BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF020F02

Length=686
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011072995.1|  PREDICTED: phosphoethanolamine N-methyltrans...    329   6e-107   Sesamum indicum [beniseed]
ref|XP_011084227.1|  PREDICTED: phosphoethanolamine N-methyltrans...    326   6e-106   Sesamum indicum [beniseed]
ref|XP_011084235.1|  PREDICTED: phosphoethanolamine N-methyltrans...    326   7e-106   Sesamum indicum [beniseed]
ref|NP_001234549.1|  phosphoethanolamine N-methyltransferase            326   7e-106   Solanum lycopersicum
ref|XP_006341528.1|  PREDICTED: phosphoethanolamine N-methyltrans...    325   2e-105   Solanum tuberosum [potatoes]
ref|XP_009757363.1|  PREDICTED: phosphoethanolamine N-methyltrans...    324   6e-105   Nicotiana sylvestris
ref|XP_002532097.1|  phosphoethanolamine n-methyltransferase, put...    324   6e-105   Ricinus communis
ref|XP_009776424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    323   1e-104   Nicotiana sylvestris
ref|XP_009614862.1|  PREDICTED: phosphoethanolamine N-methyltrans...    322   3e-104   Nicotiana tomentosiformis
ref|XP_004241642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    322   4e-104   Solanum lycopersicum
emb|CDO98349.1|  unnamed protein product                                322   4e-104   Coffea canephora [robusta coffee]
ref|XP_009616694.1|  PREDICTED: phosphoethanolamine N-methyltrans...    321   6e-104   Nicotiana tomentosiformis
gb|EYU24136.1|  hypothetical protein MIMGU_mgv1a005261mg                321   8e-104   Erythranthe guttata [common monkey flower]
ref|XP_006365411.1|  PREDICTED: phosphoethanolamine N-methyltrans...    321   9e-104   Solanum tuberosum [potatoes]
ref|XP_009782224.1|  PREDICTED: phosphoethanolamine N-methyltrans...    320   1e-103   Nicotiana sylvestris
ref|XP_011039130.1|  PREDICTED: phosphomethylethanolamine N-methy...    319   5e-103   Populus euphratica
emb|CBI26879.3|  unnamed protein product                                318   8e-103   Vitis vinifera
ref|XP_009595958.1|  PREDICTED: phosphoethanolamine N-methyltrans...    318   1e-102   Nicotiana tomentosiformis
ref|XP_002317876.2|  hypothetical protein POPTR_0012s044901g            313   1e-102   
ref|XP_006376720.1|  hypothetical protein POPTR_0012s044901g            313   1e-102   
ref|XP_004299531.1|  PREDICTED: phosphomethylethanolamine N-methy...    318   2e-102   Fragaria vesca subsp. vesca
ref|XP_010655650.1|  PREDICTED: phosphomethylethanolamine N-methy...    317   3e-102   Vitis vinifera
ref|XP_006843796.1|  hypothetical protein AMTR_s00007p00250490          317   3e-102   Amborella trichopoda
ref|XP_002284594.1|  PREDICTED: phosphoethanolamine N-methyltrans...    317   3e-102   Vitis vinifera
gb|AAG52075.1|AC012679_13  putative S-adenosyl-methionine-sterol-...    310   3e-102   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33965.1|  hypothetical protein MIMGU_mgv1a005263mg                316   5e-102   Erythranthe guttata [common monkey flower]
ref|XP_008240154.1|  PREDICTED: phosphoethanolamine N-methyltrans...    316   5e-102   
ref|XP_010033717.1|  PREDICTED: phosphoethanolamine N-methyltrans...    316   6e-102   Eucalyptus grandis [rose gum]
ref|XP_008240152.1|  PREDICTED: phosphoethanolamine N-methyltrans...    315   1e-101   Prunus mume [ume]
dbj|BAC57432.1|  phosphoethanolamine N-methyltransferase                315   1e-101   Suaeda japonica
gb|ABG57185.1|  phosphoethanolamine N-methyltransferase                 315   2e-101   Salicornia europaea [chicken-claws]
gb|KDP23923.1|  hypothetical protein JCGZ_27083                         314   3e-101   Jatropha curcas
ref|XP_006490771.1|  PREDICTED: phosphoethanolamine N-methyltrans...    313   5e-101   
ref|XP_006451624.1|  hypothetical protein CICLE_v10010749mg             314   5e-101   Citrus clementina [clementine]
ref|XP_011014101.1|  PREDICTED: phosphomethylethanolamine N-methy...    313   5e-101   Populus euphratica
ref|XP_002282182.1|  PREDICTED: phosphomethylethanolamine N-methy...    313   6e-101   Vitis vinifera
ref|XP_002891445.1|  hypothetical protein ARALYDRAFT_473996             313   7e-101   
gb|ABK42071.1|  phosphoethanolamine N-methyltransferase                 313   8e-101   Suaeda liaotungensis
gb|AFZ78648.1|  methyl transferase                                      313   8e-101   Populus tomentosa [Chinese white poplar]
ref|XP_011008809.1|  PREDICTED: phosphomethylethanolamine N-methy...    313   1e-100   Populus euphratica
gb|AFW04224.1|  phosphoethanolamine N-methyl transferase                313   1e-100   Suaeda maritima
emb|CAN64744.1|  hypothetical protein VITISV_041321                     312   2e-100   Vitis vinifera
ref|XP_011008808.1|  PREDICTED: phosphomethylethanolamine N-methy...    313   2e-100   Populus euphratica
emb|CBI26877.3|  unnamed protein product                                312   2e-100   Vitis vinifera
ref|XP_010533969.1|  PREDICTED: phosphomethylethanolamine N-methy...    312   2e-100   Tarenaya hassleriana [spider flower]
ref|XP_010655490.1|  PREDICTED: phosphomethylethanolamine N-methy...    311   2e-100   Vitis vinifera
ref|XP_007209942.1|  hypothetical protein PRUPE_ppa004742mg             311   3e-100   Prunus persica
gb|KJB30118.1|  hypothetical protein B456_005G132000                    307   3e-100   Gossypium raimondii
ref|XP_009385384.1|  PREDICTED: phosphoethanolamine N-methyltrans...    311   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010677350.1|  PREDICTED: phosphoethanolamine N-methyltrans...    310   4e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_177501.2|  putative phosphoethanolamine N-methyltransferase 3    311   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974139.2|  putative phosphoethanolamine N-methyltransferase 3    311   7e-100   Arabidopsis thaliana [mouse-ear cress]
pir||H96762  hypothetical protein F6D5.1 [imported] - Arabidopsis...    313   7e-100
ref|XP_002887491.1|  predicted protein                                  310   1e-99    
ref|XP_010428286.1|  PREDICTED: phosphoethanolamine N-methyltrans...    310   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010274723.1|  PREDICTED: phosphomethylethanolamine N-methy...    310   1e-99    Nelumbo nucifera [Indian lotus]
dbj|BAE07178.1|  phosphoethanolamine N-methyltransferase                310   1e-99    Beta vulgaris [beet]
ref|XP_010686587.1|  PREDICTED: phosphoethanolamine N-methyltrans...    310   2e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006302164.1|  hypothetical protein CARUB_v10020173mg             310   2e-99    Capsella rubella
gb|AGI56231.1|  phosphoethanolamine N-methyltransferase                 310   2e-99    Lycium barbarum [Duke of Argyll's teatree]
gb|KFK41794.1|  hypothetical protein AALP_AA2G173000                    310   2e-99    Arabis alpina [alpine rockcress]
ref|XP_010428285.1|  PREDICTED: phosphoethanolamine N-methyltrans...    310   2e-99    Camelina sativa [gold-of-pleasure]
dbj|BAE99185.1|  putative phosphoethanolamine N-methyltransferase       310   3e-99    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC57960.1|  phosphoethanolamine N-methyltransferase                309   3e-99    Tripolium pannonicum [sea starwort]
emb|CDY11100.1|  BnaC06g23520D                                          309   4e-99    Brassica napus [oilseed rape]
ref|XP_006393387.1|  hypothetical protein EUTSA_v10011451mg             308   4e-99    
ref|XP_010314226.1|  PREDICTED: phosphoethanolamine N-methyltrans...    305   5e-99    
ref|XP_007036802.1|  S-adenosyl-L-methionine-dependent methyltran...    308   5e-99    
emb|CDX68222.1|  BnaA07g22620D                                          309   6e-99    
ref|XP_008360927.1|  PREDICTED: phosphoethanolamine N-methyltrans...    308   6e-99    
gb|KJB30120.1|  hypothetical protein B456_005G132000                    308   6e-99    Gossypium raimondii
ref|XP_009104804.1|  PREDICTED: phosphoethanolamine N-methyltrans...    309   6e-99    Brassica rapa
ref|XP_008393424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    308   7e-99    
ref|XP_010461683.1|  PREDICTED: phosphomethylethanolamine N-methy...    308   7e-99    Camelina sativa [gold-of-pleasure]
gb|KJB30122.1|  hypothetical protein B456_005G132000                    308   9e-99    Gossypium raimondii
gb|KFK36082.1|  hypothetical protein AALP_AA4G075100                    308   1e-98    Arabis alpina [alpine rockcress]
ref|XP_010416170.1|  PREDICTED: phosphoethanolamine N-methyltrans...    308   1e-98    Camelina sativa [gold-of-pleasure]
gb|KJB30117.1|  hypothetical protein B456_005G132000                    308   1e-98    Gossypium raimondii
ref|XP_008364653.1|  PREDICTED: phosphoethanolamine N-methyltrans...    307   1e-98    
ref|XP_010471422.1|  PREDICTED: phosphoethanolamine N-methyltrans...    307   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_006346642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    307   2e-98    Solanum tuberosum [potatoes]
ref|XP_006390538.1|  hypothetical protein EUTSA_v10018431mg             308   2e-98    Eutrema salsugineum [saltwater cress]
ref|XP_008799222.1|  PREDICTED: phosphomethylethanolamine N-methy...    307   2e-98    
ref|XP_010471421.1|  PREDICTED: phosphoethanolamine N-methyltrans...    307   2e-98    Camelina sativa [gold-of-pleasure]
ref|XP_008799221.1|  PREDICTED: phosphomethylethanolamine N-methy...    307   3e-98    Phoenix dactylifera
ref|XP_008799219.1|  PREDICTED: phosphomethylethanolamine N-methy...    306   3e-98    Phoenix dactylifera
ref|XP_010921161.1|  PREDICTED: phosphoethanolamine N-methyltrans...    306   3e-98    Elaeis guineensis
ref|XP_009360079.1|  PREDICTED: phosphoethanolamine N-methyltrans...    306   3e-98    Pyrus x bretschneideri [bai li]
ref|XP_002322102.2|  hypothetical protein POPTR_0015s04540g             307   4e-98    
emb|CDX95799.1|  BnaC05g35500D                                          306   4e-98    
ref|XP_004252273.1|  PREDICTED: phosphomethylethanolamine N-methy...    306   5e-98    Solanum lycopersicum
gb|KHG16117.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    306   5e-98    Gossypium arboreum [tree cotton]
ref|XP_009356042.1|  PREDICTED: phosphoethanolamine N-methyltrans...    305   9e-98    Pyrus x bretschneideri [bai li]
ref|XP_010678114.1|  PREDICTED: phosphoethanolamine N-methyltrans...    305   1e-97    Beta vulgaris subsp. vulgaris [field beet]
emb|CDM83854.1|  unnamed protein product                                302   1e-97    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010263678.1|  PREDICTED: phosphoethanolamine N-methyltrans...    305   1e-97    Nelumbo nucifera [Indian lotus]
ref|XP_008453479.1|  PREDICTED: phosphoethanolamine N-methyltrans...    305   1e-97    Cucumis melo [Oriental melon]
ref|NP_001056231.2|  Os05g0548900                                       295   1e-97    
gb|AER10512.1|  phosphoethanolamine N-methyltransferase                 305   1e-97    Pyrus betulifolia
ref|XP_010519218.1|  PREDICTED: phosphoethanolamine N-methyltrans...    305   2e-97    Tarenaya hassleriana [spider flower]
ref|XP_010519219.1|  PREDICTED: phosphoethanolamine N-methyltrans...    305   2e-97    Tarenaya hassleriana [spider flower]
ref|XP_009145948.1|  PREDICTED: phosphoethanolamine N-methyltrans...    304   2e-97    Brassica rapa
ref|XP_004969638.1|  PREDICTED: phosphoethanolamine N-methyltrans...    304   3e-97    Setaria italica
ref|XP_007036803.1|  S-adenosyl-L-methionine-dependent methyltran...    304   4e-97    
sp|Q9M571.1|PEAMT_SPIOL  RecName: Full=Phosphoethanolamine N-meth...    304   4e-97    Spinacia oleracea
gb|KFK39125.1|  hypothetical protein AALP_AA3G204100                    304   4e-97    Arabis alpina [alpine rockcress]
ref|XP_002883100.1|  N-methyltransferase 1                              303   4e-97    
emb|CDX92181.1|  BnaA05g22260D                                          302   5e-97    
ref|XP_004137500.1|  PREDICTED: phosphoethanolamine N-methyltrans...    303   7e-97    Cucumis sativus [cucumbers]
gb|EMT21187.1|  Phosphoethanolamine N-methyltransferase 1               303   7e-97    
ref|XP_008464197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    303   8e-97    Cucumis melo [Oriental melon]
ref|NP_188427.2|  phosphoethanolamine N-methyltransferase 1             303   8e-97    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02720.1|  methyl transferase-like protein                        303   9e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137341.1|  PREDICTED: phosphoethanolamine N-methyltrans...    303   9e-97    Cucumis sativus [cucumbers]
dbj|BAD80838.1|  phosphoethanolamine N-methyltransferase                303   9e-97    Atriplex nummularia
gb|EPS65842.1|  hypothetical protein M569_08933                         302   1e-96    Genlisea aurea
emb|CDM83845.1|  unnamed protein product                                303   1e-96    Triticum aestivum [Canadian hard winter wheat]
gb|AFW78991.1|  hypothetical protein ZEAMMB73_932976                    298   1e-96    
gb|ACV89824.1|  S-adenosyl-L-methionine:phosphoethanolamine N-met...    303   1e-96    Triticum aestivum [Canadian hard winter wheat]
gb|EMS54147.1|  Phosphoethanolamine N-methyltransferase 1               303   1e-96    Triticum urartu
ref|XP_007209943.1|  hypothetical protein PRUPE_ppa004742mg             302   2e-96    
ref|XP_004161835.1|  PREDICTED: phosphoethanolamine N-methyltrans...    303   2e-96    
ref|XP_002441466.1|  hypothetical protein SORBIDRAFT_09g027360          302   2e-96    Sorghum bicolor [broomcorn]
ref|XP_010921205.1|  PREDICTED: phosphoethanolamine N-methyltrans...    301   2e-96    
ref|XP_010540184.1|  PREDICTED: phosphoethanolamine N-methyltrans...    300   2e-96    Tarenaya hassleriana [spider flower]
ref|NP_001043957.1|  Os01g0695100                                       302   3e-96    
gb|AEY75253.1|  phosphoethanolamine N-methyltransferase                 301   3e-96    Atriplex canescens [shadscale]
ref|XP_010921197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    301   3e-96    Elaeis guineensis
gb|EEE55232.1|  hypothetical protein OsJ_03109                          302   4e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006297517.1|  hypothetical protein CARUB_v10013541mg             301   4e-96    Capsella rubella
gb|KJB53040.1|  hypothetical protein B456_008G289900                    300   7e-96    Gossypium raimondii
gb|KJB53039.1|  hypothetical protein B456_008G289900                    300   7e-96    Gossypium raimondii
ref|XP_010487709.1|  PREDICTED: phosphoethanolamine N-methyltrans...    300   9e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010487710.1|  PREDICTED: phosphoethanolamine N-methyltrans...    300   9e-96    Camelina sativa [gold-of-pleasure]
gb|AAS57723.1|  phosphoethanolamine N-methyltransferase                 300   9e-96    Oryza sativa [red rice]
gb|AAM13092.1|  unknown protein                                         300   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404071.1|  PREDICTED: phosphomethylethanolamine N-methy...    300   1e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921188.1|  PREDICTED: phosphoethanolamine N-methyltrans...    301   2e-95    
ref|XP_002456194.1|  hypothetical protein SORBIDRAFT_03g031950          300   2e-95    Sorghum bicolor [broomcorn]
ref|XP_010465872.1|  PREDICTED: phosphoethanolamine N-methyltrans...    299   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_004166029.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    300   2e-95    
gb|AAP83582.1|  phosphoethanolamine N-methyltransferase                 299   2e-95    Brassica napus [oilseed rape]
ref|NP_001169597.1|  uncharacterized LOC100383478                       299   3e-95    Zea mays [maize]
ref|XP_010506234.1|  PREDICTED: phosphoethanolamine N-methyltrans...    298   4e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006644536.1|  PREDICTED: phosphoethanolamine N-methyltrans...    298   5e-95    Oryza brachyantha
dbj|BAJ97525.1|  predicted protein                                      299   5e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010506242.1|  PREDICTED: phosphoethanolamine N-methyltrans...    298   5e-95    Camelina sativa [gold-of-pleasure]
gb|AAV67950.1|  putative phosphoethanolamine N-methyltransferase        298   5e-95    Zea mays [maize]
ref|XP_008675144.1|  PREDICTED: phosphoethanolamine N-methyltrans...    298   8e-95    
tpg|DAA57997.1|  TPA: putative phosphoethanolamine N-methyltransf...    298   1e-94    
