|XP_006410942.1| hypothetical protein EUTSA_v10016645mg [Eutrema salsugineum]
 gb|ESQ52395.1| hypothetical protein EUTSA_v10016645mg [Eutrema salsugineum]
Length=453

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 94/154 (61%), Gaps = 18/154 (12%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  SW      +N++E NGYY +   N    + 
Sbjct  307  EIGQRTWGIMKGVMAIASQKVEEFTKEETSSW----NQQNKNEGNGYYQNKTANP---SL  359

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTK-----ETSPANNds------wagwdda  285
             G     SSSG Q N  NS SWD+W  + NNTK     + S +N+D           D  
Sbjct  360  GGSHSSSSSSGHQNNYRNSNSWDDWGEENNNTKKEAAQKVSTSNDDDGGWAGWDDDNDTK  419

Query  284  kddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             DDG+D +YQSA D K VGHNGKSDT W+ GGFL
Sbjct  420  DDDGYDGYYQSAGDKKSVGHNGKSDTAWTGGGFL  453



>ref|XP_009374672.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Pyrus x bretschneideri]
 ref|XP_009374673.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Pyrus x bretschneideri]
Length=471

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 100/147 (68%), Gaps = 9/147 (6%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSX-XRNESEQNGYYXDFNHNXKGLN  435
            EIGQRTWGIMKGV A+ASQKVEEYTK D  +WK ++   RN+SEQNGYY +F    K  N
Sbjct  328  EIGQRTWGIMKGVMAMASQKVEEYTK-DGTNWKAENNWQRNDSEQNGYYQEFKQENKEWN  386

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA----NNdswagwddakddgfd  267
            SS  GG  SS     NS  S SWD+WD K    +ET+      +ND WAGWDD KDDG+D
Sbjct  387  SSSVGGQSSSGN--LNSYGSSSWDDWDQKDTRKQETTKGMGSNSNDGWAGWDDGKDDGYD  444

Query  266  dFYQSAHDNKHVGHNGKSDTKWSDGGF  186
            + YQSA  +K  GHNGKSD+ W+ GGF
Sbjct  445  NAYQSASISK-AGHNGKSDSAWTGGGF  470



>ref|XP_008366719.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Malus domestica]
 ref|XP_008366720.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Malus domestica]
Length=473

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 94/147 (64%), Gaps = 9/147 (6%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSX-XRNESEQNGYYXDFNHNXKGLN  435
            EIGQRTWGIMKGV A+ASQKVEEYTK D  +WK ++   RN+SEQNGYY +F    K  N
Sbjct  330  EIGQRTWGIMKGVMAMASQKVEEYTK-DGTNWKAENNWQRNDSEQNGYYQEFKQENKEWN  388

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw----ddakddgfd  267
            SS  GG  SS     NS  S SWD+WD K    +ET+     +        DD KDDG+D
Sbjct  389  SSSIGGQSSSGN--LNSYGSSSWDDWDQKDTRKQETTKGTGSNSNDGWAGWDDGKDDGYD  446

Query  266  dFYQSAHDNKHVGHNGKSDTKWSDGGF  186
            + YQSA  +K  GHNGKSD+ W+ GGF
Sbjct  447  NAYQSASISK-AGHNGKSDSAWTGGGF  472



>ref|XP_004495006.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like isoform X1 [Cicer arietinum]
Length=482

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 106/182 (58%), Gaps = 42/182 (23%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWG+MKGV ALASQKVEEYTKE N +WK DS  RNE+++NGYY DFN   KG +S
Sbjct  304  EIGHRTWGLMKGVMALASQKVEEYTKE-NSNWKADSWQRNENDRNGYYQDFNQETKGGSS  362

Query  431  sgggggqsssGRQFNSVNSGSWDNWD---------TKGNN--------------------  339
            S G    SS   QF + +S SWD+WD         TKG+                     
Sbjct  363  STGREQSSSG--QFKTHSSNSWDDWDQKDSWKEEPTKGSTRYSSGVQVGTHNPSSWDDWD  420

Query  338  ---------TKETSPANNdsw-agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGG  189
                      K ++P NND+  AGWD+AKDDGFD+FY+ A + K  G NGKSD  W+ GG
Sbjct  421  HKDSRKEEPAKGSAPHNNDAGWAGWDNAKDDGFDNFYEGASNKKSAGRNGKSDDAWTGGG  480

Query  188  FL  183
            FL
Sbjct  481  FL  482



>ref|XP_004253319.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Solanum lycopersicum]
Length=437

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 80/150 (53%), Gaps = 30/150 (20%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N++E NGY     HN      
Sbjct  311  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTWNQ----QNKTEGNGYSSSSGHNN-----  361

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw-------ddakddg  273
                          +  NS SWD+W  + N+ KE +P  + S           DD     
Sbjct  362  --------------SYRNSNSWDDWGEENNSKKEAAPKVSTSNDDDDGGWAGWDDNDAKD  407

Query  272  fddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             D +YQ A D K VGHNGKSDT W+ GGFL
Sbjct  408  DDFYYQPASDKKSVGHNGKSDTAWTGGGFL  437



>ref|XP_010427029.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Camelina sativa]
Length=468

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 87/154 (56%), Gaps = 15/154 (10%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV A+A+QKV EYTKE   SW   S    ESE NGYY +F +  K  N 
Sbjct  319  EIGHRTWGIMKGVMAMATQKVGEYTKEGTTSWNQQS----ESESNGYYQNFGNGNKAANP  374

Query  431  -sgggggqsssGRQF-NSVNSGSWDNW-DTKGNNTKETSPANNdswagwddakddgfddF  261
              GGG  QSSS  Q+ NS  S SWD+W + +   T+  +P  + +    D        D 
Sbjct  375  SVGGGRSQSSSSGQYNNSQKSNSWDSWGENENRKTEAAAPKGSSASNDDDGWTGWDDHDA  434

Query  260  --------YQSAHDNKHVGHNGKSDTKWSDGGFL  183
                    YQSA D K VGHNGKSDT W+ GGFL
Sbjct  435  KDDGFDGHYQSAGDQKSVGHNGKSDTAWTGGGFL  468



>ref|XP_010504141.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Camelina sativa]
Length=467

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 87/154 (56%), Gaps = 15/154 (10%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV A+A+QKV EYTKE   SW   S    ESE NGYY +F +  K  N 
Sbjct  318  EIGHRTWGIMKGVMAMATQKVGEYTKEGTTSWNQQS----ESESNGYYQNFGNGNKAANP  373

Query  431  -sgggggqsssGRQF-NSVNSGSWDNW-DTKGNNTKETSPANNdswagwddakddgfddF  261
              GGG  QSSS  Q+ NS  S SWD+W + +   T+  +P  + +    D        D 
Sbjct  374  SVGGGRSQSSSSGQYNNSQKSNSWDSWGENENRKTEAAAPKGSSASNDDDGWTGWDDHDA  433

Query  260  --------YQSAHDNKHVGHNGKSDTKWSDGGFL  183
                    YQSA D K VGHNGKSDT W+ GGFL
Sbjct  434  KDDGFDGHYQSAGDQKSVGHNGKSDTAWTGGGFL  467



>ref|XP_010515873.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Camelina sativa]
Length=467

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 87/154 (56%), Gaps = 15/154 (10%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV A+A+QKV EYTKE   SW   S    ESE NGYY +F +  K  N 
Sbjct  318  EIGHRTWGIMKGVMAMATQKVGEYTKEGTTSWNQQS----ESESNGYYQNFGNGNKAANP  373

Query  431  -sgggggqsssGRQF-NSVNSGSWDNW-DTKGNNTKETSPANNdswagwddakddgfddF  261
              GGG  QSSS  Q+ NS  S SWD+W + +   T+  +P  + +    D        D 
Sbjct  374  SVGGGRSQSSSSGQYNNSQKSNSWDSWGENENKKTEAAAPKGSSASNDDDGWTGWDDHDA  433

Query  260  --------YQSAHDNKHVGHNGKSDTKWSDGGFL  183
                    YQSA D K VGHNGKSDT W+ GGFL
Sbjct  434  KDDGFDGHYQSAGDQKSVGHNGKSDTAWTGGGFL  467



>ref|NP_190939.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
 ref|NP_001030854.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
 sp|Q9M354.1|AGD6_ARATH RecName: Full=Probable ADP-ribosylation factor GTPase-activating 
protein AGD6; Short=ARF GAP AGD6; AltName: Full=Protein 
ARF-GAP DOMAIN 6; Short=AtAGD6; AltName: Full=Protein ZIGA2 
[Arabidopsis thaliana]
 emb|CAB88333.1| putative protein [Arabidopsis thaliana]
 gb|ABO45696.1| At3g53710 [Arabidopsis thaliana]
 gb|AEE79130.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
 gb|AEE79131.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Arabidopsis thaliana]
Length=459

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 86/155 (55%), Gaps = 16/155 (10%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV A+A+QKVEE+TKE + SW   S    E+E NGYY +F +  K  NS
Sbjct  309  EIGHRTWGIMKGVMAMATQKVEEFTKEGSTSWNQQS----ENEGNGYYQNFGNGNKAANS  364