ref|NP_175293.1|  phosphoethanolamine N-methyltransferase 2             296   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137342.1|  PREDICTED: phosphoethanolamine N-methyltrans...    296   2e-94    Cucumis sativus [cucumbers]
ref|XP_004961340.1|  PREDICTED: phosphoethanolamine N-methyltrans...    297   2e-94    Setaria italica
ref|XP_004969637.1|  PREDICTED: phosphoethanolamine N-methyltrans...    296   3e-94    Setaria italica
ref|NP_973993.1|  phosphoethanolamine N-methyltransferase 2             296   4e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569614.1|  PREDICTED: phosphoethanolamine N-methyltrans...    296   4e-94    Brachypodium distachyon [annual false brome]
dbj|BAH01482.1|  unnamed protein product                                296   5e-94    Oryza sativa Japonica Group [Japonica rice]
gb|EEC79642.1|  hypothetical protein OsI_20868                          296   6e-94    Oryza sativa Indica Group [Indian rice]
gb|AFW83642.1|  phosphoethanolamine N-methyltransferase                 296   6e-94    
ref|XP_002456193.1|  hypothetical protein SORBIDRAFT_03g031940          295   9e-94    Sorghum bicolor [broomcorn]
ref|XP_010097563.1|  hypothetical protein L484_017373                   295   1e-93    
ref|NP_001148925.1|  LOC100282545                                       295   1e-93    Zea mays [maize]
ref|XP_004166030.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    294   1e-93    
ref|XP_008799258.1|  PREDICTED: phosphomethylethanolamine N-methy...    293   2e-93    
ref|XP_006303987.1|  hypothetical protein CARUB_v10008968mg             294   2e-93    Capsella rubella
ref|XP_010231068.1|  PREDICTED: phosphomethylethanolamine N-methy...    293   2e-93    Brachypodium distachyon [annual false brome]
ref|XP_003567962.1|  PREDICTED: phosphomethylethanolamine N-methy...    294   2e-93    Brachypodium distachyon [annual false brome]
ref|XP_010461752.1|  PREDICTED: phosphomethylethanolamine N-methy...    293   4e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010097561.1|  Phosphoethanolamine N-methyltransferase 1          293   2e-92    
gb|AGO59019.1|  heat responsive transcription factor protein            291   2e-92    Triticum aestivum [Canadian hard winter wheat]
gb|EMT23240.1|  Phosphoethanolamine N-methyltransferase 1               292   2e-92    
gb|AAL40895.1|  phosphoethanolamine methyltransferase                   291   2e-92    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006655550.1|  PREDICTED: phosphoethanolamine N-methyltrans...    290   1e-91    Oryza brachyantha
gb|KDP23922.1|  hypothetical protein JCGZ_27082                         290   2e-91    Jatropha curcas
gb|EMT23241.1|  Phosphoethanolamine N-methyltransferase 1               290   4e-91    
gb|AAF79705.1|AC020889_13  T1N15.23                                     282   3e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDX93681.1|  BnaA06g03670D                                          285   4e-90    
ref|XP_009147956.1|  PREDICTED: phosphomethylethanolamine N-methy...    285   8e-90    Brassica rapa
ref|XP_006406666.1|  hypothetical protein EUTSA_v10020595mg             281   2e-88    Eutrema salsugineum [saltwater cress]
gb|KJB53038.1|  hypothetical protein B456_008G289900                    280   3e-88    Gossypium raimondii
emb|CDY40594.1|  BnaC06g02100D                                          280   3e-88    Brassica napus [oilseed rape]
gb|ABX10444.1|  phosphoethanolamine N-methyltransferase                 276   9e-87    Gossypium hirsutum [American cotton]
ref|XP_010481025.1|  PREDICTED: phosphomethylethanolamine N-methy...    275   1e-86    
ref|XP_006303561.1|  hypothetical protein CARUB_v10011038mg             276   2e-86    
ref|XP_002969650.1|  hypothetical protein SELMODRAFT_146547             274   1e-85    Selaginella moellendorffii
ref|XP_001763293.1|  predicted protein                                  274   1e-85    
ref|XP_002970912.1|  hypothetical protein SELMODRAFT_270875             272   8e-85    Selaginella moellendorffii
emb|CAN75113.1|  hypothetical protein VITISV_043577                     269   2e-84    Vitis vinifera
gb|KHN10536.1|  Phosphoethanolamine N-methyltransferase                 266   1e-82    Glycine soja [wild soybean]
ref|XP_003525185.1|  PREDICTED: phosphoethanolamine N-methyltrans...    266   1e-82    
gb|KDO63824.1|  hypothetical protein CISIN_1g043471mg                   264   1e-81    Citrus sinensis [apfelsine]
gb|AFK34318.1|  unknown                                                 254   1e-81    Lotus japonicus
gb|KJB30123.1|  hypothetical protein B456_005G132000                    262   3e-81    Gossypium raimondii
ref|XP_007160542.1|  hypothetical protein PHAVU_002G330400g             261   9e-81    Phaseolus vulgaris [French bean]
gb|EAY75471.1|  hypothetical protein OsI_03371                          260   1e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_008675146.1|  PREDICTED: phosphoethanolamine N-methyltrans...    258   2e-79    Zea mays [maize]
ref|XP_003534138.1|  PREDICTED: phosphoethanolamine N-methyltrans...    255   3e-78    
ref|XP_010500398.1|  PREDICTED: phosphomethylethanolamine N-methy...    253   7e-78    Camelina sativa [gold-of-pleasure]
gb|ABK24808.1|  unknown                                                 253   1e-77    Picea sitchensis
ref|XP_003619840.1|  Phosphoethanolamine N-methyltransferase            250   3e-77    
ref|XP_003619836.1|  Phosphoethanolamine N-methyltransferase            251   1e-76    Medicago truncatula
gb|AFK45429.1|  unknown                                                 243   3e-75    Medicago truncatula
ref|XP_003528975.2|  PREDICTED: phosphoethanolamine N-methyltrans...    245   4e-74    
ref|XP_004512745.1|  PREDICTED: phosphoethanolamine N-methyltrans...    244   5e-74    Cicer arietinum [garbanzo]
ref|XP_004503268.1|  PREDICTED: phosphoethanolamine N-methyltrans...    244   5e-74    Cicer arietinum [garbanzo]
ref|XP_004512744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    244   5e-74    Cicer arietinum [garbanzo]
ref|XP_003631125.1|  Phosphoethanolamine N-methyltransferase            243   2e-73    
gb|AET05600.2|  phosphoethanolamine N-methyltransferase                 243   2e-73    Medicago truncatula
ref|XP_007152684.1|  hypothetical protein PHAVU_004G150500g             239   5e-72    Phaseolus vulgaris [French bean]
ref|XP_003631124.1|  Phosphoethanolamine N-methyltransferase            238   1e-71    
ref|XP_007209941.1|  hypothetical protein PRUPE_ppa004742mg             230   4e-69    
gb|KJB30119.1|  hypothetical protein B456_005G132000                    228   1e-68    Gossypium raimondii
ref|XP_007160543.1|  hypothetical protein PHAVU_002G330400g             229   4e-68    Phaseolus vulgaris [French bean]
emb|CDY07952.1|  BnaC03g35710D                                          221   4e-66    Brassica napus [oilseed rape]
gb|KJB53041.1|  hypothetical protein B456_008G289900                    222   4e-66    Gossypium raimondii
ref|XP_010774827.1|  PREDICTED: phosphoethanolamine N-methyltrans...    221   1e-65    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003970259.1|  PREDICTED: phosphoethanolamine N-methyltrans...    221   2e-65    
ref|XP_004073222.1|  PREDICTED: phosphoethanolamine N-methyltrans...    221   3e-65    
ref|NP_001070105.1|  phosphoethanolamine methyltransferase              220   7e-65    Danio rerio [leopard danio]
gb|AAI35513.1|  LOC100124841 protein                                    219   2e-64    Xenopus tropicalis [western clawed frog]
ref|XP_007550439.1|  PREDICTED: phosphoethanolamine N-methyltrans...    219   3e-64    Poecilia formosa
ref|NP_001096276.2|  phosphoethanolamine methyltransferase              218   3e-64    Xenopus tropicalis [western clawed frog]
ref|XP_008324913.1|  PREDICTED: phosphoethanolamine N-methyltrans...    218   3e-64    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324912.1|  PREDICTED: phosphoethanolamine N-methyltrans...    218   4e-64    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008324914.1|  PREDICTED: phosphoethanolamine N-methyltrans...    218   4e-64    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004545582.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   2e-63    
ref|XP_004545581.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   2e-63    
ref|XP_005723168.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   2e-63    
ref|XP_005723169.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   2e-63    Pundamilia nyererei
ref|XP_005723167.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   3e-63    Pundamilia nyererei
ref|XP_005467629.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   3e-63    Oreochromis niloticus
ref|XP_005467627.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   3e-63    Oreochromis niloticus
ref|XP_005913451.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   4e-63    Haplochromis burtoni
ref|XP_005913450.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   4e-63    Haplochromis burtoni
ref|XP_003444639.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   4e-63    Oreochromis niloticus
ref|XP_005643867.1|  S-adenosyl-L-methionine-dependent methyltran...    215   6e-63    Coccomyxa subellipsoidea C-169
ref|XP_006781399.1|  PREDICTED: phosphoethanolamine N-methyltrans...    215   7e-63    Neolamprologus brichardi [lyretail cichlid]
ref|XP_008278560.1|  PREDICTED: phosphoethanolamine N-methyltrans...    214   1e-62    Stegastes partitus
emb|CDY35847.1|  BnaC09g37790D                                          211   1e-62    Brassica napus [oilseed rape]
emb|CCA16454.1|  phosphoethanolamine Nmethyltransferase putative        214   1e-62    Albugo laibachii Nc14
gb|KEH21429.1|  phosphoethanolamine N-methyltransferase                 213   2e-62    Medicago truncatula
ref|XP_008278559.1|  PREDICTED: phosphoethanolamine N-methyltrans...    214   2e-62    Stegastes partitus
ref|XP_005806845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    214   2e-62    Xiphophorus maculatus
ref|XP_010730440.1|  PREDICTED: phosphomethylethanolamine N-methy...    214   2e-62    
ref|XP_010730439.1|  PREDICTED: phosphomethylethanolamine N-methy...    214   3e-62    
ref|XP_009832411.1|  hypothetical protein H257_08283                    213   4e-62    Aphanomyces astaci
ref|NP_001167350.1|  phosphoethanolamine N-methyltransferase 3          213   4e-62    Salmo salar
gb|ELT87122.1|  hypothetical protein CAPTEDRAFT_189076                  213   4e-62    Capitella teleta
ref|XP_008418601.1|  PREDICTED: phosphoethanolamine N-methyltrans...    213   5e-62    Poecilia reticulata
ref|XP_008418600.1|  PREDICTED: phosphoethanolamine N-methyltrans...    213   5e-62    Poecilia reticulata
emb|CDX74572.1|  BnaA04g08170D                                          209   1e-61    
ref|XP_010864863.1|  PREDICTED: phosphoethanolamine N-methyltrans...    211   2e-61    Esox lucius
ref|XP_011453571.1|  PREDICTED: phosphoethanolamine N-methyltrans...    211   2e-61    Crassostrea gigas
emb|CCI39434.1|  unnamed protein product                                211   2e-61    Albugo candida
ref|XP_011453570.1|  PREDICTED: phosphoethanolamine N-methyltrans...    211   2e-61    Crassostrea gigas
gb|ETP40953.1|  hypothetical protein F442_11791                         204   3e-61    Phytophthora parasitica P10297
ref|XP_011453569.1|  PREDICTED: phosphoethanolamine N-methyltrans...    211   3e-61    Crassostrea gigas
ref|NP_001087172.1|  phosphoethanolamine methyltransferase              209   1e-60    Xenopus laevis [clawed frog]
ref|XP_008872791.1|  hypothetical protein H310_08714                    208   2e-60    Aphanomyces invadans
ref|XP_007228349.1|  PREDICTED: phosphoethanolamine N-methyltrans...    209   4e-60    
gb|KJB30121.1|  hypothetical protein B456_005G132000                    201   2e-58    Gossypium raimondii
ref|XP_005096335.1|  PREDICTED: phosphoethanolamine N-methyltrans...    203   2e-58    Aplysia californica
ref|XP_005096334.1|  PREDICTED: phosphoethanolamine N-methyltrans...    203   3e-58    Aplysia californica
ref|XP_009012150.1|  hypothetical protein HELRODRAFT_183893             198   3e-57    Helobdella robusta
ref|XP_002594089.1|  hypothetical protein BRAFLDRAFT_118790             201   4e-57    Branchiostoma floridae
emb|CAG09731.1|  unnamed protein product                                199   5e-57    Tetraodon nigroviridis
ref|XP_002898136.1|  phosphoethanolamine N-methyltransferase            199   7e-57    Phytophthora infestans T30-4
ref|XP_009061459.1|  hypothetical protein LOTGIDRAFT_219756             197   3e-56    Lottia gigantea
ref|XP_002898137.1|  phosphoethanolamine N-methyltransferase, put...    197   5e-56    Phytophthora infestans T30-4
gb|EFX73213.1|  hypothetical protein DAPPUDRAFT_58148                   196   1e-55    Daphnia pulex
ref|XP_001768934.1|  predicted protein                                  194   1e-55    
ref|XP_007440631.1|  PREDICTED: phosphomethylethanolamine N-methy...    194   7e-55    
ref|XP_008620240.1|  hypothetical protein SDRG_15834                    191   3e-54    Saprolegnia diclina VS20
gb|KEH21430.1|  phosphoethanolamine N-methyltransferase                 191   4e-54    Medicago truncatula
gb|KDO18852.1|  hypothetical protein SPRG_15851                         189   6e-54    Saprolegnia parasitica CBS 223.65
emb|CBY12280.1|  unnamed protein product                                185   1e-53    Oikopleura dioica
ref|XP_008620239.1|  hypothetical protein SDRG_15833                    190   2e-53    Saprolegnia diclina VS20
ref|XP_794381.2|  PREDICTED: phosphoethanolamine N-methyltransfer...    190   2e-53    
emb|CDX72992.1|  BnaC06g34400D                                          179   7e-53    
emb|CBY30945.1|  unnamed protein product                                182   2e-52    
gb|KDO18851.1|  hypothetical protein SPRG_15850                         187   3e-52    
ref|XP_001634828.1|  predicted protein                                  181   4e-52    
gb|AGM38074.1|  putative phosphoethanolamine N-methyltransferase        175   7e-52    
ref|XP_011399976.1|  Phosphoethanolamine N-methyltransferase            185   2e-51    
gb|KFM82339.1|  Phosphoethanolamine N-methyltransferase                 165   7e-47    
ref|WP_027370921.1|  hypothetical protein                               154   6e-42    
ref|WP_015250142.1|  methyltransferase family protein                   153   1e-41    
ref|XP_001614208.1|  phosphoethanolamine N-methyltransferase            153   2e-41    
pdb|4MWZ|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...    153   2e-41    
ref|XP_004223586.1|  phosphoethanolamine N-methyltransferase            152   3e-41    
pdb|4IV0|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...    152   5e-41    
gb|ETO16413.1|  hypothetical protein RFI_20925                          152   1e-40    
emb|CDQ99741.1|  unnamed protein product                                150   1e-40    
ref|XP_009525359.1|  hypothetical protein PHYSODRAFT_345888             155   1e-40    
ref|XP_008815737.1|  phosphoethanolamine N-methyltransferase            150   2e-40    
ref|XP_002259925.1|  phosphoethanolamine N-methyltransferase            147   3e-39    
emb|CBY30905.1|  unnamed protein product                                147   5e-39    
pdb|4IV8|A  Chain A, Crystal Structure Of N-methyl Transferase Fr...    147   6e-39    
gb|KIZ00504.1|  hypothetical protein MNEG_7455                          140   4e-38    
emb|CDJ43178.1|  hypothetical protein, conserved                        142   3e-37    
emb|CDJ58552.1|  Sterol 24-C-methyltransferase, related                 142   4e-37    
emb|CDJ67597.1|  hypothetical protein, conserved                        140   2e-36    
gb|ETN82894.1|  methyltransferase domain protein                        143   2e-36    
gb|KHN00145.1|  Phosphoethanolamine N-methyltransferase                 142   6e-36    
gb|ETW47365.1|  hypothetical protein PFMALIP_04544                      137   1e-35    
gb|EYC15763.1|  hypothetical protein Y032_0036g3344                     140   2e-35    
emb|CDI77742.1|  hypothetical protein, conserved                        137   3e-35    
pdb|3UJD|A  Chain A, Phosphoethanolamine Methyltransferase Mutant...    137   3e-35    
ref|XP_001350151.1|  phosphoethanolamine N-methyltransferase            137   3e-35    
gb|ETL89749.1|  hypothetical protein L917_11367                         132   4e-35    
gb|ETW16777.1|  hypothetical protein PFFVO_04306                        136   5e-35    
pdb|3UJ6|A  Chain A, Semet Phosphoethanolamine Methyltransferase ...    136   5e-35    
emb|CDO66214.1|  phosphoethanolamine N-methyltransferase                135   1e-34    
gb|EYC15765.1|  hypothetical protein Y032_0036g3344                     140   3e-34    
pdb|4R6W|A  Chain A, Plasmodium Falciparum Phosphoethanolamine Me...    134   3e-34    
pdb|3UJC|A  Chain A, Phosphoethanolamine Methyltransferase Mutant...    133   6e-34    
pdb|4KRI|A  Chain A, Haemonchus Contortus Phospholethanolamine N-...    135   1e-33    
emb|CDJ96940.1|  Methyltransferase type 11 domain containing protein    135   1e-33    
pdb|4KRH|A  Chain A, Semet Haemonchus Contortus Phosphoethanolami...    134   7e-33    
ref|XP_002635479.1|  C. briggsae CBR-PMT-2 protein                      132   2e-32    
gb|KHN87001.1|  Phosphoethanolamine N-methyltransferase 1               127   1e-31    
ref|XP_006306318.1|  hypothetical protein CARUB_v10012188mg             128   3e-31    
gb|EGT43583.1|  CBN-PMT-2 protein                                       128   6e-31    
emb|CEF62382.1|  Hypothetical protein SRAE_1000065500                   127   8e-31    
gb|ADV61410.1|  Methyltransferase type 11                               125   1e-30    
ref|NP_504248.1|  Protein PMT-2                                         127   1e-30    
pdb|4INE|A  Chain A, Crystal Structure Of N-methyl Transferase (p...    127   1e-30    
ref|XP_003115237.1|  CRE-PMT-2 protein                                  127   1e-30    
gb|ADI22186.1|  SAM-dependent methyltransferases                        121   1e-29    
gb|ABK93894.1|  unknown                                                 116   2e-29    
gb|KIH55493.1|  methyltransferase domain protein                        120   2e-28    
emb|CBY31441.1|  unnamed protein product                                117   2e-26    
emb|CBY10458.1|  unnamed protein product                                116   6e-26    
ref|WP_030008425.1|  hypothetical protein                               111   6e-26    
emb|CEG03634.1|  unnamed protein product                                105   3e-25    
gb|ACF23047.1|  ST236                                                   102   3e-24    
gb|ADI22300.1|  SAM-dependent methyltransferases                        104   1e-23    
emb|CDJ34460.1|  Tocopherol o-methyltransferase, related                101   3e-22    
gb|AAM97038.1|  phosphoethanolamine N-methyltransferase, putative       102   5e-22    
ref|WP_044253490.1|  hypothetical protein                             99.8    6e-22    
gb|EMT23242.1|  Putative phosphoethanolamine N-methyltransferase 2      101   9e-22    
gb|KHG05875.1|  Phosphoethanolamine N-methyltransferase 1 -like p...  99.0    3e-21    
gb|ETK83142.1|  hypothetical protein L915_11580                       93.6    1e-20    
ref|WP_038787099.1|  methyltransferase                                95.5    7e-20    
gb|KGS61388.1|  ubiE/COQ5 methyltransferase family protein            94.4    9e-20    
gb|KGC36951.1|  ubiE/COQ5 methyltransferase family protein            94.0    1e-19    
gb|KGS76095.1|  ubiE/COQ5 methyltransferase family protein            94.0    1e-19    
ref|WP_006201234.1|  SAM-dependent methlyltransferase                 94.7    1e-19    
ref|WP_010118738.1|  methyltransferase                                94.7    1e-19    
ref|WP_038773359.1|  methyltransferase                                94.4    2e-19    
emb|CDX96485.1|  BnaA07g30960D                                        90.1    2e-19    
gb|EEH25635.1|  cyclopropane-fatty-acyl-phospholipid synthase         94.0    2e-19    
ref|WP_038733335.1|  methyltransferase                                94.4    2e-19    
ref|WP_038742287.1|  methyltransferase                                94.0    2e-19    
ref|WP_009948102.1|  MULTISPECIES: methyltransferase                  94.0    2e-19    
ref|WP_038749925.1|  methyltransferase                                94.0    2e-19    
gb|EDO87536.1|  cyclopropane-fatty-acyl-phospholipid synthase         94.0    2e-19    
ref|WP_038779212.1|  methyltransferase                                94.0    2e-19    
gb|EBA45191.1|  cyclopropane-fatty-acyl-phospholipid synthase         94.0    2e-19    
ref|WP_041190171.1|  methyltransferase                                94.0    2e-19    
ref|WP_038793751.1|  MULTISPECIES: methyltransferase                  94.0    2e-19    
ref|WP_011325999.1|  MULTISPECIES: methyltransferase                  94.0    2e-19    
ref|WP_017844165.1|  methyltransferase                                94.0    2e-19    
ref|WP_010108956.1|  methyltransferase                                94.0    2e-19    
ref|WP_004531806.1|  MULTISPECIES: methyltransferase                  94.0    2e-19    
gb|EET03909.1|  cyclopropane-fatty-acyl-phospholipid synthase         94.0    2e-19    
ref|WP_038799888.1|  methyltransferase                                94.0    2e-19    
ref|WP_023734633.1|  SAM-dependent methlyltransferase                 94.0    2e-19    
gb|EES21972.1|  cyclopropane-fatty-acyl-phospholipid synthase         94.0    2e-19    
ref|WP_038727077.1|  methyltransferase                                94.0    2e-19    
ref|WP_004532962.1|  methyltransferase                                94.0    2e-19    
ref|WP_042734046.1|  hypothetical protein                             94.0    2e-19    
gb|ABN93730.1|  cyclopropane-fatty-acyl-phospholipid synthase         93.6    2e-19    
ref|WP_038793743.1|  methyltransferase                                94.0    2e-19    
ref|WP_038744912.1|  methyltransferase                                93.6    3e-19    
ref|WP_023711680.1|  MULTISPECIES: SAM-dependent methlyltransferase   93.6    3e-19    
ref|WP_041191926.1|  methyltransferase                                93.6    3e-19    
ref|XP_009106017.1|  PREDICTED: phosphoethanolamine N-methyltrans...  91.3    4e-19    
ref|WP_044353071.1|  methyltransferase                                92.4    7e-19    
ref|WP_038755336.1|  methyltransferase                                92.4    7e-19    
gb|ABN86795.1|  cyclopropane-fatty-acyl-phospholipid synthase         92.4    7e-19    
ref|WP_038749813.1|  methyltransferase                                92.4    8e-19    
ref|WP_023730784.1|  SAM-dependent methlyltransferase                 91.3    2e-18    
ref|WP_038775589.1|  methyltransferase                                90.5    3e-18    
ref|WP_038739292.1|  MULTISPECIES: methyltransferase                  90.5    3e-18    
ref|WP_004557577.1|  phosphoethanolamine N-methyltransferase          90.5    3e-18    
ref|WP_038730130.1|  methyltransferase                                90.5    4e-18    
ref|WP_023696414.1|  MULTISPECIES: SAM-dependent methlyltransferase   90.5    4e-18    
ref|WP_023727283.1|  SAM-dependent methlyltransferase                 90.1    6e-18    
ref|WP_023690119.1|  MULTISPECIES: SAM-dependent methlyltransferase   89.7    6e-18    
ref|WP_023806546.1|  SAM-dependent methlyltransferase                 89.4    8e-18    
ref|WP_023683953.1|  MULTISPECIES: SAM-dependent methlyltransferase   89.4    8e-18    
ref|WP_023715007.1|  SAM-dependent methlyltransferase                 89.4    9e-18    
ref|WP_031208770.1|  MULTISPECIES: SAM-dependent methlyltransferase   88.6    1e-17    
ref|WP_028096892.1|  hypothetical protein                             88.6    2e-17    
ref|WP_006328098.1|  Methyltransferase type 11                        88.2    2e-17    
ref|WP_023737415.1|  MULTISPECIES: SAM-dependent methlyltransferase   87.8    3e-17    
ref|WP_023754158.1|  MULTISPECIES: SAM-dependent methlyltransferase   87.4    4e-17    
ref|WP_023670077.1|  MULTISPECIES: SAM-dependent methlyltransferase   87.0    5e-17    
ref|WP_008873958.1|  Methyltransferase type 11                        86.7    7e-17    
ref|WP_023751672.1|  SAM-dependent methlyltransferase                 86.3    1e-16    
ref|WP_015877778.1|  methyltransferase                                85.9    1e-16    
ref|WP_023816426.1|  MULTISPECIES: SAM-dependent methlyltransferase   85.1    2e-16    
ref|WP_031199857.1|  SAM-dependent methlyltransferase                 85.1    3e-16    
ref|WP_037711497.1|  hypothetical protein                             84.7    4e-16    
gb|ETK83144.1|  hypothetical protein L915_11579                       85.5    5e-16    
ref|WP_035529505.1|  SAM-dependent methlyltransferase                 83.6    7e-16    
ref|WP_038294054.1|  hypothetical protein                             83.6    8e-16    
gb|KGT03169.1|  ubiE/COQ5 methyltransferase family protein            82.8    1e-15    
ref|WP_042643251.1|  SAM-dependent methlyltransferase                 82.0    2e-15    
ref|XP_005843496.1|  hypothetical protein CHLNCDRAFT_141021           79.7    4e-15    
ref|WP_023763768.1|  SAM-dependent methlyltransferase                 81.3    5e-15    
ref|WP_027054000.1|  SAM-dependent methlyltransferase                 80.9    7e-15    
ref|WP_027023426.1|  SAM-dependent methlyltransferase                 80.9    7e-15    
gb|AGH25525.1|  phosphoethanolamine N-methyltransferase               77.0    8e-15    
ref|WP_020055656.1|  hypothetical protein                             80.5    9e-15    
ref|WP_013892685.1|  SAM-dependent methlyltransferase                 80.5    1e-14    
ref|WP_027166568.1|  SAM-dependent methlyltransferase                 79.7    2e-14    
ref|WP_042628692.1|  methyltransferase                                79.7    2e-14    
gb|ACY01395.1|  O-methyl transferase                                  79.7    2e-14    
ref|WP_006606849.1|  type 11 methyltransferase                        79.7    2e-14    
ref|WP_023776863.1|  SAM-dependent methlyltransferase                 79.0    3e-14    
ref|WP_040998713.1|  SAM-dependent methlyltransferase                 79.0    3e-14    
ref|WP_027031419.1|  SAM-dependent methlyltransferase                 79.0    3e-14    
ref|WP_030735454.1|  hypothetical protein                             79.0    4e-14    
ref|WP_041000231.1|  SAM-dependent methlyltransferase                 78.2    5e-14    
ref|WP_019861572.1|  SAM-dependent methlyltransferase                 78.2    5e-14    
ref|WP_041906306.1|  hypothetical protein                             75.1    1e-13    
gb|AID32842.1|  methyltransferase domain protein                      76.3    1e-13    
ref|WP_020043824.1|  hypothetical protein                             76.6    2e-13    
ref|WP_031198834.1|  hypothetical protein                             76.6    2e-13    
ref|WP_027059070.1|  SAM-dependent methlyltransferase                 76.6    2e-13    
gb|ESZ37576.1|  methyltransferase                                     76.3    2e-13    
ref|WP_040985035.1|  SAM-dependent methlyltransferase                 75.5    4e-13    
ref|WP_010352920.1|  type 11 methyltransferase                        75.9    4e-13    
ref|WP_031198722.1|  MULTISPECIES: hypothetical protein               75.1    6e-13    
ref|WP_034360655.1|  methyltransferase                                75.1    7e-13    
gb|ESX41160.1|  hypothetical protein X762_30475                       74.7    8e-13    
ref|WP_037268547.1|  SAM-dependent methlyltransferase                 74.7    8e-13    
ref|WP_023720903.1|  SAM-dependent methlyltransferase                 74.7    8e-13    
gb|EKD64845.1|  methyltransferase type 11                             74.7    1e-12    
ref|WP_026404025.1|  methyltransferase type 11                        74.7    1e-12    
ref|WP_024922895.1|  MULTISPECIES: SAM-dependent methlyltransferase   74.3    1e-12    
ref|WP_033256340.1|  methyltransferase type 11                        74.7    1e-12    
gb|EHK58080.1|  type 11 methyltransferase                             74.3    1e-12    
ref|WP_040585126.1|  SAM-dependent methlyltransferase                 74.3    1e-12    
gb|ETM43020.1|  hypothetical protein L914_11418                       70.1    2e-12    
ref|WP_030080389.1|  MULTISPECIES: hypothetical protein               73.6    3e-12    
ref|WP_037209133.1|  SAM-dependent methlyltransferase                 73.2    3e-12    
ref|WP_037158542.1|  SAM-dependent methlyltransferase                 72.8    4e-12    
ref|WP_023756036.1|  MULTISPECIES: hypothetical protein               72.4    5e-12    
ref|WP_030923435.1|  methyltransferase type 11                        72.8    6e-12    
ref|WP_032931948.1|  SAM-dependent methlyltransferase                 72.0    9e-12    
ref|WP_040390322.1|  hypothetical protein                             72.0    1e-11    
ref|WP_026388035.1|  hypothetical protein                             71.6    1e-11    
ref|WP_041011247.1|  SAM-dependent methlyltransferase                 70.5    3e-11    
ref|WP_038308171.1|  hypothetical protein                             70.5    3e-11    
ref|WP_043186512.1|  hypothetical protein                             68.9    3e-11    
ref|WP_030463904.1|  methyltransferase type 11                        70.9    3e-11    
ref|WP_037310226.1|  hypothetical protein                             70.5    3e-11    
ref|WP_018814931.1|  hypothetical protein                             70.5    3e-11    
ref|WP_029386413.1|  hypothetical protein                             70.5    3e-11    
ref|WP_012787449.1|  methyltransferase type 11                        71.6    3e-11    
ref|WP_010911865.1|  SAM-dependent methlyltransferase                 70.1    4e-11    
ref|WP_034414270.1|  hypothetical protein                             70.1    4e-11    
ref|WP_033217970.1|  methyltransferase type 11                        70.1    4e-11    
emb|CDN15041.1|  Gamma-tocopherol C-methyltransferase                 69.3    6e-11    
ref|WP_018744778.1|  hypothetical protein                             69.7    6e-11    
ref|WP_040026629.1|  methyltransferase type 11                        69.3    8e-11    
ref|WP_037222369.1|  delta(24)-sterol C-methyltransferase             69.3    9e-11    
ref|WP_027289649.1|  hypothetical protein                             69.3    9e-11    
ref|WP_040485672.1|  SAM-dependent methlyltransferase                 68.6    1e-10    
ref|WP_009819402.1|  SAM-dependent methlyltransferase                 68.6    1e-10    
gb|AEZ64598.1|  Herf                                                  68.9    1e-10    
ref|WP_023514333.1|  type 11 methyltransferase                        68.6    1e-10    
ref|WP_016641933.1|  putative Demethylrebeccamycin-D-glucose O-me...  68.9    1e-10    
ref|WP_008183377.1|  methylase involved in ubiquinone/menaquinone...  68.6    2e-10    
gb|ESR24533.1|  methyl transferase-like protein                       68.6    2e-10    
ref|WP_023820202.1|  hypothetical protein                             67.8    2e-10    
gb|AGC24260.1|  PrlF                                                  68.2    3e-10    
ref|WP_039900615.1|  delta(24)-sterol C-methyltransferase             68.2    3e-10    
gb|EKD22724.1|  UbiE/COQ5 family methyltransferase                    67.0    3e-10    
ref|WP_015162190.1|  methylase involved in ubiquinone/menaquinone...  67.8    3e-10    
emb|CCI34341.1|  Tocopherol O-methyltransferase, chloroplastic        67.8    3e-10    
ref|WP_019507891.1|  delta(24)-sterol C-methyltransferase             67.8    4e-10    
ref|WP_018745107.1|  hypothetical protein                             67.4    4e-10    
ref|WP_041107317.1|  SAM-dependent methyltransferase                  67.4    4e-10    
ref|WP_043999694.1|  delta(24)-sterol C-methyltransferase             67.4    4e-10    
ref|WP_038841911.1|  methyltransferase type 11                        67.4    4e-10    
emb|CCI14044.1|  Tocopherol O-methyltransferase, chloroplastic        67.4    5e-10    
ref|WP_034273121.1|  methyltransferase type 11                        66.2    5e-10    
ref|WP_022472517.1|  methylase involved in ubiquinone/menaquinone...  66.2    6e-10    
ref|XP_002771524.1|  myst histone acetyltransferase, putative         68.6    7e-10    
ref|WP_043219017.1|  SAM-dependent methyltransferase                  66.6    7e-10    
ref|WP_032760362.1|  hypothetical protein                             63.9    7e-10    
ref|WP_015191057.1|  Tocopherol O-methyltransferase                   67.0    7e-10    
ref|WP_002803187.1|  delta(24)-sterol C-methyltransferase             66.6    7e-10    
ref|WP_030369216.1|  methyltransferase type 11                        66.6    8e-10    
gb|EPS69227.1|  hypothetical protein M569_05544                       67.4    8e-10    
ref|WP_028676530.1|  methyltransferase type 11                        66.6    8e-10    