Query  431  sg---ggggqsssGRQFNSVNSGSWDNW-DTKGNNTKETSPANNdswagwddakddgfdd  264
            S         S+SG   NS NS SWD+W + +   T+  +P  + +    D        D
Sbjct  365  SVGGGRPQSSSTSGHYNNSQNSNSWDSWGENENKKTEAVAPKGSSASNDDDGWTGWDDHD  424

Query  263  F--------YQSAHDNKHVGHNGKSDTKWSDGGFL  183
                     YQSA D K  GHNGKSDT W+ GGFL
Sbjct  425  AKDDGFDGHYQSAGDKKSAGHNGKSDTAWTGGGFL  459



>gb|KJB76702.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76703.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76704.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76705.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76706.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
 gb|KJB76707.1| hypothetical protein B456_012G102200 [Gossypium raimondii]
Length=462

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 100/147 (68%), Gaps = 7/147 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGI+KGV ALASQKVEEY K D  +WKND+  +NESE+NG++   N   KG NS
Sbjct  319  EIGHRTWGIVKGVMALASQKVEEYAK-DGMNWKNDNWPQNESEKNGHHQGSNQGNKGWNS  377

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGN----NTKETSPANNdswagwddakddgfdd  264
            + GG   S      NS  S SWD+WDTK N     T+ T+  +ND+WAGWD+AKDDG+D+
Sbjct  378  TSGGQPSSGGNS--NSRTSSSWDDWDTKDNRKEGTTEVTTSHSNDAWAGWDEAKDDGYDN  435

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            FY    + + VG NGKSD  WS GGFL
Sbjct  436  FYNGTSNKRAVGDNGKSDVTWSGGGFL  462



>ref|XP_009338772.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Pyrus x bretschneideri]
Length=471

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 86/145 (59%), Gaps = 5/145 (3%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV ALASQKVEEYTK+       ++  RN SEQNGYY +F    K  NS
Sbjct  328  EIGQRTWGIMKGVMALASQKVEEYTKDGTNGKAENNWQRNGSEQNGYYQEFKQENKEWNS  387

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddFYQS  252
            S  GG  SS     NS  S SWD+WD K    +ET+     +        DDG DD Y +
Sbjct  388  SSVGGQSSSGN--LNSYGSSSWDDWDQKDTRKQETTKGTGSNSNDGWAGWDDGKDDGYDN  445

Query  251  AHDNKHV---GHNGKSDTKWSDGGF  186
            A+ +  +   GHNGKSD+ W+ GGF
Sbjct  446  AYRSASISKAGHNGKSDSAWTGGGF  470



>ref|XP_008345448.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Malus domestica]
Length=471

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 90/146 (62%), Gaps = 7/146 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EI QRTWGIMKGV ALASQKVEEYTK+       ++  RN+SEQNGYY +F    K  NS
Sbjct  328  EIXQRTWGIMKGVMALASQKVEEYTKDGTNGKAENNWQRNDSEQNGYYQEFKQENKEWNS  387

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw----ddakddgfdd  264
            S  GG  SS     NS  S SWD+WD K    +ET+     +        DD KDDG+D+
Sbjct  388  SSVGGQSSSGN--LNSYGSSSWDDWDQKDTRKQETTKGTGSNSTDGWAGWDDGKDDGYDN  445

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGF  186
             YQSA  +K  GHNGKSD+ W+ GGF
Sbjct  446  AYQSASISK-AGHNGKSDSAWTGGGF  470



>ref|XP_006291063.1| hypothetical protein CARUB_v10017178mg [Capsella rubella]
 gb|EOA23961.1| hypothetical protein CARUB_v10017178mg [Capsella rubella]
Length=468

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 89/154 (58%), Gaps = 15/154 (10%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDF-NHNXKGLN  435
            EIG RTWGIMKGV A+A+QKVEEYTKE   SW   S    E+E NGYY +F N N   ++
Sbjct  319  EIGHRTWGIMKGVMAMATQKVEEYTKEGTTSWNQQS----ENESNGYYQNFGNGNKAAIS  374

Query  434  ssgggggqsssGRQF-NSVNSGSWDNW-DTKGNNTKETSPANNdswagwddakddgfddF  261
            S GGG  QSSS   + NS  S SWD+W + +   T+  +P  + +    D        D 
Sbjct  375  SVGGGRSQSSSSGHYDNSQKSNSWDSWGENENRKTEAAAPKGSLASNDDDGWTGWDDHDA  434

Query  260  --------YQSAHDNKHVGHNGKSDTKWSDGGFL  183
                    YQSA D K VGHNGKSD+ W+ GGFL
Sbjct  435  KDDGFDGHYQSAGDKKSVGHNGKSDSAWTGGGFL  468



>ref|XP_011019883.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Populus euphratica]
Length=468

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 88/149 (59%), Gaps = 12/149 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFN-HNXKGLN  435
            EIGQRTWGIMKGV A+ASQKVEEYTKE   +   D+  R++++ NGYY +FN    KG N
Sbjct  326  EIGQRTWGIMKGVMAIASQKVEEYTKEGRNT---DNWQRSDNQSNGYYQEFNKQENKGWN  382

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKET-----SPANNdswagwddakddgf  270
            SS GG   S      NS  S SWD+WD K N T+++     S +N+      D   D   
Sbjct  383  SSSGGQYSSG---HHNSYGSSSWDDWDQKDNKTEDSIKSTASHSNDGWAGWDDAKDDGYD  439

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            D+ YQS    K   HNGKSD  W+ GGFL
Sbjct  440  DNIYQSVPSAKSASHNGKSDASWTGGGFL  468



>ref|XP_002877936.1| hypothetical protein ARALYDRAFT_485760 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54195.1| hypothetical protein ARALYDRAFT_485760 [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 86/154 (56%), Gaps = 15/154 (10%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV A+A+QKVEE+TKE   SW   S    ESE NGYY +F +  K  NS
Sbjct  311  EIGHRTWGIMKGVMAMATQKVEEFTKEGTTSWNQQS----ESEGNGYYQNFGNGNKAANS  366

Query  431  sgggggqsssGRQF--NSVNSGSWDNW-DTKGNNTKETSPANNdswagwddakddgfddF  261
            S GGG   SS      NS NS SWD+W + +   T+  +P  + +    D        D 
Sbjct  367  SVGGGRSQSSSSGHYNNSQNSNSWDSWGENENKKTEAAAPKGSSASNDDDGWTGWDDHDA  426

Query  260  --------YQSAHDNKHVGHNGKSDTKWSDGGFL  183
                    YQSA D K VGHN KSD+ W+ GGFL
Sbjct  427  KDDGFDGHYQSAGDKKSVGHNEKSDSAWTGGGFL  460



>gb|KEH42388.1| ADP-ribosylation factor GTPase-activating protein AGD10 [Medicago 
truncatula]
Length=481

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 103/181 (57%), Gaps = 39/181 (22%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWG+MKGV ALASQKVEEYTKE++ S  N+   RNES++NGYY DFN   KG NS
Sbjct  302  EIGQRTWGLMKGVMALASQKVEEYTKENSNSTTNN-WQRNESDRNGYYQDFNQGNKGGNS  360

Query  431  sgggggqsssGRQFNSVNS---------------------------------GSWDNWDT  351
            S G    SS   +  S NS                                  SWD+WD 
Sbjct  361  STGREQSSSGQYKTQSSNSWDDWGQKDSWKGEPANKGSTPYSSGGQSGTHNPSSWDDWDH  420

Query  350  KGNN----TKETSPANNdsw-agwddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGF  186
            K +      K ++P NND   AGWD+AKDDGFD+FY+ A + K  GHNGKSD  W+ GGF
Sbjct  421  KDSRKEEPAKSSAPHNNDVGWAGWDNAKDDGFDNFYEGASNKKAAGHNGKSDDAWTGGGF  480

Query  185  L  183
            L
Sbjct  481  L  481



>ref|XP_010937673.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Elaeis guineensis]
Length=464

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 82/143 (57%), Gaps = 9/143 (6%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            E+GQ+TWGIMKGV A+ASQKVEEYTKE   +WK D   R ESEQNGYY DF  + KG N 
Sbjct  331  EVGQKTWGIMKGVMAMASQKVEEYTKE-GINWKGDDWQRKESEQNGYYQDFGQD-KGWN-  387

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddFYQS  252
                  + +S + +NSV+  SWD+WD K    +      N       D   D   D Y  
Sbjct  388  ----SSEGNSFKHYNSVS--SWDDWDEKERKQEPGKGTQNSESWAGWDDVKDDGYDNYNY  441

Query  251  AHDNKHVGHNGKSDTKWSDGGFL  183
            +  NK V  NGKS + W++ GFL
Sbjct  442  SPSNKGVNQNGKSGSLWTESGFL  464



>ref|XP_008812043.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6, partial [Phoenix dactylifera]
Length=182