>ref|XP_011072995.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Sesamum 
indicum]
Length=491

 Score =   329 bits (843),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLKCAVEFEVADCTKKEYPDGTFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYC+  G PS EFA YIKQRGYDLHD + YGQMLRDAGF++V
Sbjct  367  LFRSFYKWLKPGGKVLISDYCRNDGTPSTEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF+KVL+KEL+AVEKEKEAFIQDFSEEDY+DIVGGWK KL R+SSGEQRWGL
Sbjct  427  IAEDRTDQFIKVLEKELNAVEKEKEAFIQDFSEEDYSDIVGGWKAKLVRSSSGEQRWGL  485



>ref|XP_011084227.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   326 bits (836),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPA
Sbjct  310  HVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKEYPDGTFDVIYSRDTILHIQDKPA  369

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFY+WLKPGGKVLI+DYC+ SG PS EFA YIKQRGYDLHD + YGQMLRDAGF +V
Sbjct  370  LFRSFYRWLKPGGKVLISDYCRSSGTPSAEFAGYIKQRGYDLHDVDTYGQMLRDAGFAEV  429

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+KVL+KELDAVEK+KE FI+DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  430  IAEDRTEQFIKVLEKELDAVEKDKETFIRDFSEEDYNDIVGGWKAKLVRSSSGEQRWGL  488



>ref|XP_011084235.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Sesamum indicum]
Length=491

 Score =   326 bits (836),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKEYPDGTFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFY+WLKPGGKVLI+DYC+ SG PS EFA YIKQRGYDLHD + YGQMLRDAGF +V
Sbjct  367  LFRSFYRWLKPGGKVLISDYCRSSGTPSAEFAGYIKQRGYDLHDVDTYGQMLRDAGFAEV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+KVL+KELDAVEK+KE FI+DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  427  IAEDRTEQFIKVLEKELDAVEKDKETFIRDFSEEDYNDIVGGWKAKLVRSSSGEQRWGL  485



>ref|NP_001234549.1| phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
 gb|AAG59894.1|AF328858_1 phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=491

 Score =   326 bits (836),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDCTFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWL+PGGKVLI+DYCKR+GP S+EF  YIKQRGYDLHD E YGQMLRDAGF +V
Sbjct  367  LFRSFYKWLRPGGKVLISDYCKRAGPASKEFEGYIKQRGYDLHDVEAYGQMLRDAGFHEV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRT+QF+KVL+KELD VEKE+E+FI +FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  427  VAEDRTEQFIKVLQKELDTVEKERESFIHEFSEQDYNEIVGGWKSKLIRSSSGEQRWGL  485



>ref|XP_006341528.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341529.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=491

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDCTFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWL+PGGKVLI+DYCKR+GP S+EF  YIKQRGYDLHD E YGQMLRDAGF +V
Sbjct  367  LFRSFYKWLRPGGKVLISDYCKRAGPASKEFEGYIKQRGYDLHDVEAYGQMLRDAGFHEV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRT+QF++VL+KELD VEKE+E+FI +FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  427  VAEDRTEQFIEVLQKELDTVEKERESFIHEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  485



>ref|XP_009757363.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=491

 Score =   324 bits (830),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD  FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDGAFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYCK++G  SEEFA YIKQRGYDLHD E YGQMLRDAGF +V
Sbjct  367  LFRSFYKWLKPGGKVLISDYCKKAGTASEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRT+QF+ VL+KELD VEKE+E+FI DFSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  427  VAEDRTEQFIGVLQKELDTVEKERESFIHDFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  485



>ref|XP_002532097.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
 gb|EEF30287.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
Length=492

 Score =   324 bits (830),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VIGIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD +FDVIYSRDTILHIQDKPAL
Sbjct  309  VIGIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDNSFDVIYSRDTILHIQDKPAL  368

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYCK +G PS EFA YIKQRGYDLHD + YGQML+DAGF+DVI
Sbjct  369  FRSFYKWLKPGGKVLISDYCKSAGTPSSEFAEYIKQRGYDLHDVKAYGQMLKDAGFDDVI  428

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF +VLK+ELD +EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  429  AEDRTDQFNQVLKRELDVIEKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  486



>ref|XP_009776424.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=499

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+ IDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPA
Sbjct  315  HVVAIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPA  374

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFY+WLKPGGKVLI+DYCK  GP SEEFA YIKQRGYDLHD  EYGQMLRDAGF++V
Sbjct  375  LFRSFYRWLKPGGKVLISDYCKSPGPASEEFAGYIKQRGYDLHDVAEYGQMLRDAGFDEV  434

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+ VL+KEL+ VEKE+++FIQ+FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  435  IAEDRTEQFINVLQKELNTVEKERDSFIQEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  493



>ref|XP_009614862.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=499

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+ IDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPA
Sbjct  315  HVVAIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPA  374

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFY WLKPGGKVLI+DYCK  GP SEEFA YIKQRGYDLHD  EYGQMLRDAGF++V
Sbjct  375  LFRSFYNWLKPGGKVLISDYCKSPGPASEEFAGYIKQRGYDLHDVAEYGQMLRDAGFDEV  434

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+ VL+KEL+ VEKE+++FIQ+FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  435  IAEDRTEQFINVLQKELNTVEKERDSFIQEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  493



>ref|XP_004241642.1| PREDICTED: phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=494

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMIT+A ERAIG KCAVEFEVADCT KTYP+ +FDVIYSRDTILHIQDKPA
Sbjct  310  HVVGIDLSVNMITLAFERAIGRKCAVEFEVADCTVKTYPEESFDVIYSRDTILHIQDKPA  369

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGG+VLI+DYCK++GP SE+FAAYIKQRGYDLHD E YGQMLRDAGF +V
Sbjct  370  LFRSFYKWLKPGGRVLISDYCKKAGPASEDFAAYIKQRGYDLHDVEAYGQMLRDAGFNEV  429

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IA+DRT+QFM+VL+KELD VE E+E FIQ+FSE+DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  430  IADDRTEQFMQVLQKELDTVENERELFIQEFSEQDYNDIVGGWKAKLVRSSSGEQRWGL  488



>emb|CDO98349.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NM+++ALERAIGL+C+VEFEVADCTKKTYPD +FDVIYSRDTILHIQDKP
Sbjct  306  AHVVGIDLSINMVSLALERAIGLRCSVEFEVADCTKKTYPDGSFDVIYSRDTILHIQDKP  365

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            ALF+SFYKWLKPGG VLI+DYCKR+GPPS++F  YIKQRGYDLHD E YGQML+DAGF++
Sbjct  366  ALFKSFYKWLKPGGTVLISDYCKRAGPPSDDFVKYIKQRGYDLHDVEAYGQMLKDAGFDE  425

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRT QF+ VL+KEL+ VEK++EAFI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  426  VIAEDRTHQFINVLQKELELVEKDREAFISDFSEEDYNDIVGGWKAKLLRSSSGEQRWGL  485



>ref|XP_009616694.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   321 bits (823),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD  FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKTYPDGAFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYCK++G  SEEFA YIKQRGYDLHD E YGQMLRDAGF +V
Sbjct  367  LFRSFYKWLKPGGKVLISDYCKKAGTASEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRT+QF+ VL+KELD VEKE+++FI +FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  427  VAEDRTEQFVGVLQKELDTVEKERKSFIHEFSEQDYNEIVGGWKAKLIRSSSGEQRWGL  485



>gb|EYU24136.1| hypothetical protein MIMGU_mgv1a005261mg [Erythranthe guttata]
Length=491

 Score =   321 bits (822),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSINMISFALERAIGLKCAVEFEVADCTKKDYPDGTFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYCK +G  S +F  YIKQRGYDLHD E YGQMLRDAGF+DV
Sbjct  367  LFRSFYKWLKPGGKVLISDYCKNAGASSADFTEYIKQRGYDLHDVEAYGQMLRDAGFDDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QFM VL+KEL+AVEK+KE FI+DFS+EDY+DIVGGWK KL RTSSGEQRWGL
Sbjct  427  IAEDRTNQFMTVLEKELNAVEKDKETFIRDFSQEDYDDIVGGWKSKLVRTSSGEQRWGL  485



>ref|XP_006365411.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Solanum 
tuberosum]
Length=494

 Score =   321 bits (822),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMIT+A ERAIG KCAVEFEVADCT KTYP+ +FDVIYSRDTILHIQDKPA
Sbjct  310  HVVGIDLSVNMITLAFERAIGRKCAVEFEVADCTVKTYPEESFDVIYSRDTILHIQDKPA  369

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGG+VLI+DYCK+SGP SE+FA YIKQRGYDLHD E YGQMLRDAGF +V
Sbjct  370  LFRSFYKWLKPGGRVLISDYCKKSGPASEDFAVYIKQRGYDLHDVEAYGQMLRDAGFNEV  429

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QFMKVL+KELD VE E+E+FIQ+FSE+DY DIVGGWK KL R+SSGEQRWGL
Sbjct  430  IAEDRTEQFMKVLQKELDIVENERESFIQEFSEQDYYDIVGGWKAKLVRSSSGEQRWGL  488



>ref|XP_009782224.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=496

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            +V+GIDLS NMI++A ERAIG KCAVEFEVADCTK TYP+ TFDVIYSRDTILHIQDKPA
Sbjct  312  YVVGIDLSVNMISLAFERAIGRKCAVEFEVADCTKTTYPEGTFDVIYSRDTILHIQDKPA  371

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYCK++GP SEEFA YIKQRGYDLHD E YGQMLRDAGF +V
Sbjct  372  LFRSFYKWLKPGGKVLISDYCKKAGPASEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEV  431

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTR-TSSGEQRWGL  137
            +AEDRT+QF+KVL+KELD VEKE+E+FIQ+FSE+DYNDIVGGWK KL R TSSGEQRWGL
Sbjct  432  VAEDRTEQFIKVLQKELDTVEKERESFIQEFSEKDYNDIVGGWKAKLIRSTSSGEQRWGL  491



>ref|XP_011039130.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Populus 
euphratica]
Length=490

 Score =   319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  307  VVGIDLSINMISFALERAIGLKCSVEFEVADCTTKTYPDDTFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCKR+G PS EFA YIKQRGYDLHD E YGQMLRDAGF++VI
Sbjct  367  FRSFFKWLKPGGKVLISDYCKRAGTPSPEFAEYIKQRGYDLHDVEAYGQMLRDAGFDEVI  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF +VL +EL+A+EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  427  AEDRTDQFNQVLLRELNAIEKEKDEFILDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  484



>emb|CBI26879.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   318 bits (814),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+IALERAIG KC VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  292  VVGIDLSINMISIALERAIGRKCLVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPAL  351

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F+SF+KWLKPGGKVLITDYCKR+GPPS EF  YI+QRGYDLHD + YGQML+DAGF +VI
Sbjct  352  FKSFFKWLKPGGKVLITDYCKRAGPPSPEFQEYIEQRGYDLHDVKAYGQMLKDAGFCEVI  411

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+QF+KVL++E+DAVEK K+ FIQDFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  412  AEDRTEQFIKVLQREMDAVEKNKDEFIQDFSEEDYNEIVGGWKSKLNRSSSGEQRWGL  469



>ref|XP_009595958.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            +V+GIDLS NMI++A ERAIG KCAVEFEVADCTK TYP+ TFDVIYSRDTILHIQDK A
Sbjct  312  YVVGIDLSVNMISLAFERAIGRKCAVEFEVADCTKATYPEGTFDVIYSRDTILHIQDKLA  371

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYCKR+GP SEEFA YIKQRGYDLHD E YGQMLRDAGF +V
Sbjct  372  LFRSFYKWLKPGGKVLISDYCKRAGPASEEFAGYIKQRGYDLHDVEAYGQMLRDAGFNEV  431

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTR-TSSGEQRWGL  137
            +AEDRT+QF+KVL+KELD VEKE+E+FIQ+FSE+DYNDIVGGWK KL R TSSGEQRWGL
Sbjct  432  VAEDRTEQFIKVLQKELDTVEKERESFIQEFSEQDYNDIVGGWKAKLIRSTSSGEQRWGL  491