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 83/143 (58%), Gaps = 9/143 (6%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            E+GQ+TWGIMKGV A+ASQKV+EYTKE   +W  D   R ESE+NG+Y DF  + KG N 
Sbjct  49   EVGQKTWGIMKGVMAMASQKVDEYTKE-GINWNGDDWQRKESEKNGHYQDFGQD-KGFN-  105

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddFYQS  252
                  + +S +++NSV+  SWD+WD K    +      N       D   D   D Y  
Sbjct  106  ----SSEGNSFKRYNSVS--SWDDWDEKEKKQEPEKGTQNSESWAGWDDVKDDGYDNYSY  159

Query  251  AHDNKHVGHNGKSDTKWSDGGFL  183
            +  NK V HNGKS + W++ GFL
Sbjct  160  SPSNKGVNHNGKSGSLWTESGFL  182



>ref|XP_009116065.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Brassica rapa]
Length=454

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 82/148 (55%), Gaps = 8/148 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKV EYTKE  G+       RNESE NGYY +F +  K  N 
Sbjct  306  EIGQRTWGIMKGVMAIASQKVGEYTKE--GTTTTSWNQRNESESNGYYQNFGNGNKAANP  363

Query  431  sgggggqsssGRQFNSV--NSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddF-  261
            S  G G  SS   + +    S SWD+W    +  KE   +   S +  DD      D   
Sbjct  364  SVEGKGSQSSSSGYYNNSHKSNSWDDWGENESKKKEAVASKGSSASNDDDGWTGWDDPKD  423

Query  260  ---YQSAHDNKHVGHNGKSDTKWSDGGF  186
               YQSA D K  GHNGKSDT W+ GGF
Sbjct  424  DVYYQSAGDKKSAGHNGKSDTAWTGGGF  451



>ref|XP_010505344.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Camelina sativa]
Length=459

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 88/149 (59%), Gaps = 10/149 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N++E NG Y +     K  NS
Sbjct  315  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTWNQ----QNKNEGNGLYQNSGFGNKTANS  370

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddF---  261
            S GG   SSSG+  +  NS SWD+W  + +  KE +P  + S    D       +D    
Sbjct  371  SFGGSQSSSSGQNNSYRNSNSWDDWGDEKDTKKEAAPKVSTSNDDDDGWAGWDDNDAKDD  430

Query  260  ---YQSAHDNKHVGHNGKSDTKWSDGGFL  183
               YQSA   K VGHNGKSD+ W+ GGFL
Sbjct  431  DFYYQSAGAKKSVGHNGKSDSAWTGGGFL  459



>ref|XP_010517025.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Camelina sativa]
Length=460

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 87/150 (58%), Gaps = 11/150 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N++E NG Y +     K  NS
Sbjct  315  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTW----NQQNKNEGNGLYQNSGFGNKTANS  370

Query  431  sgggggqsssGRQFNSV-NSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddF--  261
            S  GG QSSS    N   NS SWD+W  + +  KE +P  + S    D       +D   
Sbjct  371  SSFGGSQSSSSGHNNGYRNSSSWDDWGEEKDTKKEAAPKVSTSNDDDDGWAGWDDNDAKD  430

Query  260  ----YQSAHDNKHVGHNGKSDTKWSDGGFL  183
                YQSA   K VGHNGKSD+ W+ GGFL
Sbjct  431  DDFYYQSAGAKKSVGHNGKSDSAWTGGGFL  460



>ref|XP_006294027.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
 ref|XP_006294028.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
 gb|EOA26925.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
 gb|EOA26926.1| hypothetical protein CARUB_v10023020mg, partial [Capsella rubella]
Length=516

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 89/150 (59%), Gaps = 11/150 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N++E NG+Y +     K  NS
Sbjct  371  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTW----NQQNKNEGNGFYQNSGFGNKTANS  426

Query  431  sgggggqsssGRQFNSV-NSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddF--  261
            S GG   SSS  Q NS  NS SWD+W  + +  KE +P  + S    D       +D   
Sbjct  427  SFGGSQSSSSSGQNNSYRNSNSWDDWGEEKDTKKEAAPKVSTSNDDDDGWAGWDDNDAKD  486

Query  260  ----YQSAHDNKHVGHNGKSDTKWSDGGFL  183
                YQSA   K VGHNGKSDT W+ GGFL
Sbjct  487  DDFYYQSAGAKKSVGHNGKSDTAWTGGGFL  516



>gb|KHG23489.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Gossypium 
arboreum]
Length=462

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 100/147 (68%), Gaps = 7/147 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGI+KGV ALASQKVEEY K D  +WKND+  +NESE+NG++   N   KG NS
Sbjct  319  EIGHRTWGIVKGVMALASQKVEEYAK-DGMNWKNDNWPQNESEKNGHHQGSNQGNKGWNS  377

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGN----NTKETSPANNdswagwddakddgfdd  264
            + GG   S      NS  S SWD+WDTK N     T+ T+  +ND WAGWD+AKDDG+D+
Sbjct  378  TSGGQSSSGG--NSNSCTSSSWDDWDTKDNRKEGTTEVTTSHSNDGWAGWDEAKDDGYDN  435

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            FY  A + + VG NGKSD  WS GGFL
Sbjct  436  FYNGASNKRAVGDNGKSDATWSGGGFL  462



>emb|CDX78196.1| BnaA09g33910D [Brassica napus]
Length=445

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 82/149 (55%), Gaps = 11/149 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKE-DNGSWKNDSXXRNESEQNGYYXDFNHNXKGLN  435
            EIGQRTWGIMKGV A+ASQKV EYTKE    SW      RNESE NGYY +F +  K  N
Sbjct  300  EIGQRTWGIMKGVMAIASQKVGEYTKEGKTTSW----NQRNESESNGYYQNFGNGNKAAN  355

Query  434  ssgggggqsssGRQFNSV--NSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddF  261
             S  G G  SS   + +    S SWD+W    +  KE   +   S +  DD      D  
Sbjct  356  PSVEGRGSQSSSSGYYNNSHKSNSWDDWGENESKKKEAVASKGSSASNDDDGWTGWDDPK  415

Query  260  ----YQSAHDNKHVGHNGKSDTKWSDGGF  186
                YQSA D K  GHNGKS+T W+ GGF
Sbjct  416  DDVYYQSAGDKKSAGHNGKSNTAWTGGGF  444



>emb|CDX79739.1| BnaC03g20750D [Brassica napus]
Length=453

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 92/153 (60%), Gaps = 19/153 (12%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N +E NGYY +     K + +
Sbjct  310  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTWNQ----QNTNEGNGYYQN-----KAVTN  360

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswa---------gwddakd  279
            S  GG QSSS  Q NS NS SWD+W  + N  KE +P    S +           D   D
Sbjct  361  SSLGGSQSSSSYQNNSRNSSSWDDWGEENNTKKEAAPQTKVSTSDDDGWAGWGDNDGKDD  420

Query  278  dgfddFYQSAH-DNKHVGHNGKSDTKWSDGGFL  183
            D  D +YQ+A  D K VGHNGKSDT W+ GGFL
Sbjct  421  DDDDGYYQTAAGDKKSVGHNGKSDTAWTGGGFL  453



>ref|XP_009139382.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Brassica rapa]
 emb|CDX76193.1| BnaA04g04570D [Brassica napus]
Length=451

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 83/149 (56%), Gaps = 10/149 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV A+A+QKV EYTKE   SW       NESE NGYY ++    K  N 
Sbjct  307  EIGHRTWGIMKGVMAIATQKVGEYTKEGTTSWNQ----HNESESNGYYQNYGSGNKEANP  362

Query  431  sgggggqsssGRQF--NSVNSGSWDNWDTKGNNTKETSPANNdswagwddak----ddgf  270
            S GGGG          NS  S SWD+W       K  + A   S A  DD      DDGF
Sbjct  363  SAGGGGSQLPSTGHYNNSQKSNSWDDWGENETPKKNEAVAPKGSSASNDDGGWTGWDDGF  422

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            D  YQSA D K VGHNGK DT W+ GGFL
Sbjct  423  DGHYQSADDKKSVGHNGKPDTAWTGGGFL  451



>gb|KDP35606.1| hypothetical protein JCGZ_09044 [Jatropha curcas]
Length=222

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 94/149 (63%), Gaps = 10/149 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFN-HNXKGLN  435
            EIGQRTWGIM+GV A+A+QKVEE +K+    WK D+  +NESE NGYY +FN    KG N
Sbjct  78   EIGQRTWGIMRGVMAMATQKVEELSKD---GWKADNWQQNESEGNGYYQEFNKQENKGWN  134

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKG----NNTKET-SPANNdswagwddakddgf  270
            SS  GG  SSSG   NS +S SWD+WD K     ++TK T + +N+      D   D   
Sbjct  135  SSSAGGQSSSSGNY-NSYSSSSWDDWDQKDVRKEDSTKSTGTRSNDGWAGWDDGKDDGFD  193

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            D+FYQ   D K VG NGKSD  W+ GGFL
Sbjct  194  DNFYQREPDKKAVGPNGKSDDTWTGGGFL  222



>ref|XP_002309050.1| PDE1 SUPPRESSOR 1 family protein [Populus trichocarpa]
 gb|EEE92573.1| PDE1 SUPPRESSOR 1 family protein [Populus trichocarpa]
Length=471

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 88/149 (59%), Gaps = 12/149 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFN-HNXKGLN  435
            EIGQRTWGIMKGV A+ASQKVEEYTKE   +   D+  +++++ NGYY +FN    KG N
Sbjct  329  EIGQRTWGIMKGVMAIASQKVEEYTKEGRNT---DNWQQSDNQSNGYYQEFNKQENKGWN  385

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKET-----SPANNdswagwddakddgf  270
            SS GG   S      NS  S SWD+WD K N  +++     S +N+D     D   D   
Sbjct  386  SSSGGQSSSG---HHNSYGSSSWDDWDQKDNRKEDSIKSTASHSNDDWAGWDDAKDDGYD  442

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            D+ Y SA   K   HNGKSD  W+ GGFL
Sbjct  443  DNIYHSAPSTKSASHNGKSDASWTGGGFL  471



>gb|KDP20155.1| hypothetical protein JCGZ_00032 [Jatropha curcas]
Length=465

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 94/149 (63%), Gaps = 10/149 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFN-HNXKGLN  435
            EIGQRTWGIM+GV A+A+QKVEE +K+    WK D+  +NESE NGYY +FN    KG N
Sbjct  321  EIGQRTWGIMRGVMAMATQKVEELSKD---GWKADNWQQNESESNGYYQEFNKQENKGWN  377

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKG----NNTKET-SPANNdswagwddakddgf  270
            SS  GG  SSSG   NS +S SWD+WD K     ++TK T + +N+      D   D   
Sbjct  378  SSSAGGQSSSSGNY-NSYSSSSWDDWDQKDVRKEDSTKSTGTRSNDGWAGWDDGKDDGFD  436

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            D+FYQ   D K VG NGKSD  W+ GGFL
Sbjct  437  DNFYQREPDKKAVGPNGKSDDTWTGGGFL  465



>ref|XP_011094837.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Sesamum indicum]
Length=468

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 94/148 (64%), Gaps = 7/148 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+TWG+M+GV ALA+QKVEEYTKE +G WKND+  R ES  NGYY +F    KG N 
Sbjct  323  EIGQKTWGLMRGVMALATQKVEEYTKEGSG-WKNDNWQRKESNSNGYYQEFGQESKGWN-  380

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw----ddakddgfdd  264
            S       SSGRQ  SV+S SWD+WDTK +  +E                DDAKDDG+D+
Sbjct  381  SAAASQPPSSGRQVASVSSSSWDDWDTKDSRKQEPPEGKTTQDVDSWAGWDDAKDDGYDN  440

Query  263  FYQSAHD-NKHVGHNGKSDTKWSDGGFL  183
             Y SA D  K    NGKSD KW++GGFL
Sbjct  441  SYHSASDYRKTTSINGKSDAKWTEGGFL  468



>ref|XP_009402324.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Musa acuminata subsp. malaccensis]
Length=459

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 81/147 (55%), Gaps = 14/147 (10%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEEY+ E   SWK D   + ES +NGYY +F  + K  N 
Sbjct  323  EIGQRTWGIMKGVMAMASQKVEEYSNE-GISWKVDDWSQKESVKNGYYQEFGQDNKNWN-  380

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagw----ddakddgfdd  264
                  Q +  + +NSV+S SWDNWD K    +   P      +      DD KDD    
Sbjct  381  ----SPQENPNKHYNSVSS-SWDNWDEK---ERREEPRKGTQSSESWAGWDDMKDDDGYA  432

Query  263  FYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             Y  +  N     NGKS + W+DGGFL
Sbjct  433  NYHYSSSNNAANQNGKSGSSWTDGGFL  459



>ref|XP_003554321.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Glycine max]
Length=489

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 99/182 (54%), Gaps = 42/182 (23%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWG+MKGV ALASQKVEE+ + DN +W +D+  RNES++NG+Y +FN    G NS
Sbjct  311  EIGQRTWGMMKGVMALASQKVEEFAR-DNPNWTSDNWQRNESDRNGFYQEFNRENNGRNS  369

Query  431  sgggggqsssGR---------------------------------QFNSVNSGSWDNWDT  351
            S   G  SS G+                                 +F++ NS SWD+WD 
Sbjct  370  STREGQHSSGGQTNTFHSSSWDDWGHNDFRKEEPAKGSAPQSSGGKFDNYNSSSWDDWDQ  429

Query  350  KGNNTKETSPANNdswagwdd------akddgfddFYQSAHDNKHVGHNGKSDTKWSDGG  189
            +  +T++  PA   S    D       AKDDGFDD Y SA ++K V HN KS   W+ GG
Sbjct  430  E--DTRKKEPAKGSSARSSDGWAGWDNAKDDGFDDIYGSASNSKGVTHNDKSGAAWTGGG  487

Query  188  FL  183
            FL
Sbjct  488  FL  489



>emb|CDX74953.1| BnaA05g06990D [Brassica napus]
Length=452

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 83/154 (54%), Gaps = 15/154 (10%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIM+GV A+ASQKVEE+TKE+  +W      +N+SE NGY        +    
Sbjct  303  EIGQRTWGIMRGVMAIASQKVEEFTKEETSTWNQ----QNKSEGNGYTNSSLGGSQSSYQ  358

Query  431  sgggggqsssGRQFNSVNSGSWDNW-DTKGNNTKETSPANNdswagwddakddgfddF--  261
            +      SS G   +  NS SWD+W + KG   KE +P  + S    DD      DD   
Sbjct  359  NNYLSQSSSGGHHNSYGNSNSWDDWGEEKGTTKKEAAPKVSTSKDDDDDGWAGWDDDNDA  418

Query  260  -------YQS-AHDNKHVGHNGKSDTKWSDGGFL  183
                   YQS A D K VGHNGK DT W+ GGFL
Sbjct  419  KDDDDGYYQSGAGDKKSVGHNGKPDTAWTGGGFL  452



>emb|CDX73533.1| BnaC08g24700D [Brassica napus]
Length=446

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 82/145 (57%), Gaps = 8/145 (6%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKE-DNGSWKNDSXXRNESEQNGYYXDFNHNXKGLN  435
            EIGQRTWGIMKGV A+ASQKV EYTKE    +W      RNESE NGYY +F +  K  N
Sbjct  306  EIGQRTWGIMKGVMAIASQKVGEYTKEGRTTTW----SQRNESESNGYYQNFGNGNKAAN  361

Query  434  ssgggggqsssGRQFNSV--NSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddF  261
             S  G G  SS   + +    S SWD    K     + S A+N    GW    D   D +
Sbjct  362  PSVEGRGSQSSSSGYYNNSQRSNSWDESKKKEAVASKGSSASN-DDDGWTGWNDPKDDVY  420

Query  260  YQSAHDNKHVGHNGKSDTKWSDGGF  186
            YQSA D K  GHNGKSDT W+ GGF
Sbjct  421  YQSAGDKKSAGHNGKSDTAWTGGGF  445



>ref|XP_010509321.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Camelina sativa]
Length=456

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 89/150 (59%), Gaps = 11/150 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N++E NG Y +     K  NS
Sbjct  311  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTW----NQQNKNEGNGLYQNSGFGNKTANS  366

Query  431  sgggggqsssGRQFNSV-NSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddF--  261
            S  GG QSSS  Q N+  NS SWD+W  + +  KE +P  + S    D       +D   
Sbjct  367  SSFGGSQSSSSVQNNNYRNSNSWDDWGDEKDTKKEAAPKVSTSNDDDDGWAGWDDNDAKD  426

Query  260  ----YQSAHDNKHVGHNGKSDTKWSDGGFL  183
                YQSA   K VG+NGKSD+ W+ GGFL
Sbjct  427  DDFYYQSAGAKKSVGNNGKSDSAWTGGGFL  456



>emb|CBI30586.3| unnamed protein product [Vitis vinifera]
Length=390

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG +TWGIMKGV A+ASQKVEEY K D   W +D   RN++E+NG+Y +F    KG NS
Sbjct  247  EIGHKTWGIMKGVMAMASQKVEEYAK-DGMKWNSDGWQRNDNEKNGFYQEFGQQSKGWNS  305

Query  431  sgggggqsssGR--QFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddFY  258
            S  GG  SS G     +S +   WD  D K  ++ + +  N D+WAGWDDAKDDG+++FY
Sbjct  306  SSEGGQPSSGGHVNSVSSSSWDDWDQKDNKKEDSTKGASHNGDNWAGWDDAKDDGYENFY  365

Query  257  QSAHDNKHVGHNGKSDTKWSDGGFL  183
            QSA D K VG NGKSDT W++GGFL
Sbjct  366  QSASDKKAVGRNGKSDTMWTEGGFL  390



>ref|XP_002262606.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Vitis vinifera]
Length=465