>ref|XP_002317876.2| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
 gb|EEE96096.2| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
Length=356

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  173  VVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPAL  232

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCK +G PS EFA YIKQRGYDLHD + YGQMLRDAGF++VI
Sbjct  233  FRSFFKWLKPGGKVLISDYCKCAGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVI  292

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF +VL +EL A+EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  293  AEDRTDQFNQVLLRELKAIEKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  350



>ref|XP_006376720.1| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
 gb|ERP54517.1| hypothetical protein POPTR_0012s044901g, partial [Populus trichocarpa]
Length=355

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  172  VVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPAL  231

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCK +G PS EFA YIKQRGYDLHD + YGQMLRDAGF++VI
Sbjct  232  FRSFFKWLKPGGKVLISDYCKCAGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVI  291

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF +VL +EL A+EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  292  AEDRTDQFNQVLLRELKAIEKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  349



>ref|XP_004299531.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=500

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE++IGLKCAVEFEVADCT KTYPD +FDVIYSRDTILHIQDKPAL
Sbjct  317  VVGIDLSVNMISFALEQSIGLKCAVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPAL  376

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLITDYC+ +G PS EFA YIKQRGYDLHD + YGQML DAGF DV+
Sbjct  377  FRSFYKWLKPGGKVLITDYCRSAGTPSAEFAEYIKQRGYDLHDVKAYGQMLTDAGFVDVV  436

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL++EL+AVEK+KEAFI+DFSEEDYNDIVGGWK KL RT+SGEQ+WGL
Sbjct  437  AEDRTDQFIRVLQRELNAVEKDKEAFIKDFSEEDYNDIVGGWKAKLVRTNSGEQKWGL  494



>ref|XP_010655650.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Vitis vinifera]
Length=494

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+IALERAIG KC VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  311  VVGIDLSINMISIALERAIGRKCLVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPAL  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F+SF+KWLKPGGKVLITDYCKR+GPPS EF  YI+QRGYDLHD + YGQML+DAGF +VI
Sbjct  371  FKSFFKWLKPGGKVLITDYCKRAGPPSPEFQEYIEQRGYDLHDVKAYGQMLKDAGFCEVI  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+QF+KVL++E+DAVEK K+ FIQDFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  431  AEDRTEQFIKVLQREMDAVEKNKDEFIQDFSEEDYNEIVGGWKSKLNRSSSGEQRWGL  488



>ref|XP_006843796.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
 gb|ERN05471.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
Length=489

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ A+ERAIG KCAVEFEVADCTKKTYPD TFDV+YSRDTILHIQDKP+L
Sbjct  306  VVGIDLSINMISFAIERAIGRKCAVEFEVADCTKKTYPDNTFDVMYSRDTILHIQDKPSL  365

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+F+KWLKPGGKVLI+DYCKRSGPPS EFA YIKQRGYDLHD E YGQMLRDAGF DV 
Sbjct  366  FRTFFKWLKPGGKVLISDYCKRSGPPSPEFAEYIKQRGYDLHDVEAYGQMLRDAGFHDVT  425

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF+KVL+KELDAVEK+K++FI DFSEEDY DIV GWK KL R+S GEQRWGL
Sbjct  426  AEDRTDQFLKVLQKELDAVEKDKDSFIGDFSEEDYFDIVNGWKAKLKRSSGGEQRWGL  483



>ref|XP_002284594.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Vitis vinifera]
Length=490

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+IALERAIG KC VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  307  VVGIDLSINMISIALERAIGRKCLVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F+SF+KWLKPGGKVLITDYCKR+GPPS EF  YI+QRGYDLHD + YGQML+DAGF +VI
Sbjct  367  FKSFFKWLKPGGKVLITDYCKRAGPPSPEFQEYIEQRGYDLHDVKAYGQMLKDAGFCEVI  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+QF+KVL++E+DAVEK K+ FIQDFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  427  AEDRTEQFIKVLQREMDAVEKNKDEFIQDFSEEDYNEIVGGWKSKLNRSSSGEQRWGL  484



>gb|AAG52075.1|AC012679_13 putative S-adenosyl-methionine-sterol-C-methyltransferase, 5' 
partial; 1-1344 [Arabidopsis thaliana]
Length=295

 Score =   310 bits (794),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  112  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  171

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR FYKWLKPGGKVLITDYC+    PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VI
Sbjct  172  FRRFYKWLKPGGKVLITDYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVI  231

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  232  AEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  289



>gb|EYU33965.1| hypothetical protein MIMGU_mgv1a005263mg [Erythranthe guttata]
Length=491

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALE AIGL CAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALEHAIGLNCAVEFEVADCTKKEYPDGTFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYC+  G PS EFA YIKQRGYDLHD + Y QML DAGF++V
Sbjct  367  LFRSFYKWLKPGGKVLISDYCRNVGSPSAEFAEYIKQRGYDLHDVKAYSQMLGDAGFDEV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF+KVL+KELDAVEK+KE FI+DFSEEDYN+IVGGWK KL R+SSGEQRWGL
Sbjct  427  IAEDRTDQFIKVLEKELDAVEKDKEEFIRDFSEEDYNEIVGGWKAKLVRSSSGEQRWGL  485



>ref|XP_008240154.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Prunus mume]
Length=485

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKCAVEFEVADCT+KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  302  VVGIDLSVNMISFALEHAIGLKCAVEFEVADCTQKTYPDDTFDVIYSRDTILHIQDKPAL  361

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLHD + YGQML+DAGF++VI
Sbjct  362  FRSFYKWLKPGGKVLISDYCRSAGTPSAEFAEYIKQRGYDLHDVQAYGQMLKDAGFDEVI  421

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF +VL++ELDAVEK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  422  AEDRTDQFKEVLQRELDAVEKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  479



>ref|XP_010033717.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW84063.1| hypothetical protein EUGRSUZ_B00946 [Eucalyptus grandis]
Length=491

 Score =   316 bits (810),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKK+YPD TFDVIYSRDTILHIQDKPAL
Sbjct  308  VVGIDLSINMISFALERAIGLKCSVEFEVADCTKKSYPDNTFDVIYSRDTILHIQDKPAL  367

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCK +G PS EFAAYIKQRGYDLHD + YGQMLRDAGF +VI
Sbjct  368  FRSFFKWLKPGGKVLISDYCKHAGTPSPEFAAYIKQRGYDLHDVKAYGQMLRDAGFAEVI  427

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF+KVL+KEL+AVEK+K+ FI DFSEEDYNDIVGGWK KL R+SS EQ WGL
Sbjct  428  AEDRTDQFIKVLEKELNAVEKDKDTFISDFSEEDYNDIVGGWKAKLMRSSSSEQCWGL  485



>ref|XP_008240152.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Prunus mume]
Length=491

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKCAVEFEVADCT+KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  308  VVGIDLSVNMISFALEHAIGLKCAVEFEVADCTQKTYPDDTFDVIYSRDTILHIQDKPAL  367

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLHD + YGQML+DAGF++VI
Sbjct  368  FRSFYKWLKPGGKVLISDYCRSAGTPSAEFAEYIKQRGYDLHDVQAYGQMLKDAGFDEVI  427

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF +VL++ELDAVEK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  428  AEDRTDQFKEVLQRELDAVEKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  485



>dbj|BAC57432.1| phosphoethanolamine N-methyltransferase [Suaeda japonica]
Length=494

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+G DLS NMI+ ALER+IGLKCAVEFEVADCTK  YPD +FDVIYSRDTILHIQDKPAL
Sbjct  311  VVGFDLSVNMISFALERSIGLKCAVEFEVADCTKINYPDNSFDVIYSRDTILHIQDKPAL  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYCK++GPPS EFAAYIKQRGYDLHD +EYGQML+DAGF DV+
Sbjct  371  FRSFYKWLKPGGKVLISDYCKKAGPPSPEFAAYIKQRGYDLHDVKEYGQMLKDAGFVDVL  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+QF++VL+KEL+ VEKEK+ FI DFSEEDYNDIVGGW  KL RT+ GEQRWGL
Sbjct  431  AEDRTEQFIRVLRKELETVEKEKDVFISDFSEEDYNDIVGGWNDKLRRTAKGEQRWGL  488



>gb|ABG57185.1| phosphoethanolamine N-methyltransferase [Salicornia europaea]
Length=494

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKKTYPD++F VIYSRDTILHIQDKP L
Sbjct  311  VVGIDLSVNMISFALERSIGLKCAVEFEVADCTKKTYPDSSFGVIYSRDTILHIQDKPEL  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPG KVLI+DYCK++GPPS EFA+YIKQRGYDLHD +EYGQML+DAGF DVI
Sbjct  371  FRTFYKWLKPGDKVLISDYCKKAGPPSPEFASYIKQRGYDLHDVKEYGQMLKDAGFIDVI  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL+KEL+ VEKEK+ FI DFSEEDYNDIVGGW  KL RT+ GEQRWGL
Sbjct  431  AEDRTDQFIRVLQKELETVEKEKDEFISDFSEEDYNDIVGGWNAKLQRTAKGEQRWGL  488



>gb|KDP23923.1| hypothetical protein JCGZ_27083 [Jatropha curcas]
Length=491

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  308  VVGIDLSVNMISFALERAIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPAL  367

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGK+LITDYCK +G PSEEFA YIKQRGYDLH  + YGQMLRDAGF+DVI
Sbjct  368  FRSFYKWLKPGGKILITDYCKSAGTPSEEFAEYIKQRGYDLHCVKAYGQMLRDAGFDDVI  427

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF +VL++ELDA EK K+ FI DFSE+DYNDI+ GWK KL R+SSGEQRWGL
Sbjct  428  AEDRTDQFNQVLQQELDATEKIKDEFITDFSEKDYNDIIDGWKAKLIRSSSGEQRWGL  485



>ref|XP_006490771.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=489

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKKTYP+ +FDVIYSRDTILHIQDKPA
Sbjct  305  HVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHIQDKPA  364

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SF+KWLKPGG VLI+DYCK  G PS EF+ YIKQRGYDLHD + YGQML+DAGF D+
Sbjct  365  LFKSFFKWLKPGGTVLISDYCKSFGTPSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDI  424

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF++VL++ELDA+EK+K+AFI+DFSEEDYNDIVGGWK KL RTS+GEQRWGL
Sbjct  425  IAEDRTEQFVQVLQRELDAIEKDKDAFIKDFSEEDYNDIVGGWKAKLIRTSAGEQRWGL  483



>ref|XP_006451624.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
 ref|XP_006490770.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR64864.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
Length=492

 Score =   314 bits (804),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKKTYP+ +FDVIYSRDTILHIQDKPA
Sbjct  308  HVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHIQDKPA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SF+KWLKPGG VLI+DYCK  G PS EF+ YIKQRGYDLHD + YGQML+DAGF D+
Sbjct  368  LFKSFFKWLKPGGTVLISDYCKSFGTPSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDI  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF++VL++ELDA+EK+K+AFI+DFSEEDYNDIVGGWK KL RTS+GEQRWGL
Sbjct  428  IAEDRTEQFVQVLQRELDAIEKDKDAFIKDFSEEDYNDIVGGWKAKLIRTSAGEQRWGL  486



>ref|XP_011014101.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Populus euphratica]
Length=490

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  307  VVGIDLSINMISFALERAIGLKCSVEFEVADCTTKTYPDDTFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCK +G PS EFA YIKQRGYDLHD E YGQMLRDAGF++VI
Sbjct  367  FRSFFKWLKPGGKVLISDYCKHAGTPSPEFAEYIKQRGYDLHDVEAYGQMLRDAGFDEVI  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AED TDQF +VL +EL+A+EKEK+ FI DFSEEDYNDIVGGWK KL R+SSGEQRWGL
Sbjct  427  AEDLTDQFNQVLLRELNAIEKEKDEFILDFSEEDYNDIVGGWKAKLIRSSSGEQRWGL  484



>ref|XP_002282182.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Vitis 
vinifera]
 emb|CBI15568.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   313 bits (803),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NM++ ALERAIGLKC+VEFEVADCTKK+YPD TFDVIYSRDTILHIQDKPAL
Sbjct  308  VVGIDLSINMVSFALERAIGLKCSVEFEVADCTKKSYPDNTFDVIYSRDTILHIQDKPAL  367

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F+SF+KWLKPGGKVLI+DYCKR+GPPS EF+ YIKQRGYDLHD E YG+MLRDAGF +VI
Sbjct  368  FKSFFKWLKPGGKVLISDYCKRAGPPSSEFSEYIKQRGYDLHDVEAYGEMLRDAGFIEVI  427

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL++EL+AVE  K  F+QDFSE+DYN+IV GWK KL R+SSGEQRWGL
Sbjct  428  AEDRTDQFLQVLQRELNAVETNKNEFVQDFSEDDYNEIVDGWKAKLMRSSSGEQRWGL  485



>ref|XP_002891445.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67704.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLITDYC+ +  PS +FA YI+QRGYDLHD + YGQML+DAGFEDV
Sbjct  367  LFRAFFKWLKPGGKVLITDYCRSAETPSPDFAEYIEQRGYDLHDVQAYGQMLKDAGFEDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++ELD VEKEKE FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  427  IAEDRTDQFVRVLRRELDKVEKEKEEFISDFSEEDYNDIVGGWTAKLERTASGEQKWGL  485



>gb|ABK42071.1| phosphoethanolamine N-methyltransferase [Suaeda liaotungensis]
Length=494

 Score =   313 bits (803),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+G DLS NMI+ ALER+IGLKCAVEFEVADCTK  YPD +FDVIYSRDTILHIQDKPAL
Sbjct  311  VVGFDLSVNMISFALERSIGLKCAVEFEVADCTKINYPDNSFDVIYSRDTILHIQDKPAL  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYCK++GPPS EFAAYIKQRGYDLHD +EYGQML+DAGF DV+
Sbjct  371  FRSFYKWLKPGGKVLISDYCKKAGPPSPEFAAYIKQRGYDLHDVKEYGQMLKDAGFVDVL  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+QF++VL+KEL+ VEKEK+ FI DFSEEDYN+IVGGW  KL RT+ GEQRWGL
Sbjct  431  AEDRTEQFIRVLRKELETVEKEKDVFISDFSEEDYNEIVGGWNDKLRRTAKGEQRWGL  488



>gb|AFZ78648.1| methyl transferase [Populus tomentosa]
Length=485

 Score =   313 bits (802),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  302  VVGIDLSINMISFALERAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPAL  361

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCK +G PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+
Sbjct  362  FRSFFKWLKPGGKVLISDYCKCAGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVV  421

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF KVL++EL+A+EK+K+ FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  422  AEDRTDQFNKVLQRELNAIEKDKDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  479



>ref|XP_011008809.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Populus euphratica]
Length=490

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  307  VVGIDLSINMISFALERAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCK SG PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+
Sbjct  367  FRSFFKWLKPGGKVLISDYCKCSGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVV  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF K+L++EL+A+EK+K+ FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  427  AEDRTDQFNKLLQRELNAIEKDKDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  484



>gb|AFW04224.1| phosphoethanolamine N-methyl transferase [Suaeda maritima]
Length=494

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+G DLS NMI+ ALER+IG KCAVEFEVADCTK  YPD +FDVIYSRDTILHIQDKPAL
Sbjct  311  VVGFDLSVNMISFALERSIGPKCAVEFEVADCTKINYPDNSFDVIYSRDTILHIQDKPAL  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYCK++GPPS EFAAYIKQRGYDLHD +EYGQML+DAGF DV+
Sbjct  371  FRSFYKWLKPGGKVLISDYCKKAGPPSPEFAAYIKQRGYDLHDVKEYGQMLKDAGFVDVL  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+QF++VL+KEL+ VEKEK+ FI DFSEEDYNDIVGGW  KL RT+ GEQRWGL
Sbjct  431  AEDRTEQFIRVLRKELETVEKEKDVFISDFSEEDYNDIVGGWNDKLRRTAKGEQRWGL  488