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG +TWGIMKGV A+ASQKVEEY K D   W +D   RN++E+NG+Y +F    KG NS
Sbjct  322  EIGHKTWGIMKGVMAMASQKVEEYAK-DGMKWNSDGWQRNDNEKNGFYQEFGQQSKGWNS  380

Query  431  sgggggqsssGR--QFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddFY  258
            S  GG  SS G     +S +   WD  D K  ++ + +  N D+WAGWDDAKDDG+++FY
Sbjct  381  SSEGGQPSSGGHVNSVSSSSWDDWDQKDNKKEDSTKGASHNGDNWAGWDDAKDDGYENFY  440

Query  257  QSAHDNKHVGHNGKSDTKWSDGGFL  183
            QSA D K VG NGKSDT W++GGFL
Sbjct  441  QSASDKKAVGRNGKSDTMWTEGGFL  465



>ref|XP_009416249.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Musa acuminata subsp. malaccensis]
Length=460

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 82/145 (57%), Gaps = 10/145 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+TWGIMKGV A+ASQKVEEYTKE   +WK D     ESE+N +Y  F+ +  G N 
Sbjct  324  EIGQKTWGIMKGVMAMASQKVEEYTKE-GINWKTDDSSWKESEKNSFYQKFSQDNNGWN-  381

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswag--wddakddgfddFY  258
                  Q +S + +NSV  GSWD+WD K    +      N        DD KDD  +D Y
Sbjct  382  ----SSQENSNKNYNSV--GSWDDWDEKETKEQPRKGTQNGESWAGWDDDVKDDDGNDNY  435

Query  257  QSAHDNKHVGHNGKSDTKWSDGGFL  183
                 NK    NGKS + W+DGGFL
Sbjct  436  NYTWSNKVGNQNGKSGSSWTDGGFL  460



>ref|XP_010920665.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Elaeis guineensis]
Length=465

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 78/143 (55%), Gaps = 8/143 (6%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            E+GQ+TWGIMKGV A+ASQKVEEYTK D  + K+D   R E E+NGYY +F    KG N 
Sbjct  331  EVGQKTWGIMKGVMAMASQKVEEYTK-DGMNCKDDDLQRQEGERNGYYQNFGQENKGWN-  388

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddFYQS  252
                  + +S + +N+ +  SWDNWD +    +              D   D   D Y  
Sbjct  389  ----SSEGNSLKHYNAAS--SWDNWDEEEKKEQPGKGTQGSESWAGWDDVKDDGYDNYSY  442

Query  251  AHDNKHVGHNGKSDTKWSDGGFL  183
            +  +K    NGKS + W++GGFL
Sbjct  443  SPSSKGANRNGKSSSLWTEGGFL  465



>emb|CDY30849.1| BnaC04g27040D [Brassica napus]
Length=448

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 84/149 (56%), Gaps = 10/149 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV A+A+QKV EYTKE   +W       NESE NGY  ++    K  N 
Sbjct  304  EIGHRTWGIMKGVMAIATQKVGEYTKEGTTNW----NQHNESEGNGYSQNYGSGNKPANP  359

Query  431  sgggggqsssGRQF--NSVNSGSWDNWDTKGNNTKETSPANNdswagwddak----ddgf  270
            S GGGG  SS      NS  S SWD+W       K  + A   S A  DD      DDGF
Sbjct  360  SSGGGGSQSSSTGHYNNSQKSNSWDDWGENETPKKNEAVAPKGSSASNDDGGWTGWDDGF  419

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            D  YQSA D K VGHNGK DT W+ GGFL
Sbjct  420  DGHYQSADDKKSVGHNGKPDTAWTGGGFL  448



>ref|XP_003521336.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Glycine max]
Length=486

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 98/183 (54%), Gaps = 43/183 (23%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV ALASQKVEE+ + DN +W +D+  RNES++NG+Y +FN    G NS
Sbjct  307  EIGQRTWGIMKGVMALASQKVEEFAR-DNPNWMSDNWQRNESDRNGFYQEFNRENNGRNS  365

Query  431  sgggggqsssGR---------------------------------QF-NSVNSGSWDNWD  354
            S   G  SS G+                                 +F N+ NS SWD+WD
Sbjct  366  STREGQHSSGGQTNTFHSSSWDDWGHNDSRKEETAKGSAPQSSGGKFDNNYNSSSWDDWD  425

Query  353  TKGNNTKETSPANNdswagwdd------akddgfddFYQSAHDNKHVGHNGKSDTKWSDG  192
             +  +T++  PA   +    D       AKDDGFDD Y SA +NK   HN KS   W+ G
Sbjct  426  QE--DTRKKEPAKGSAAHSSDGWTGWDNAKDDGFDDIYGSASNNKGGAHNDKSGAAWTGG  483

Query  191  GFL  183
            GFL
Sbjct  484  GFL  486



>ref|XP_009133186.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
 ref|XP_009133187.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
 ref|XP_009133188.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
 ref|XP_009133190.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
Length=477

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 95/174 (55%), Gaps = 35/174 (20%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXD----------  462
            E GQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N +E NGYY +          
Sbjct  308  ETGQRTWGIMKGVMAIASQKVEEFTKEEASTW----NQQNTNEGNGYYQNKAATNSSLGG  363

Query  461  ------FNHNXK------GLNssgggggqsssGRQFNSVNSGSWDNWDTKGNNTK-ETSP  321
                  + +N +      G  ++      S SG   +  NS SWD+W  + NNTK ET+P
Sbjct  364  SQSSSSYQNNKRSSWDDWGEENNTKKETASQSGYHNSHGNSSSWDDWGEEKNNTKKETAP  423

Query  320  ANNd-------swagwddakddgfddFYQSAH-DNKHVGHNGKSDTKWSDGGFL  183
              +        +  G +D KDD  D +YQSA  D K VGHNGKSDT W+ GGFL
Sbjct  424  KVSTSNDDDGWAGWGDNDGKDDDDDGYYQSAAGDKKSVGHNGKSDTAWTGGGFL  477



>gb|KHG23490.1| ADP-ribosylation factor GTPase-activating protein AGD7 [Gossypium 
arboreum]
Length=510

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 95/142 (67%), Gaps = 7/142 (5%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGI+KGV ALASQKVEEY K D  +WKND+  +NESE+NG++   N   KG NS
Sbjct  319  EIGHRTWGIVKGVMALASQKVEEYAK-DGMNWKNDNWPQNESEKNGHHQGSNQGNKGWNS  377

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGN----NTKETSPANNdswagwddakddgfdd  264
            + GG   S       S  S SWD+WDTK N     T+ T+  +ND WAGWD+AKDDG+D+
Sbjct  378  TSGGQSSSGGNSN--SCTSSSWDDWDTKDNRKEGTTEVTTSHSNDGWAGWDEAKDDGYDN  435

Query  263  FYQSAHDNKHVGHNGKSDTKWS  198
            FY  A + + VG NGKSD  WS
Sbjct  436  FYNGASNKRAVGDNGKSDATWS  457



>ref|XP_010678052.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Beta vulgaris subsp. vulgaris]
Length=471

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 96/146 (66%), Gaps = 4/146 (3%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+TWGIM+GV A+A+QKVEE+TKE   SWK D+  + E+E+NGYY DF    +G N 
Sbjct  327  EIGQKTWGIMRGVMAIATQKVEEFTKEPGVSWKTDNPHQTENERNGYYQDFKSESQGWN-  385

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNN---TKETSPANNdswagwddakddgfddF  261
            +  GGGQSSSGRQ NSV+S SWD+WD K +    +K+   ++++      D   D   D 
Sbjct  386  NSSGGGQSSSGRQNNSVSSVSWDDWDQKDDWKEGSKKGGSSHSNDGWAGWDDPKDDGFDD  445

Query  260  YQSAHDNKHVGHNGKSDTKWSDGGFL  183
            +  +   K  G NGKSDTKW +GGFL
Sbjct  446  FYHSSSMKSSGSNGKSDTKWGEGGFL  471



>ref|XP_007162658.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
 ref|XP_007162659.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
 gb|ESW34652.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
 gb|ESW34653.1| hypothetical protein PHAVU_001G1694000g [Phaseolus vulgaris]
Length=485

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 98/178 (55%), Gaps = 37/178 (21%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIM+GV A+A+QKVEEYT+ DN +  +D+  RNE+++NG+Y +FN   KG N 
Sbjct  310  EIGHRTWGIMRGVMAMATQKVEEYTR-DNPNGTSDNWKRNETDKNGFYQEFNQENKGWN-  367

Query  431  sgggggqsssGRQFNSV-------------------------------NSGSWDNWDTKG  345
            S G  GQ S+GRQ NS                                NS SWD+WD + 
Sbjct  368  SSGREGQHSTGRQTNSSSWDDWDHEDSRKEEPAKGSSHQSSGGRSDTNNSSSWDDWDHED  427

Query  344  NNTKETSPANNdswagw----ddakddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
               KE +  +    +      D+ KD+GFDDFY +A +NK  GHN K+   W+ GGFL
Sbjct  428  TRKKEAAKGSAAHSSDGWAGWDNNKDEGFDDFYGNASNNKAAGHNDKAGVAWTGGGFL  485



>ref|XP_008795047.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Phoenix dactylifera]
Length=466

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 80/149 (54%), Gaps = 19/149 (13%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            E+GQ+TWGIMKGV A+ASQKVEEYTK D  +WK D   R E E+NGYY DF     G N 
Sbjct  331  EVGQKTWGIMKGVMAMASQKVEEYTK-DGMNWKGDGWQRQEGERNGYYQDFGQENNGWN-  388

Query  431  sgggggqsssGRQFNSVNSGSWDNWD------TKGNNTKETSPANNdswagwddakddgf  270
                  + +S +  NSV+  SWD WD       +G  T + S +         D   D  
Sbjct  389  ----SSEGNSLKHHNSVS--SWDGWDEEEKKEQRGKGTTQDSAS-----WAGWDDVKDDG  437

Query  269  ddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             D Y  +  +K    NGKS + W++GGFL
Sbjct  438  YDNYSYSASSKGGNQNGKSGSLWTEGGFL  466



>ref|XP_009386541.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Musa acuminata subsp. malaccensis]
Length=449

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 79/144 (55%), Gaps = 16/144 (11%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG +TWGIMKGV A+ASQKVE YTKE   SW  D   R ESE++ YY +F  + +G + 
Sbjct  319  EIGHKTWGIMKGVMAMASQKVEVYTKE-GISWNVDDWPRKESEKSSYYQEFGQDKRGWS-  376

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddFYQS  252
                  Q  S +Q+NS++  SWD+WD K    +   P             DD  D    +
Sbjct  377  ----SRQEDSNKQYNSIS--SWDDWDKK---ERREEPGKGTQRGESWAGWDDVRD---DA  424

Query  251  AHD--NKHVGHNGKSDTKWSDGGF  186
             HD  NK V  NGKS + W+DGGF
Sbjct  425  GHDNLNKGVNQNGKSGSLWTDGGF  448



>gb|AAG17006.1|AF184146_1 ARF GAP-like zinc finger-containing protein ZIGA2, partial [Arabidopsis 
thaliana]
Length=458

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 80/147 (54%), Gaps = 16/147 (11%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV A+A+QKVEE+TKE + SW   S    E+E NGYY +F +  K  NS
Sbjct  309  EIGHRTWGIMKGVMAMATQKVEEFTKEGSTSWNQQS----ENEGNGYYQNFGNGNKAANS  364

Query  431  sgggggqsssGRQF---NSVNSGSWDNW-DTKGNNTKETSPANNdswagwddakddgfdd  264
            S GGG   SS       NS NS SWD+W + +   T+  +P  + +    D        D
Sbjct  365  SVGGGRPQSSSTSGHYNNSQNSNSWDSWGENENKKTEAVAPKGSSASNDDDGWTGWDDHD  424

Query  263  F--------YQSAHDNKHVGHNGKSDT  207
                     YQSA D K  GHNGKSD 
Sbjct  425  AKDDGFDGHYQSAGDKKSAGHNGKSDP  451



>ref|XP_007027081.1| ARF-GAP domain 7 isoform 2 [Theobroma cacao]
 gb|EOY07583.1| ARF-GAP domain 7 isoform 2 [Theobroma cacao]
Length=397

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKG  441
            EIGQRTWGIMKGV A+ASQKVEEYTK D  +WKN++  RN+SE+NGYY +F    KG
Sbjct  324  EIGQRTWGIMKGVMAIASQKVEEYTK-DGMNWKNENWQRNDSEKNGYYQEFKQENKG  379



>emb|CDY69342.1| BnaCnng63080D [Brassica napus]
Length=438

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 78/150 (52%), Gaps = 13/150 (9%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N+SE NGY        +  ++
Sbjct  295  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTWNQ----QNKSEGNGYTNSSLGGSQSSST  350

Query  431  sgggggqsssGRQFNSV-NSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddF--  261
                   S      N   NS SWD+W  + + TK+ +  + D         DD       
Sbjct  351  PKVSQSSSGG--HLNGYGNSNSWDDWGEEKSTTKKEAKDDGDGDDDGWAGWDDNDAKDDD  408

Query  260  ---YQS-AHDNKHVGHNGKSDTKWSDGGFL  183
               YQS A   K VGHNGK DT W+ GGFL
Sbjct  409  DGYYQSGAGVKKSVGHNGKPDTAWTGGGFL  438



>ref|XP_010907061.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Elaeis guineensis]
Length=459

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 77/147 (52%), Gaps = 16/147 (11%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNX--KGL  438
            EIGQRTWGIMKGV A+ASQKVEEYTKE  G W  D   RNE+E+NGYY +F      +G 
Sbjct  325  EIGQRTWGIMKGVMAMASQKVEEYTKEGMG-WNGDDWQRNENERNGYYKEFGEEKAWQGW  383

Query  437  NssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddFY  258
            +S G            +S   GSWD+WD K    +    A +    G      D   + Y
Sbjct  384  DSPGA-----------HSSGRGSWDDWDAKDKKEEHGKGAQDRHGWGGWHDVKDDCYENY  432

Query  257  QSAHDNKHVGHNGKSD--TKWSDGGFL  183
              +   K    N KS+  + W++GGFL
Sbjct  433  HHSSSKKATNQNLKSNSTSTWTEGGFL  459



>emb|CDY07784.1| BnaA03g17270D [Brassica napus]
Length=433

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 87/147 (59%), Gaps = 25/147 (17%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W      +N +E NGYY     N    NS
Sbjct  308  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTW----NQQNTNEGNGYY----QNKAATNS  359

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNd---swagwddakddgfddF  261
            S GG   SSS +             + K + T + S +N+D   +  G +D KDD  D +
Sbjct  360  SLGGSQSSSSYQ-------------NNKPSQTPKVSTSNDDDGWAGWGDNDGKDDDDDGY  406

Query  260  YQSAH-DNKHVGHNGKSDTKWSDGGFL  183
            YQSA  D K VGHNGKSDT W+ GGFL
Sbjct  407  YQSAAGDKKSVGHNGKSDTAWTGGGFL  433



>ref|XP_006373937.1| hypothetical protein POPTR_0016s11090g [Populus trichocarpa]
 gb|ERP51734.1| hypothetical protein POPTR_0016s11090g [Populus trichocarpa]
Length=157

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 82/146 (56%), Gaps = 6/146 (4%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFN-HNXKGLN  435
            EIG RTWGIMKGV A+ASQKVEEYTK+    W  D+  +N S+ NGYY +FN    KG N
Sbjct  14   EIGHRTWGIMKGVMAMASQKVEEYTKD---GWNTDNWQQNNSQSNGYYQEFNKQENKGWN  70

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP--ANNdswagwddakddgfddF  261
            SS  G   S      +S +   WD  D +  ++ +++   +N+      D   D   D+F
Sbjct  71   SSSSGQSSSGHYNSCSSSSWDDWDRKDNRKEDSVKSTALHSNDGWAGWDDAKDDGYDDNF  130

Query  260  YQSAHDNKHVGHNGKSDTKWSDGGFL  183
            Y SA D K   HNGKSD  W+ GGF 
Sbjct  131  YHSAPDKKSASHNGKSDASWTGGGFF  156



>ref|XP_009143481.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Brassica rapa]
 ref|XP_009143482.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7 [Brassica rapa]
Length=476

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 84/180 (47%), Gaps = 41/180 (23%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXK----  444
            EIGQRTWGIM+GV A+ASQKVEE+TKE+  +W      +N+SE NGY        +    
Sbjct  301  EIGQRTWGIMRGVMAIASQKVEEFTKEEASTWNQ----QNKSEGNGYTNSSLGGSQSSSS  356

Query  443  ---------------GLNssgggggqsssGRQFNSV-------NSGSWDNW-DTKGNNTK  333
                           G  +S      +    Q +S        NS SWD+W + K    K
Sbjct  357  YQNNYCSNSNSWDNWGEENSTTKKEAAPKVSQSSSGGHHNSYGNSNSWDDWGEEKSTTKK  416

Query  332  ETSPANNdswagwddakddgfddF---------YQS-AHDNKHVGHNGKSDTKWSDGGFL  183
            E +P  + S    DD      DD          YQS A D K VGHNGK DT W+ GGFL
Sbjct  417  EAAPKVSTSKDDDDDGWAGWDDDNDAKDDDDGYYQSGAGDKKSVGHNGKPDTAWTGGGFL  476



>ref|XP_009141672.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Brassica rapa]
Length=450

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 85/166 (51%), Gaps = 23/166 (14%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWK-------NDSXX---RNESEQNGYYXD  462
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W        +DS      + S QN Y   
Sbjct  285  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTWNQQNNNGFSDSKAGTNSSSSYQNNYRNS  344