>emb|CAN64744.1| hypothetical protein VITISV_041321 [Vitis vinifera]
Length=490

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NM++ ALERAIGLKC+VEFEVADCTKK+YPD TFDVIYSRDTILHIQDKPAL
Sbjct  307  VVGIDLSINMVSFALERAIGLKCSVEFEVADCTKKSYPDNTFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F+SF+KWLKPGGKVLI+DYCKR+GPPS EF+ YIKQRGYDLH+ E YG+MLRDAGF +VI
Sbjct  367  FKSFFKWLKPGGKVLISDYCKRAGPPSSEFSEYIKQRGYDLHBVEAYGEMLRDAGFIEVI  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL +EL+AVE  K  F+QDFSE+DYN+IV GWK KL R+SSGEQRWGL
Sbjct  427  AEDRTDQFLQVLXRELNAVETNKNEFVQDFSEDDYNEIVDGWKAKLMRSSSGEQRWGL  484



>ref|XP_011008808.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Populus euphratica]
Length=506

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  323  VVGIDLSINMISFALERAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPAL  382

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCK SG PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+
Sbjct  383  FRSFFKWLKPGGKVLISDYCKCSGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVV  442

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF K+L++EL+A+EK+K+ FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  443  AEDRTDQFNKLLQRELNAIEKDKDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  500



>emb|CBI26877.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+IAL+RAIG    VEFEVADCTKKTYPD+TFDVIYSRDTILHIQDKPAL
Sbjct  299  VVGIDLSINMISIALDRAIGRNRLVEFEVADCTKKTYPDSTFDVIYSRDTILHIQDKPAL  358

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCKRSGPPS EF AYI QRGYDLHD E YGQML+DAGF++VI
Sbjct  359  FRSFFKWLKPGGKVLISDYCKRSGPPSPEFEAYIGQRGYDLHDVEAYGQMLKDAGFDEVI  418

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL+KE+D++EKEK+ FI DFSEEDY DIVGGWK KL R+S GEQRWGL
Sbjct  419  AEDRTDQFIEVLQKEMDSIEKEKDKFISDFSEEDYKDIVGGWKSKLVRSSMGEQRWGL  476



>ref|XP_010533969.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Tarenaya 
hassleriana]
Length=491

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+ +  PS EFA YIKQRGYDLHD + YGQML+DAGF+DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCRSAKTPSLEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQFM+VL++ELD VE EKE FI+DFSEEDY+DIVGGWK KL R++SGEQ+WGL
Sbjct  427  IAEDRTDQFMQVLQRELDKVEMEKEEFIRDFSEEDYDDIVGGWKAKLERSASGEQKWGL  485



>ref|XP_010655490.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Vitis vinifera]
 ref|XP_010655528.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Vitis vinifera]
Length=468

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+IAL+RAIG    VEFEVADCTKKTYPD+TFDVIYSRDTILHIQDKPAL
Sbjct  283  VVGIDLSINMISIALDRAIGRNRLVEFEVADCTKKTYPDSTFDVIYSRDTILHIQDKPAL  342

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCKRSGPPS EF AYI QRGYDLHD E YGQML+DAGF++VI
Sbjct  343  FRSFFKWLKPGGKVLISDYCKRSGPPSPEFEAYIGQRGYDLHDVEAYGQMLKDAGFDEVI  402

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL+KE+D++EKEK+ FI DFSEEDY DIVGGWK KL R+S GEQRWGL
Sbjct  403  AEDRTDQFIEVLQKEMDSIEKEKDKFISDFSEEDYKDIVGGWKSKLVRSSMGEQRWGL  460



>ref|XP_007209942.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11141.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=491

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKCAVEFEVADCT+KTY D TFDVIYSRDTILHIQDKPAL
Sbjct  308  VVGIDLSVNMISFALERAIGLKCAVEFEVADCTQKTYADDTFDVIYSRDTILHIQDKPAL  367

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFY+WLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLH+ + YGQML+DAGF++VI
Sbjct  368  FRSFYRWLKPGGKVLISDYCRSAGTPSAEFAEYIKQRGYDLHNVQAYGQMLKDAGFDEVI  427

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF +VL++ELDAVEK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  428  AEDRTDQFKEVLQRELDAVEKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  485



>gb|KJB30118.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=363

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPA
Sbjct  178  HVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPA  237

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ +
Sbjct  238  LFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVI  297

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  298  LAEDRTDQFLQVLQRELNQVEKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  356



>ref|XP_009385384.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIG KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+L
Sbjct  314  VVGIDLSINMISFALERAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPSL  373

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F+ F+KWLKPGGKVLI+DYCK+SG PSE+FAAYIKQRGYDLHD ++YGQMLRDAGF +VI
Sbjct  374  FKGFFKWLKPGGKVLISDYCKKSGTPSEDFAAYIKQRGYDLHDVDDYGQMLRDAGFHEVI  433

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+QF++VL+KELDAVEK+KEAFI DFS+EDY++IV GWK KL R+ +GEQRWGL
Sbjct  434  AEDRTNQFLEVLQKELDAVEKDKEAFIHDFSQEDYDEIVSGWKAKLKRSWTGEQRWGL  491



>ref|XP_010677350.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=449

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+IALERA+GL CAVEFEVADCT  TYPD  FDVIYSRDTILHIQDKPAL
Sbjct  263  VVGIDLSINMISIALERAVGLNCAVEFEVADCTTITYPDNAFDVIYSRDTILHIQDKPAL  322

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYC+ +G  S EFA YIKQRGYDLHD + YGQMLRDAGF++VI
Sbjct  323  FRSFYKWLKPGGKVLISDYCRSAGTASPEFAEYIKQRGYDLHDVQAYGQMLRDAGFDEVI  382

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF KVL++EL+AVEKEKE FI DFSEEDY+ IVGGWK KL R SSGEQRWGL
Sbjct  383  AEDRTDQFSKVLERELNAVEKEKERFITDFSEEDYDAIVGGWKSKLVRVSSGEQRWGL  440



>ref|NP_177501.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9C6B9.2|PEAM3_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35481.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=490

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  307  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR FYKWLKPGGKVLITDYC+    PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VI
Sbjct  367  FRRFYKWLKPGGKVLITDYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVI  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  427  AEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  484



>ref|NP_974139.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35480.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=504

 Score =   311 bits (797),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  321  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  380

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR FYKWLKPGGKVLITDYC+    PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VI
Sbjct  381  FRRFYKWLKPGGKVLITDYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVI  440

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  441  AEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  498



>pir||H96762 hypothetical protein F6D5.1 [imported] - Arabidopsis thaliana
 gb|AAG51806.1|AC079676_1 phosphoethanolamine N-methyltransferase, putative; 6854-3993 
[Arabidopsis thaliana]
Length=555

 Score =   313 bits (801),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  372  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  431

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR FYKWLKPGGKVLITDYC+    PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VI
Sbjct  432  FRRFYKWLKPGGKVLITDYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVI  491

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  492  AEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  549



>ref|XP_002887491.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63750.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD  FDVIYSRDTILHIQDKPAL
Sbjct  307  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNIFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQMLRDAGFE+V 
Sbjct  367  FRTFYKWLKPGGKVLITDYCRSPKTPSSDFANYIKQRGYDLHDVQAYGQMLRDAGFEEVT  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  427  AEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  484



>ref|XP_010428286.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Camelina sativa]
Length=492

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  309  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  368

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGFE+VI
Sbjct  369  FRTFYKWLKPGGKILITDYCRSPKTPSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVI  428

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  429  AEDRTDQFMKVLKRELDAVEKEKDEFISDFSQEDYEDIVGGWNSKLLRSSSGEQKWGL  486



>ref|XP_010274723.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Nelumbo nucifera]
Length=489

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V GIDLS NMI+ ALE AIG KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  307  VFGIDLSINMISFALEHAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F+SF+KWLKPGGKVLI+DYCKR+G PS+EFA YI+QRGY LHD E YGQML+DAGF++VI
Sbjct  367  FKSFFKWLKPGGKVLISDYCKRAGSPSKEFAQYIEQRGYGLHDVEAYGQMLKDAGFKEVI  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+QF++VL++ELDAVEK +EAFI DFSEEDY++IVGGWK KL R+SSGEQRWGL
Sbjct  427  AEDRTNQFIEVLQRELDAVEKAREAFIHDFSEEDYDEIVGGWKAKLVRSSSGEQRWGL  484



>dbj|BAE07178.1| phosphoethanolamine N-methyltransferase [Beta vulgaris]
Length=494

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKK YP+ +FDVIYSRDTILHIQDKPAL
Sbjct  311  VVGIDLSINMISFALERSIGLKCAVEFEVADCTKKPYPEQSFDVIYSRDTILHIQDKPAL  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLI+DYCK SGPPS EFA YIKQRGYDLHD E YGQML+DAGF DVI
Sbjct  371  FRNFYKWLKPGGKVLISDYCKSSGPPSAEFAMYIKQRGYDLHDVEAYGQMLKDAGFVDVI  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            A+D+TDQF++VL+KELD++EKEK+ FI DFSE DYNDIV GWK KL RT  GEQRWGL
Sbjct  431  AQDKTDQFIQVLQKELDSLEKEKDKFIADFSEGDYNDIVDGWKAKLIRTKVGEQRWGL  488



>ref|XP_010686587.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKK YP+ +FDVIYSRDTILHIQDKPAL
Sbjct  311  VVGIDLSINMISFALERSIGLKCAVEFEVADCTKKPYPEQSFDVIYSRDTILHIQDKPAL  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLI+DYCK SGPPS EFA YIKQRGYDLHD E YGQML+DAGF DVI
Sbjct  371  FRNFYKWLKPGGKVLISDYCKSSGPPSAEFAMYIKQRGYDLHDVEAYGQMLKDAGFVDVI  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            A+D+TDQF++VL+KELD++EKEK+ FI DFSE DYNDIV GWK KL RT  GEQRWGL
Sbjct  431  AQDKTDQFIQVLQKELDSLEKEKDKFIADFSEGDYNDIVDGWKAKLIRTKVGEQRWGL  488



>ref|XP_006302164.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
 gb|EOA35062.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
Length=503

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  320  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  379

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGFE+VI
Sbjct  380  FRTFYKWLKPGGKILITDYCRSPKTPSSDFANYIKQRGYDLHDVQAYGQMLKDAGFEEVI  439

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  440  AEDRTDQFMKVLKRELDAVEKEKDEFISDFSKEDYEDIVGGWSSKLLRSSSGEQKWGL  497



>gb|AGI56231.1| phosphoethanolamine N-methyltransferase [Lycium barbarum]
Length=498

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+ IDLS NMI+ ALER+IG+KCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPA
Sbjct  315  HVVAIDLSINMISFALERSIGIKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPA  374

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYC+   P SEE A YIKQRGYDLHD   YGQMLRDAGF++V
Sbjct  375  LFRSFYKWLKPGGKVLISDYCRSPEPASEELAGYIKQRGYDLHDVAAYGQMLRDAGFDEV  434

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT QF+ VL+KEL+ VEKE+++FIQ+FSE+DYN+IVG WK KL R+SSGEQRWGL
Sbjct  435  IAEDRTAQFINVLQKELNTVEKERDSFIQEFSEQDYNEIVGSWKAKLIRSSSGEQRWGL  493



>gb|KFK41794.1| hypothetical protein AALP_AA2G173000 [Arabis alpina]
Length=505

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  322  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  381

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGF +VI
Sbjct  382  FRTFYKWLKPGGKVLITDYCRSPKTPSADFANYIKQRGYDLHDVQAYGQMLKDAGFNEVI  441

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  442  AEDRTDQFMKVLKRELDAVEKEKDDFISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  499



>ref|XP_010428285.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Camelina sativa]
Length=504

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  321  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  380

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGFE+VI
Sbjct  381  FRTFYKWLKPGGKILITDYCRSPKTPSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVI  440

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  441  AEDRTDQFMKVLKRELDAVEKEKDEFISDFSQEDYEDIVGGWNSKLLRSSSGEQKWGL  498



>dbj|BAE99185.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
Length=504

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  321  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  380

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR FYKWLKPGGKVLI DYC+    PS +FA YIK+RGYDLHD + YGQMLRDAGFE+VI
Sbjct  381  FRRFYKWLKPGGKVLIADYCRSPKTPSPDFAIYIKKRGYDLHDVQAYGQMLRDAGFEEVI  440

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEKE FI DFS+EDY DI+GGWK KL R+SSGEQ+WGL
Sbjct  441  AEDRTDQFMKVLKRELDAVEKEKEEFISDFSKEDYEDIIGGWKSKLLRSSSGEQKWGL  498



>dbj|BAC57960.1| phosphoethanolamine N-methyltransferase [Aster tripolium]
Length=493

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VIGIDLS NMI  ALER+IGL+C+VEFEVADCTKK+YPD +FDVIYSRDTILHIQDKPAL
Sbjct  310  VIGIDLSVNMIAFALERSIGLQCSVEFEVADCTKKSYPDNSFDVIYSRDTILHIQDKPAL  369

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLI+DYC++SG PSE+FA YIKQRGYDLHD E YG+ML+DAGF +VI
Sbjct  370  FRTFYKWLKPGGKVLISDYCRKSGKPSEDFAEYIKQRGYDLHDVETYGKMLKDAGFGEVI  429

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT QF++VL++EL+ VEKEKE FIQDF+E DYNDIVGGWK KL RT SGEQRWGL
Sbjct  430  AEDRTKQFIEVLQRELERVEKEKEEFIQDFTEGDYNDIVGGWKAKLVRTGSGEQRWGL  487



>emb|CDY11100.1| BnaC06g23520D [Brassica napus]
Length=506

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  323  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  382

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGF++VI
Sbjct  383  FRTFYKWLKPGGKVLITDYCRSPKTPSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDEVI  442

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  443  AEDRTDQFMKVLKRELDAVEKEKDEFISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  500



>ref|XP_006393387.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
 gb|ESQ30673.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
Length=475

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  291  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDHSFDVIYSRDTILHIQDKPA  350

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF++F+KWLKPGGKVLITDYC+ +  PS  FA YIKQRGYDLHD + YGQML+DAGFEDV
Sbjct  351  LFKTFFKWLKPGGKVLITDYCRNAETPSPIFAEYIKQRGYDLHDVQAYGQMLKDAGFEDV  410

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL+ VEKEK+ FI DFSEEDYN+IVGGWK KL R++SGEQ+WGL
Sbjct  411  IAEDRTDQFVQVLRRELERVEKEKDEFINDFSEEDYNEIVGGWKAKLERSTSGEQKWGL  469



>ref|XP_010314226.1| PREDICTED: phosphoethanolamine N-methyltransferase isoform X2 
[Solanum lycopersicum]
Length=388

 Score =   305 bits (781),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+ IDLS NMI+ ALER+IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPA
Sbjct  204  HVVAIDLSINMISFALERSIGLKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPA  263

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYCK   P S++F+ YIKQRGYDLHD   YGQML+DAGF++V
Sbjct  264  LFRSFYKWLKPGGKVLISDYCKSPIPASDKFSEYIKQRGYDLHDVATYGQMLKDAGFDEV  323

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+ VL+KEL+ VEKE+++FI +FSE+DYN+IVGGW  KL R+SSGEQRWGL
Sbjct  324  IAEDRTEQFINVLQKELNTVEKERDSFIHEFSEQDYNEIVGGWTAKLLRSSSGEQRWGL  382



>ref|XP_007036802.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY21303.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=493

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIG+ C+VEFEVADCTKKTYPD +FDVIYSRDTILHIQDKPA
Sbjct  309  HVVGIDLSINMISFALERAIGMNCSVEFEVADCTKKTYPDNSFDVIYSRDTILHIQDKPA  368