Query  461  FNHNXKGLNssgggggqsssGRQFNS---VNSGSWDNW-DTKGNNTKETSPANNdswa--  300
             + +  G  S+          +  +     N+ SWD+W + K +  KE +P  + S    
Sbjct  345  SSWDDWGEESNTKKEAAPKVSQSVHHNGYGNANSWDDWGEEKSSTKKEAAPKVSTSKDDD  404

Query  299  ------gwddakddgfddFYQ-SAHDNKHVGHNGKSDTKWSDGGFL  183
                    D+   D  D +YQ +A D K VGHNGK DT W+ GGFL
Sbjct  405  GGWAGWDDDNDDKDDDDGYYQNTAEDKKSVGHNGKPDTAWTGGGFL  450



>ref|XP_004493890.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Cicer arietinum]
Length=433

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 7/98 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV ALASQKVEEYT++   +  +D+  +N+++++    DFN   KG NS
Sbjct  299  EIGQRTWGIMKGVMALASQKVEEYTRDYPPNGNSDNWQQNQNDRH----DFNQENKGWNS  354

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA  318
            S   G  SSSG Q N+  S SWD+WD+K  +T++  PA
Sbjct  355  STREGQPSSSG-QTNTYQSSSWDDWDSK--DTRKEVPA  389



>ref|XP_009409527.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein 
AGD7-like [Musa acuminata subsp. malaccensis]
Length=509

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 54/88 (61%), Gaps = 8/88 (9%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQ+TWGIM+GV A+ASQKVEEY KE   +W  D     ESE+NG Y  F  N K  N 
Sbjct  325  EIGQKTWGIMRGVMAMASQKVEEYAKEGI-NWNEDDWSWKESEKNGPYQKFGQNNKDWN-  382

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTK  348
                  + SS R  NSV+  SWD+WD K
Sbjct  383  ----SFEESSERHQNSVS--SWDDWDEK  404



>gb|ABD32193.1| Arf GTPase activating protein [Medicago truncatula]
 gb|ACJ85591.1| unknown [Medicago truncatula]
 gb|AFK49050.1| unknown [Medicago truncatula]
 gb|AES81716.2| ADP-ribosylation factor GTPase-activating protein AGD10 [Medicago 
truncatula]
Length=443

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV ALASQKVEE+TK D     +D+  RNE++++    DFN   KG NS
Sbjct  307  EIGQRTWGIMKGVMALASQKVEEFTK-DYPDGNSDNWPRNENDRH----DFNQENKGWNS  361

Query  431  sggggg-qsssGRQFNSVNSGSWDNWDTKGNNTKETSPA  318
            S      Q SSG Q N+ +S SWD+WD +  +T++  PA
Sbjct  362  STSTREGQPSSGGQTNTYHSNSWDDWDNQ--DTRKEVPA  398



>ref|XP_003625498.1| ADP-ribosylation factor GTPase-activating protein [Medicago truncatula]
Length=474

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 8/99 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIGQRTWGIMKGV ALASQKVEE+TK D     +D+  RNE++++    DFN   KG NS
Sbjct  307  EIGQRTWGIMKGVMALASQKVEEFTK-DYPDGNSDNWPRNENDRH----DFNQENKGWNS  361

Query  431  sggggg-qsssGRQFNSVNSGSWDNWDTKGNNTKETSPA  318
            S      Q SSG Q N+ +S SWD+WD +  +T++  PA
Sbjct  362  STSTREGQPSSGGQTNTYHSNSWDDWDNQ--DTRKEVPA  398



>ref|XP_006651253.1| PREDICTED: LOW QUALITY PROTEIN: probable ADP-ribosylation factor 
GTPase-activating protein AGD6-like, partial [Oryza brachyantha]
Length=447

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 71/145 (49%), Gaps = 13/145 (9%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNH--NXKGL  438
            EIG RTWGIMKGV ALA+QKVEEYTKE    W +D   R +  +   Y  F H  N  G 
Sbjct  312  EIGSRTWGIMKGVMALATQKVEEYTKEGGSGWGDDWQRREQGSEP--YSRFEHETNGNGW  369

Query  437  NssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPANNdswagwddakddgfddFY  258
            NSS  G           + NS SWD+WD +G   + T    +       D   D   D Y
Sbjct  370  NSSHNGSS--------KNYNSNSWDDWDEQGKKDEPTKERQSSDSWAGWDDGKDDSFDSY  421

Query  257  QSAHDNKHVGHNGKS-DTKWSDGGF  186
              +  NK    NG S  + W++GGF
Sbjct  422  NHSTPNKGSNQNGTSGGSYWTEGGF  446



>emb|CDY26647.1| BnaA09g46300D [Brassica napus]
Length=181

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYY  468
            EIGQRTWGIMKGV A+ASQ VEE+TKE+  +W      +N +E NGYY
Sbjct  89   EIGQRTWGIMKGVMAIASQMVEEFTKEEASTWNQ----QNTNEGNGYY  132



>gb|EPS67752.1| hypothetical protein M569_07021, partial [Genlisea aurea]
Length=443

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 50/90 (56%), Gaps = 23/90 (26%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKND--SXXRNESEQNGYYXDFNHNXKGL  438
            EIG +TWG+M+GV A+ASQKVEEY +E +G WKND  S  RNE++ NG+           
Sbjct  317  EIGHKTWGLMRGVMAMASQKVEEYARESSG-WKNDGSSRIRNETDHNGH-----------  364

Query  437  NssgggggqsssGRQFNSVNSGSWDNWDTK  348
                     S+         SGSWD WDTK
Sbjct  365  ---------SNRSATVADPGSGSWDGWDTK  385



>emb|CDX88291.1| BnaC06g37350D [Brassica napus]
Length=223

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 81/158 (51%), Gaps = 33/158 (21%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXD----------  462
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W       N+  ++G+Y D          
Sbjct  68   EIGQRTWGIMKGVMAIASQKVEEFTKEEASNW-------NQQNKSGFYDDKAATNSSSSY  120

Query  461  --FNHNXKGLNs--sgggggqsssGRQFNSV------NSGSWDNWDTKGNNT--KETSP-  321
                 N    +         + ++ +   SV      NS SWD+W  + N+T  KE +P 
Sbjct  121  QSNYRNSSSCDDWGEESNSKKEAAPKVSQSVHHNGYGNSNSWDDWGEEKNSTTKKEAAPK  180

Query  320  --ANNdswagwddakddgfddFYQSAH-DNKHVGHNGK  216
              A+ D  AGW    D   D +YQSA  D K VGHNGK
Sbjct  181  VSASKDDDAGWAGWDDKEDDGYYQSAAGDKKSVGHNGK  218



>gb|KHN09424.1| Putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Glycine soja]
Length=171

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 89/174 (51%), Gaps = 43/174 (25%)
 Frame = -3

Query  584  MKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNssgggggqss  405
            MKGV ALASQKVEE+ + DN +W +D+  RNES++NG+Y +FN    G NSS   G  SS
Sbjct  1    MKGVMALASQKVEEFAR-DNPNWMSDNWQRNESDRNGFYQEFNRENNGRNSSTREGQHSS  59

Query  404  sGR---------------------------------QF-NSVNSGSWDNWDTKGNNTKET  327
             G+                                 +F N+ NS SWD+WD +  +T++ 
Sbjct  60   GGQTNTFHSSSWDDWGHNDSRKEETAKGSAPQSSGGKFDNNYNSSSWDDWDQE--DTRKK  117

Query  326  SPANNdswagwdd------akddgfddFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
             PA   +    D       AKDDGFDD Y SA +NK   HN KS   W+ GGFL
Sbjct  118  EPAKGSAAHSSDGWAGWDNAKDDGFDDIYGSASNNKGGAHNDKSGAAWTGGGFL  171



>ref|XP_010922379.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Elaeis guineensis]
Length=452

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDF  459
            EIGQRTWGIMK V A+A+QKVEEY KE  G    D    NE+E+NGYY +F
Sbjct  320  EIGQRTWGIMKEVMAMATQKVEEYAKEGMGR-NGDDQQPNENERNGYYKEF  369



>emb|CDY16083.1| BnaC08g40400D [Brassica napus]
Length=236

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 4/48 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYY  468
            EI QRTWGIMKGV A+ASQ VEE+TKE+  +W      +N +E NGYY
Sbjct  144  EIRQRTWGIMKGVMAIASQMVEEFTKEEASTWNQ----QNTNEGNGYY  187



>gb|AAO72580.1| ADP ribosylation GTPase-like protein [Oryza sativa Japonica Group]
Length=308

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 51/98 (52%), Gaps = 10/98 (10%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV ALASQKVEEY KE    W +D   R +  +  +  +   N  G NS
Sbjct  172  EIGSRTWGIMKGVMALASQKVEEYAKEGGNGWGDDWQRREQGSEPYHRFERETNGNGWNS  231

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA  318
            S   G          + NS SWD+WD      K+  PA
Sbjct  232  SSHDGSS-------KNYNSNSWDDWDEP---VKKDEPA  259



>emb|CDY18435.1| BnaA04g21520D [Brassica napus]
Length=422

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSW  516
            EIGQRTWGIMKGV A+ASQKVEE+TKE+  +W
Sbjct  285  EIGQRTWGIMKGVMAIASQKVEEFTKEEASTW  316



>gb|EAY89468.1| hypothetical protein OsI_11000 [Oryza sativa Indica Group]
Length=454

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 47/86 (55%), Gaps = 7/86 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV ALASQKVEEY KE    W +D   R +  +  +  +   N  G NS
Sbjct  318  EIGSRTWGIMKGVMALASQKVEEYAKEGGNGWGDDWQRREQGSEPYHRFERETNGNGWNS  377

Query  431  sgggggqsssGRQFNSVNSGSWDNWD  354
            S   G          + NS SWD+WD
Sbjct  378  SSHDGSS-------KNYNSNSWDDWD  396



>ref|NP_001049726.1| Os03g0278400 [Oryza sativa Japonica Group]
 gb|ABF95284.1| ARF GAP-like zinc finger-containing protein ZIGA2, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11640.1| Os03g0278400 [Oryza sativa Japonica Group]
 gb|EAZ26458.1| hypothetical protein OsJ_10347 [Oryza sativa Japonica Group]
 dbj|BAG91743.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 47/86 (55%), Gaps = 7/86 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG RTWGIMKGV ALASQKVEEY KE    W +D   R +  +  +  +   N  G NS
Sbjct  317  EIGSRTWGIMKGVMALASQKVEEYAKEGGNGWGDDWQRREQGSEPYHRFERETNGNGWNS  376

Query  431  sgggggqsssGRQFNSVNSGSWDNWD  354
            S   G          + NS SWD+WD
Sbjct  377  SSHDGSS-------KNYNSNSWDDWD  395



>ref|XP_003558222.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Brachypodium distachyon]
Length=464

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 50/99 (51%), Gaps = 7/99 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKE-DNGSWKNDSXXRNESEQNGYYXDFNHNXKGLN  435
            EIG RTWGIMKGV ALA+QKVEEY KE   G    D   R E   N  Y    H   G +
Sbjct  323  EIGSRTWGIMKGVMALATQKVEEYAKEGGVGGGWGDDWQRGEQNNNEPYCRSEHEANGNS  382

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSPA  318
             +    G S +       NS SWD+WD +G   +   P+
Sbjct  383  WNSPQDGSSKNH------NSNSWDDWDDQGKKDEPVKPS  415



>ref|XP_002465464.1| hypothetical protein SORBIDRAFT_01g039320 [Sorghum bicolor]
 gb|EER92462.1| hypothetical protein SORBIDRAFT_01g039320 [Sorghum bicolor]
Length=457

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 51/98 (52%), Gaps = 9/98 (9%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNG-YYXDFNHNXKGLN  435
            EIG RTWGIM+GV ALASQKVEEY KE   S   D   R  SEQN   Y  F H   G +
Sbjct  318  EIGSRTWGIMRGVMALASQKVEEYAKEGGMSGWGDDWQR--SEQNSEPYQRFEHETNGNS  375

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP  321
             +      S       + NS SWD+WD +G   +   P
Sbjct  376  WNSSQNSSS------KNNNSSSWDDWDDQGKKDEPAKP  407



>ref|XP_004984751.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6-like [Setaria italica]
Length=455

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 47/97 (48%), Gaps = 7/97 (7%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            EIG +TWGIM+GV ALASQKVEEY KE       D   R E + N  Y  F H       
Sbjct  319  EIGSKTWGIMRGVMALASQKVEEYAKEGGVGGWGDDWQRGE-QNNEPYQRFEHETNSNGW  377

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP  321
            S      S       + NS SWD+WD +G   +   P
Sbjct  378  SSSQNSSS------KNYNSNSWDDWDDQGKKDEPAKP  408



>ref|XP_006846038.1| hypothetical protein AMTR_s00012p00025360 [Amborella trichopoda]
 gb|ERN07713.1| hypothetical protein AMTR_s00012p00025360 [Amborella trichopoda]
Length=455

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 72/148 (49%), Gaps = 12/148 (8%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRN--ESEQN-GYYXDFN-HNXK  444
            EIGQ+TWG+M+GV A+ASQKVEEYTKE    + ++    N    E N GYY  F+  N K
Sbjct  315  EIGQKTWGLMRGVMAIASQKVEEYTKEGITKFSDNHQNHNGYSGEGNGGYYHAFSEENSK  374

Query  443  GLNssgggggqsssGRQFNSVNSGSWDNWDTKGNNTK-ETSPANNdswagwddakddgfd  267
            G + +   G          S +S SWD+W  K +  K +             D   D   
Sbjct  375  GSDHNQKNGYD-------RSESSYSWDDWGRKEDKVKDDKGAQGGGDGWAGWDDVKDEDH  427

Query  266  dFYQSAHDNKHVGHNGKSDTKWSDGGFL  183
            + +  A        +GKS++ W+ GGFL
Sbjct  428  NDFFEASTKGSSDKHGKSESSWTGGGFL  455



>ref|NP_001150760.1| DNA binding protein [Zea mays]
 gb|ACG40254.1| DNA binding protein [Zea mays]
Length=453

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 52/99 (53%), Gaps = 11/99 (11%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGS-WKNDSXXRNESEQNG-YYXDFNHNXKGL  438
            EIG +TWGIM+GV A+ASQKVEEY KE   S W  D      SEQNG  Y  F H     
Sbjct  314  EIGSKTWGIMRGVMAMASQKVEEYAKEGGMSGWGED---WQRSEQNGEPYQRFEH-----  365

Query  437  NssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP  321
             ++      SS      + NS SWD+WD +G   +   P
Sbjct  366  -ATNSNSWNSSQNSSSKNNNSSSWDDWDDQGKKGEPAKP  403



>ref|XP_008654261.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Zea mays]
 tpg|DAA44701.1| TPA: putative ARF GTPase-activating domain family protein [Zea 
mays]
Length=454

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 50/98 (51%), Gaps = 10/98 (10%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDN-GSWKNDSXXRNESEQNGYYXDFNHNXKGLN  435
            EIG RTWGIM+GV ALASQKVEEY KE   G W  D   ++  +++  Y  F H   G +
Sbjct  316  EIGSRTWGIMRGVMALASQKVEEYAKEGGVGGWGED--WQHSEQKSEPYQRFEHETNGNS  373

Query  434  ssgggggqsssGRQFNSVNSGSWDNWDTKGNNTKETSP  321
             +             +  NS SWD+WD  G   +   P
Sbjct  374  WNSSQNSS-------SKNNSSSWDDWDDPGKKDEPAKP  404



>gb|EMT07652.1| hypothetical protein F775_26990 [Aegilops tauschii]
Length=328

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKE  531
            EIG RTWGIMKGV ALA+QKVEEY KE
Sbjct  183  EIGSRTWGIMKGVMALATQKVEEYAKE  209



>gb|EMS46940.1| putative ADP-ribosylation factor GTPase-activating protein AGD6 
[Triticum urartu]
Length=482

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKE  531
            EIG RTWGIMKGV ALA+QKVEEY KE
Sbjct  336  EIGSRTWGIMKGVMALATQKVEEYAKE  362



>dbj|BAJ88349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKE  531
            EIG RTWGIMKGV ALA+QKVEEY KE
Sbjct  324  EIGSRTWGIMKGVMALATQKVEEYAKE  350



>ref|XP_009381844.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Musa acuminata subsp. malaccensis]
Length=421

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 8/59 (14%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLN  435
            EIG RTWGIMKGV A+A+QKVEE+ KE   +W       NE +  G+  +     KG N
Sbjct  312  EIGHRTWGIMKGVMAMATQKVEEFAKEGM-AW-------NEDDVGGHQEEIGQASKGGN  362



>ref|XP_008780180.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating 
protein AGD6 [Phoenix dactylifera]
Length=413

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 2/54 (4%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSX-XRNESEQNGYYXDFNH  453
            E+GQRTWGIMKG+  +ASQKVEEY   D   WK +    R E + +G      H
Sbjct  316  ELGQRTWGIMKGIMTMASQKVEEYAG-DGAGWKMEGLQPRREIDSDGSAGTPRH  368



>gb|KHF98429.1| ADP-ribosylation factor GTPase-activating AGD7 -like protein 
[Gossypium arboreum]
Length=461

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 8/93 (9%)
 Frame = -3

Query  611  EIGQRTWGIMKGVXALASQKVEEYTKEDNGSWKNDSXXRNESEQNGYYXDFNHNXKGLNs  432
            + G +TWG+MKG   LA+QKV  +TK D  + K+++  RN    NGYY +F    KG NS
Sbjct  319  KFGHKTWGVMKGAVTLATQKVGRFTK-DAMTQKSNNWQRN----NGYYQEFKQ-EKGCNS  372

Query  431  sgggggqsssGRQFNSVNSGSWDNWDTKGNNTK  333
            +  G   S+     +S +S  WDN  TK NNTK
Sbjct  373  TSRGESFSNGNH--SSYSSSYWDNCGTKDNNTK  403



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660