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYCK +G PS EFA YI+QRGYDLHD E YGQ+L DAGF++V
Sbjct  369  LFRSFYKWLKPGGKVLISDYCKNAGTPSSEFAEYIEQRGYDLHDVEAYGQILSDAGFDEV  428

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF++VL++EL+ VEK+K+AF+  FS+EDY+DI+GGWK KL R+SSGEQRWGL
Sbjct  429  IAEDRTEQFLQVLQRELNEVEKDKDAFVSSFSQEDYDDILGGWKAKLIRSSSGEQRWGL  487



>emb|CDX68222.1| BnaA07g22620D [Brassica napus]
Length=506

 Score =   309 bits (791),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  323  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  382

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGF++VI
Sbjct  383  FRTFYKWLKPGGKVLITDYCRSPKTPSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDEVI  442

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  443  AEDRTDQFMKVLKRELDAVEKEKDDFISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  500



>ref|XP_008360927.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Malus domestica]
Length=492

 Score =   308 bits (790),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VIGIDLS NMI+ ALE++IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  309  VIGIDLSVNMISFALEQSIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPAL  368

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFY+WLKPGGKVLI+DYC+  G PSE FA YIKQRGYDLHD + YGQML+DAGF++VI
Sbjct  369  FRSFYEWLKPGGKVLISDYCRCVGTPSENFAEYIKQRGYDLHDVKAYGQMLKDAGFDEVI  428

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF  VL++ELDAVEK+K++F+QDFS+EDY+DI+GGWK KL R  SGEQ+WGL
Sbjct  429  AEDRTDQFKAVLERELDAVEKDKDSFVQDFSQEDYDDIIGGWKAKLIRVDSGEQKWGL  486



>gb|KJB30120.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=465

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPA
Sbjct  280  HVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPA  339

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ +
Sbjct  340  LFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVI  399

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  400  LAEDRTDQFLQVLQRELNQVEKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  458



>ref|XP_009104804.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 [Brassica 
rapa]
Length=506

 Score =   309 bits (791),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  323  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  382

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGF++VI
Sbjct  383  FRTFYKWLKPGGKVLITDYCRSPKTPSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDEVI  442

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  443  AEDRTDQFMKVLKRELDAVEKEKDDFISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  500



>ref|XP_008393424.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   308 bits (789),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VIGIDLS NMI+ ALE++IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  309  VIGIDLSVNMISFALEQSIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPAL  368

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFY+WLKPGGKVLI+DYC+  G PSE FA YIKQRGYDLHD + YGQML+DAGF++VI
Sbjct  369  FRSFYEWLKPGGKVLISDYCRCVGTPSENFAEYIKQRGYDLHDVKAYGQMLKDAGFDEVI  428

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF  VL++ELDAVEK+K++F+QDFS+EDY+DI+GGWK KL R  SGEQ+WGL
Sbjct  429  AEDRTDQFKAVLERELDAVEKDKDSFVQDFSQEDYDDIIGGWKAKLIRVDSGEQKWGL  486



>ref|XP_010461683.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=492

 Score =   308 bits (789),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  308  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YG+ML++AGFEDV
Sbjct  368  LFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGKMLKEAGFEDV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL+ VE+EKE FI DFS+EDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  428  IAEDRTDQFVQVLRRELEKVEREKEEFISDFSQEDYNDIVGGWTAKLERTASGEQKWGL  486



>gb|KJB30122.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=491

 Score =   308 bits (789),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPA
Sbjct  306  HVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPA  365

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ +
Sbjct  366  LFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVI  425

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  426  LAEDRTDQFLQVLQRELNQVEKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  484



>gb|KFK36082.1| hypothetical protein AALP_AA4G075100 [Arabis alpina]
Length=492

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  308  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF++F+KWLKPGGKVLITDYC+ +  PS  FA YIKQRGYDLHD + YGQML+DAGF DV
Sbjct  368  LFKTFFKWLKPGGKVLITDYCRNAETPSPIFAEYIKQRGYDLHDVQAYGQMLKDAGFVDV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGWK KL R++SGEQ+WGL
Sbjct  428  IAEDRTDQFVQVLRRELERVEKEKEEFISDFSEEDYNDIVGGWKSKLERSTSGEQKWGL  486



>ref|XP_010416170.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Camelina 
sativa]
Length=490

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  307  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDKTFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGFE+VI
Sbjct  367  FRTFYKWLKPGGKILITDYCRSPKTPSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVI  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF+KVLK+ELDAVEKEK+ FI+DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  427  AEDRTDQFVKVLKRELDAVEKEKDEFIRDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  484



>gb|KJB30117.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=494

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPA
Sbjct  309  HVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPA  368

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ +
Sbjct  369  LFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVI  428

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  429  LAEDRTDQFLQVLQRELNQVEKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  487



>ref|XP_008364653.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VIGIDLS NMI+ ALE+AIGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  309  VIGIDLSVNMISFALEQAIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPAL  368

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYC+ +G PSE FA YIKQRGYDLHD + YGQML+DAGF++VI
Sbjct  369  FRSFYKWLKPGGKVLISDYCRCAGTPSENFADYIKQRGYDLHDVKAYGQMLKDAGFDEVI  428

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF  VL++EL  VEK+K++F+QDFS+EDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  429  AEDRTDQFKAVLERELAXVEKDKDSFVQDFSQEDYDDIVGGWKAKLIRVDSGEQKWGL  486



>ref|XP_010471422.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  307  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGFE+VI
Sbjct  367  FRTFYKWLKPGGKILITDYCRSPKTPSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVI  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AED TDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  427  AEDSTDQFMKVLKRELDAVEKEKDEFISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  484



>ref|XP_006346642.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Solanum 
tuberosum]
Length=500

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+ IDLS NMI+ ALER+IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPA
Sbjct  316  HVVAIDLSINMISFALERSIGLKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPA  375

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFY+WLKPGGKVLI+DYCK   P S+EF+ YIKQRGYDLHD   YGQML+DA F++V
Sbjct  376  LFRSFYRWLKPGGKVLISDYCKCPIPASDEFSEYIKQRGYDLHDVATYGQMLKDASFDEV  435

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+ VL+KEL+ VEKE+++FIQ+FSE+DYN+IVGGWK KL R+SSGEQRWGL
Sbjct  436  IAEDRTEQFINVLQKELNTVEKERDSFIQEFSEQDYNEIVGGWKAKLLRSSSGEQRWGL  494



>ref|XP_006390538.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
 gb|ESQ27824.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
Length=504

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE +IGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  321  VVGIDLSVNMISFALEHSIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  380

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGF+DVI
Sbjct  381  FRTFYKWLKPGGKVLITDYCRSPKTPSPDFANYIKQRGYDLHDVQAYGQMLKDAGFDDVI  440

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFMKVLK+ELDAVEKEK+ FI DFS+EDY +IVGGW  KL R+SSGEQ+WGL
Sbjct  441  AEDRTDQFMKVLKRELDAVEKEKKEFISDFSKEDYEEIVGGWNSKLLRSSSGEQKWGL  498



>ref|XP_008799222.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X3 [Phoenix dactylifera]
Length=482

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIG KCAVEFEVADCT+KTYPD TFDVIYSRDTILHIQDKP L
Sbjct  299  VVGIDLSINMISFALERAIGRKCAVEFEVADCTRKTYPDNTFDVIYSRDTILHIQDKPML  358

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGK+LITDYCK S  PSE FA YIKQRGYDLHD E Y QML+DAGF +V+
Sbjct  359  FRSFFKWLKPGGKILITDYCKSSETPSEAFAEYIKQRGYDLHDVEAYSQMLKDAGFYEVV  418

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL++ELD VEK+K+AFIQ+FS+EDYN+IV GWK KL R+SSGEQRWGL
Sbjct  419  AEDRTDQFLEVLQRELDVVEKDKDAFIQEFSKEDYNEIVSGWKAKLKRSSSGEQRWGL  476



>ref|XP_010471421.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Camelina sativa]
Length=504

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALE AIGLKC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  321  VVGIDLSVNMISFALEHAIGLKCSVEFEVADCTKKEYPDNTFDVIYSRDTILHIQDKPAL  380

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGK+LITDYC+    PS +FA YIKQRGYDLHD + YGQML+DAGFE+VI
Sbjct  381  FRTFYKWLKPGGKILITDYCRSPKTPSPDFANYIKQRGYDLHDVQTYGQMLKDAGFEEVI  440

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AED TDQFMKVLK+ELDAVEKEK+ FI DFS+EDY DIVGGW  KL R+SSGEQ+WGL
Sbjct  441  AEDSTDQFMKVLKRELDAVEKEKDEFISDFSKEDYEDIVGGWNSKLLRSSSGEQKWGL  498



>ref|XP_008799221.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Phoenix dactylifera]
Length=492

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIG KCAVEFEVADCT+KTYPD TFDVIYSRDTILHIQDKP L
Sbjct  309  VVGIDLSINMISFALERAIGRKCAVEFEVADCTRKTYPDNTFDVIYSRDTILHIQDKPML  368

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGK+LITDYCK S  PSE FA YIKQRGYDLHD E Y QML+DAGF +V+
Sbjct  369  FRSFFKWLKPGGKILITDYCKSSETPSEAFAEYIKQRGYDLHDVEAYSQMLKDAGFYEVV  428

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL++ELD VEK+K+AFIQ+FS+EDYN+IV GWK KL R+SSGEQRWGL
Sbjct  429  AEDRTDQFLEVLQRELDVVEKDKDAFIQEFSKEDYNEIVSGWKAKLKRSSSGEQRWGL  486



>ref|XP_008799219.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Phoenix dactylifera]
Length=494

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIG KCAVEFEVADCT+KTYPD TFDVIYSRDTILHIQDKP L
Sbjct  311  VVGIDLSINMISFALERAIGRKCAVEFEVADCTRKTYPDNTFDVIYSRDTILHIQDKPML  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGK+LITDYCK S  PSE FA YIKQRGYDLHD E Y QML+DAGF +V+
Sbjct  371  FRSFFKWLKPGGKILITDYCKSSETPSEAFAEYIKQRGYDLHDVEAYSQMLKDAGFYEVV  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL++ELD VEK+K+AFIQ+FS+EDYN+IV GWK KL R+SSGEQRWGL
Sbjct  431  AEDRTDQFLEVLQRELDVVEKDKDAFIQEFSKEDYNEIVSGWKAKLKRSSSGEQRWGL  488



>ref|XP_010921161.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Elaeis 
guineensis]
Length=494

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIG KC++EFEVADCTKKTYPD TFDVIYSRDTILHIQDKP L
Sbjct  311  VVGIDLSINMISFALERAIGRKCSIEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPML  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGK+LITDYCK SG PSE FA YIKQRGYDLHD E YGQML+DAGF + +
Sbjct  371  FRSFFKWLKPGGKILITDYCKSSGTPSEAFAEYIKQRGYDLHDVEAYGQMLKDAGFYEAV  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL++ELDAVEK+K+AF+Q+FS+EDY++IV GWK KL R+S GEQRWGL
Sbjct  431  AEDRTDQFLEVLQRELDAVEKDKDAFVQEFSKEDYDEIVSGWKAKLKRSSFGEQRWGL  488



>ref|XP_009360079.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VIGIDLS NMI+ ALE++IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  309  VIGIDLSVNMISFALEQSIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPAL  368

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYC+ +G PSE FA YIKQRGYDLHD + YGQML DAGF +VI
Sbjct  369  FRSFYKWLKPGGKVLISDYCRGAGTPSENFAEYIKQRGYDLHDVKAYGQMLEDAGFYEVI  428

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF  VL++ELDA+EK+K++F+QDFS+ DY+DIVGGWK KL R  SGEQ+WGL
Sbjct  429  AEDRTDQFKAVLERELDAIEKDKDSFVQDFSQGDYDDIVGGWKAKLIRVDSGEQKWGL  486



>ref|XP_002322102.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
 gb|EEF06229.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
Length=516

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLK +VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  333  VVGIDLSINMISFALERAIGLKYSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPAL  392

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCK  G PS EFA YIKQRGYDLHD + YGQMLRDAGF++V+
Sbjct  393  FRSFFKWLKPGGKVLISDYCKCDGTPSPEFAEYIKQRGYDLHDVKAYGQMLRDAGFDEVV  452

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF KVL++EL+A+EK+K+ FI DFSE DYNDIVGGWK KL R+SSGEQRWGL
Sbjct  453  AEDRTDQFNKVLQRELNAIEKDKDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQRWGL  510



>emb|CDX95799.1| BnaC05g35500D [Brassica napus]
Length=481

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPA
Sbjct  297  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPENSFDVIYSRDTILHIQDKPA  356

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYCK S  PS EF+ YIKQRGYDLHD + YGQML+DAGF DV
Sbjct  357  LFRTFFKWLKPGGKVLISDYCKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKDAGFNDV  416

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQFM+VL++EL+ VEKEKE FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  417  IAEDRTDQFMQVLRRELERVEKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  475



>ref|XP_004252273.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Solanum lycopersicum]
Length=500

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+ IDLS NMI+ ALER+IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPA
Sbjct  316  HVVAIDLSINMISFALERSIGLKCAVEFEVADCTKKTYPDGTFDVIYSRDTILHIQDKPA  375

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGKVLI+DYCK   P S++F+ YIKQRGYDLHD   YGQML+DAGF++V
Sbjct  376  LFRSFYKWLKPGGKVLISDYCKSPIPASDKFSEYIKQRGYDLHDVATYGQMLKDAGFDEV  435

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+ VL+KEL+ VEKE+++FI +FSE+DYN+IVGGW  KL R+SSGEQRWGL
Sbjct  436  IAEDRTEQFINVLQKELNTVEKERDSFIHEFSEQDYNEIVGGWTAKLLRSSSGEQRWGL  494



>gb|KHG16117.1| Phosphoethanolamine N-methyltransferase 1 -like protein [Gossypium 
arboreum]
Length=486

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPA
Sbjct  300  HVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPA  359

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGK+LI+DYCK S  PS EFA YIKQRGYDLHD + YGQML DAGF+ +
Sbjct  360  LFRSFYKWLKPGGKLLISDYCKSSKTPSREFAEYIKQRGYDLHDVKSYGQMLEDAGFDVI  419

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGWK KL R+SSGEQRWGL
Sbjct  420  LAEDRTDQFLQVLRRELNQVEKEKDAFISDFSKEDYDEIVGGWKAKLIRSSSGEQRWGL  478



>ref|XP_009356042.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   305 bits (782),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VIGIDLS NMI+ ALE++IGLKCAVEFEVADCTKKTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  309  VIGIDLSVNMISFALEQSIGLKCAVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPAL  368

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYC+ +G P E FA YIKQRGYDLHD + YGQML+DAGF++VI
Sbjct  369  FRSFYKWLKPGGKVLISDYCRCAGTPLENFADYIKQRGYDLHDVKAYGQMLKDAGFDEVI  428

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF  VL +EL AVEK+K++F+QDFS+EDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  429  AEDRTDQFKAVLARELAAVEKDKDSFVQDFSQEDYDDIVGGWKAKLIRVDSGEQKWGL  486



>ref|XP_010678114.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKKTYP+ +FDVIYSRDTILHIQDKPAL
Sbjct  311  VVGIDLSINMISFALERSIGLKCAVEFEVADCTKKTYPEQSFDVIYSRDTILHIQDKPAL  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FY+WLKPGGKVLI+DYCK + PPS EFA YIKQRGYDLHD E YGQML+DAGF DVI
Sbjct  371  FRNFYEWLKPGGKVLISDYCKSARPPSPEFAMYIKQRGYDLHDVEAYGQMLKDAGFVDVI  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            A+D+TDQF++VL+KELD++EKEK+ FI DFSE DYNDIV GWK KL RT  GEQRWGL
Sbjct  431  AKDKTDQFIQVLQKELDSLEKEKDKFIADFSEGDYNDIVDGWKAKLIRTKVGEQRWGL  488



>emb|CDM83854.1| unnamed protein product [Triticum aestivum]
Length=396

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD+TFDVIYSRDTILHIQDKP+
Sbjct  213  HVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDSTFDVIYSRDTILHIQDKPS  272

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD E YGQML++AGF DV
Sbjct  273  LFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLQNAGFHDV  332

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAE+RTDQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  333  IAEERTDQFLKVLQRELAEVEKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  391



>ref|XP_010263678.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nelumbo 
nucifera]
Length=489

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V GIDLS NM++ ALERAIG KC VEFEVADCTKK YP+ TFDVIYSRDTILHI+DKPAL
Sbjct  307  VFGIDLSINMVSFALERAIGRKCLVEFEVADCTKKAYPNNTFDVIYSRDTILHIKDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F+SF+KWLKPGGKVLI+DYCKR+G PS+EFA YI+QRGYDLHD E YGQMLRDAGF++V 
Sbjct  367  FKSFFKWLKPGGKVLISDYCKRAGSPSKEFAEYIEQRGYDLHDVEAYGQMLRDAGFKEVN  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF+KVL++ELDAVEK +  FI DFSEEDYN+IVGGWK KL R+S GEQRWGL
Sbjct  427  AEDRTDQFIKVLQRELDAVEKARGTFIYDFSEEDYNEIVGGWKAKLVRSSMGEQRWGL  484



>ref|XP_008453479.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=500

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI++ALERAIGLKCAVEFEVADCTKK YPD TFDVIYSRDTILHIQDKPAL
Sbjct  315  VVGIDLSINMISLALERAIGLKCAVEFEVADCTKKVYPDNTFDVIYSRDTILHIQDKPAL  374

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKW+KPGGK+LI+DYCK    PS EFA YIKQRGYDLHD + Y +ML +AGF +V+
Sbjct  375  FRSFYKWVKPGGKILISDYCKSGEVPSPEFAEYIKQRGYDLHDIKSYAKMLEEAGFSNVV  434

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFM VL+KEL+ VEKEKEAFI DFSEEDYNDIVGGWK KL R   GEQ+WGL
Sbjct  435  AEDRTDQFMSVLQKELNIVEKEKEAFIHDFSEEDYNDIVGGWKAKLNRCWCGEQKWGL  492



>ref|NP_001056231.2| Os05g0548900 [Oryza sativa Japonica Group]
 dbj|BAF18145.2| Os05g0548900, partial [Oryza sativa Japonica Group]
Length=208

 Score =   295 bits (755),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT KTY   TFDVIYSRDTILHI DKP
Sbjct  24   AHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKTYAPNTFDVIYSRDTILHIHDKP  83

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            ALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF  
Sbjct  84   ALFRSFFKWLKPGGKVLISDYCRNPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHH  143

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF++VL++EL  VEK KEAF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  144  VIAEDRTDQFLRVLQRELAEVEKNKEAFMADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  203



>gb|AER10512.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
 gb|AER10513.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
Length=492

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VIGIDLS NMI+ ALE++IGLKCAVEFEVADCTKKTYPD +FDVIYSRDTILHIQDKPAL
Sbjct  309  VIGIDLSVNMISFALEQSIGLKCAVEFEVADCTKKTYPDNSFDVIYSRDTILHIQDKPAL  368

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFY+WLKPGGKVLI+DYC+ +G PSE FA YIKQRGYDLHD + YGQML+DAGF +VI
Sbjct  369  FRSFYEWLKPGGKVLISDYCRCAGTPSENFAEYIKQRGYDLHDVKAYGQMLKDAGFYEVI  428

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF  VL++ELDA+EK+K++F+QDFS+ DY+DIVGGWK KL R  SGEQ+WGL
Sbjct  429  AEDRTDQFKAVLERELDAIEKDKDSFVQDFSQGDYDDIVGGWKAKLIRVESGEQKWGL  486



>ref|XP_010519218.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKK+YP  TFDVIYSRDTILHIQDKPAL
Sbjct  318  VVGIDLSINMISFALERAIGLKCSVEFEVADCTKKSYPVNTFDVIYSRDTILHIQDKPAL  377

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLI+DYC+    PS +FA YI+QRGYDLHD + YGQML+DAGF++V 
Sbjct  378  FRTFYKWLKPGGKVLISDYCRSPKAPSPDFAEYIEQRGYDLHDIQAYGQMLKDAGFDEVT  437

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFM+VLK+ELDAVEKEKE FI DFS+EDY +IVGGWK KL R+SSGEQRWGL
Sbjct  438  AEDRTDQFMQVLKRELDAVEKEKEEFILDFSKEDYEEIVGGWKAKLMRSSSGEQRWGL  495



>ref|XP_010519219.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Tarenaya hassleriana]
Length=499

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKK+YP  TFDVIYSRDTILHIQDKPAL
Sbjct  307  VVGIDLSINMISFALERAIGLKCSVEFEVADCTKKSYPVNTFDVIYSRDTILHIQDKPAL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FR+FYKWLKPGGKVLI+DYC+    PS +FA YI+QRGYDLHD + YGQML+DAGF++V 
Sbjct  367  FRTFYKWLKPGGKVLISDYCRSPKAPSPDFAEYIEQRGYDLHDIQAYGQMLKDAGFDEVT  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFM+VLK+ELDAVEKEKE FI DFS+EDY +IVGGWK KL R+SSGEQRWGL
Sbjct  427  AEDRTDQFMQVLKRELDAVEKEKEEFILDFSKEDYEEIVGGWKAKLMRSSSGEQRWGL  484



>ref|XP_009145948.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Brassica 
rapa]
Length=492

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPA
Sbjct  308  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPENSFDVIYSRDTILHIQDKPA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYCK S  PS EF+ YIKQRGYDLHD + YGQML++AGF DV
Sbjct  368  LFRTFFKWLKPGGKVLISDYCKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKEAGFNDV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQFM+VL++EL+ VEKEKE FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  428  IAEDRTDQFMQVLRRELERVEKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  486



>ref|XP_004969638.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HVIGIDLS NMI+ ALERAIG  C+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKP
Sbjct  315  AHVIGIDLSINMISFALERAIGRSCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKP  374

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            +LF++F+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD E YGQML+DAGF D
Sbjct  375  SLFKTFFKWLKPGGKVLISDYCRNPGKPSEEFAAYIKQRGYDLHDVEAYGQMLKDAGFHD  434

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF+ VL+KEL   EK K+ F+ DFS+EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  435  VIAEDRTDQFLCVLEKELAKFEKNKDDFLSDFSQEDYDDIVNGWKAKLQRSSAGEQRWGL  494



>ref|XP_007036803.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY21304.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=494

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIG+ C+VEFEVADCTKKTYPD +FDVIYSRDTILHIQDKPA
Sbjct  309  HVVGIDLSINMISFALERAIGMNCSVEFEVADCTKKTYPDNSFDVIYSRDTILHIQDKPA  368

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYG-QMLRDAGFED  317
            LFRSFYKWLKPGGKVLI+DYCK +G PS EFA YI+QRGYDLHD E YG Q+L DAGF++
Sbjct  369  LFRSFYKWLKPGGKVLISDYCKNAGTPSSEFAEYIEQRGYDLHDVEAYGQQILSDAGFDE  428

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRT+QF++VL++EL+ VEK+K+AF+  FS+EDY+DI+GGWK KL R+SSGEQRWGL
Sbjct  429  VIAEDRTEQFLQVLQRELNEVEKDKDAFVSSFSQEDYDDILGGWKAKLIRSSSGEQRWGL  488



>sp|Q9M571.1|PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase [Spinacia 
oleracea]
 gb|AAF61950.1|AF237633_1 phosphoethanolamine N-methyltransferase [Spinacia oleracea]
Length=494

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKK YP+ +FDVIYSRDTILHIQDKPAL
Sbjct  311  VVGIDLSINMISFALERSIGLKCAVEFEVADCTKKDYPENSFDVIYSRDTILHIQDKPAL  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCK +G PS EFAAYI+QRGYDLHD + YG+ML+DAGF +VI
Sbjct  371  FRSFHKWLKPGGKVLISDYCKSAGTPSAEFAAYIRQRGYDLHDVKAYGKMLKDAGFVEVI  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AE+RTDQF++VL+KELDA+E+EK+ FI DFSEEDYNDIV GWK KL RT+ GEQ+WGL
Sbjct  431  AENRTDQFIQVLQKELDALEQEKDDFIDDFSEEDYNDIVDGWKAKLVRTTEGEQQWGL  488



>gb|KFK39125.1| hypothetical protein AALP_AA3G204100 [Arabis alpina]
Length=491

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFNDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IA DRTDQF++VL++EL+ VEKEKE FI DFS+EDY+DIVGGWK KL RT+SGEQ+WGL
Sbjct  427  IAADRTDQFVQVLRRELERVEKEKEEFIADFSKEDYDDIVGGWKAKLERTASGEQKWGL  485



>ref|XP_002883100.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59359.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQFM+VLK+ELD VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  427  IAEDRTDQFMQVLKRELDRVEKEKEEFISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  485



>emb|CDX92181.1| BnaA05g22260D [Brassica napus]
Length=464

 Score =   302 bits (774),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPA
Sbjct  280  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPENSFDVIYSRDTILHIQDKPA  339

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYCK S  PS EF+ YIKQRGYDLHD + YGQML++AGF DV
Sbjct  340  LFRTFFKWLKPGGKVLISDYCKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKEAGFNDV  399

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IA+DRTDQFM+VL++EL+ VEKEKE FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  400  IADDRTDQFMQVLRRELERVEKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  458



>ref|XP_004137500.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004161836.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
2 [Cucumis sativus]
 gb|KGN64173.1| hypothetical protein Csa_1G042800 [Cucumis sativus]
Length=493

 Score =   303 bits (776),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            + V+GIDLS NMI+ ALERAIG KC VEFEVADCT KTYPD TFDVIYSRDTILHIQDKP
Sbjct  308  AEVVGIDLSINMISFALERAIGRKCPVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKP  367

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            ALF+SFYKWLKPGGKVLI+DYC+    P+EEF+ YIKQRGYDLHD + YGQML+DAGF D
Sbjct  368  ALFKSFYKWLKPGGKVLISDYCRSDETPTEEFSEYIKQRGYDLHDVKAYGQMLQDAGFHD  427

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF++VL++EL  +EKEKE FIQDFS EDYN+IV GWK KL R+S+GEQRWGL
Sbjct  428  VIAEDRTDQFIRVLERELSTIEKEKEEFIQDFSVEDYNEIVDGWKAKLVRSSTGEQRWGL  487



>gb|EMT21187.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=503

 Score =   303 bits (777),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD TFDVIYSRDTILHIQDKPA
Sbjct  320  HVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPA  379

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLH+ E YGQML++AGF DV
Sbjct  380  LFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHNVEAYGQMLQNAGFHDV  439

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  440  IAEDRTDQFLKVLQRELAEVEKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  498



>ref|XP_008464197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=493

 Score =   303 bits (776),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIG KC VEFEVADCT KTYPD TFDVIYSRDTILHIQDKPAL
Sbjct  310  VVGIDLSINMISFALERAIGRKCPVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPAL  369

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F+SFYKWLKPGGKVLI+DYC+  G P+EEF+ YIKQRGYDLHD + YGQML+D GF DVI
Sbjct  370  FKSFYKWLKPGGKVLISDYCRSDGTPTEEFSEYIKQRGYDLHDVKAYGQMLQDVGFHDVI  429

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF++VL++EL   EKEKE FIQDFS EDYN+IV GWK KL R+S+GEQRWGL
Sbjct  430  AEDRTDQFIRVLERELSTTEKEKEEFIQDFSVEDYNEIVDGWKAKLVRSSTGEQRWGL  487



>ref|NP_188427.2| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|Q9FR44.1|PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 1; Short=AtNMT1; 
Short=PEAMT 1; AltName: Full=Protein XIPOTL 1 [Arabidopsis 
thaliana]
 gb|AAG41121.1|AF197940_1 SAM:phospho-ethanolamine N-methyltransferase [Arabidopsis thaliana]
 gb|AAK32886.1|AF367299_1 AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAL25589.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAM10282.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AEE76033.1| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
Length=491

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLSCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQFM+VLK+ELD VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  427  IAEDRTDQFMQVLKRELDRVEKEKEKFISDFSKEDYDDIVGGWKSKLERCASDEQKWGL  485



>dbj|BAB02720.1| methyl transferase-like protein [Arabidopsis thaliana]
Length=498

 Score =   303 bits (776),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  314  HVVGIDLSVNMISFALERAIGLSCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  373

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF DV
Sbjct  374  LFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDV  433

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQFM+VLK+ELD VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  434  IAEDRTDQFMQVLKRELDRVEKEKEKFISDFSKEDYDDIVGGWKSKLERCASDEQKWGL  492



>ref|XP_004137341.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
sativus]
Length=500

 Score =   303 bits (776),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI++ALERAIGLKCAVEFEVADCTKK Y D TFDVIYSRDTILHIQDKPAL
Sbjct  315  VVGIDLSINMISLALERAIGLKCAVEFEVADCTKKVYLDNTFDVIYSRDTILHIQDKPAL  374

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKW+KPGGK+LI+DYCK  G PS EFA YI+QRGYDLHD + Y +ML +AGF +V+
Sbjct  375  FRSFYKWVKPGGKILISDYCKSGGVPSSEFAEYIEQRGYDLHDIKSYAKMLEEAGFNNVV  434

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFM VL++ELD VEKEKEAFI DFSEEDYNDIVGGWK KL R+  GEQ+WGL
Sbjct  435  AEDRTDQFMSVLQRELDIVEKEKEAFILDFSEEDYNDIVGGWKAKLKRSWCGEQKWGL  492



>dbj|BAD80838.1| phosphoethanolamine N-methyltransferase [Atriplex nummularia]
Length=503

 Score =   303 bits (776),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALER+IGLKCAVEFEVADCTKK YP+ +FDVIYSRDTILHIQDKPAL
Sbjct  320  VVGIDLSINMISFALERSIGLKCAVEFEVADCTKKDYPENSFDVIYSRDTILHIQDKPAL  379

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF KWLKPGGKVLI+DYCK + PPS EFAAYIKQRGYDLHD + YGQML+DAGF +VI
Sbjct  380  FRSFLKWLKPGGKVLISDYCKSAVPPSSEFAAYIKQRGYDLHDVKAYGQMLKDAGFIEVI  439

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF+KVL++ELDA+E EK+ FI DFSE+DYNDIV GWK KL RT   EQRWGL
Sbjct  440  AEDRTDQFIKVLQRELDALETEKDEFIADFSEQDYNDIVDGWKAKLVRTKGDEQRWGL  497



>gb|EPS65842.1| hypothetical protein M569_08933, partial [Genlisea aurea]
Length=487

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALERAIGL CAVEFEVADCTKK YPDA+FDVIYSRDTILHI DKP+
Sbjct  303  HVVGIDLSINMVSFALERAIGLNCAVEFEVADCTKKHYPDASFDVIYSRDTILHIHDKPS  362

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SFYKWLKPGGKVLI+DYCK    PS EFA YIK+RGYDLHD E YGQMLRDAGF++V
Sbjct  363  LFKSFYKWLKPGGKVLISDYCKGVDAPSAEFAGYIKERGYDLHDVEAYGQMLRDAGFDEV  422

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT+QF+ VLKKE+DAVEK+KE FI +FS+EDY++IVGGWK KL+R+  GEQRWGL
Sbjct  423  TAEDRTEQFVNVLKKEVDAVEKDKERFIDNFSKEDYDEIVGGWKSKLSRSCGGEQRWGL  481



>emb|CDM83845.1| unnamed protein product [Triticum aestivum]
Length=504

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD+TFDVIYSRDTILHIQDKP+
Sbjct  321  HVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDSTFDVIYSRDTILHIQDKPS  380

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD E YGQML++AGF DV
Sbjct  381  LFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLQNAGFHDV  440

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAE+RTDQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  441  IAEERTDQFLKVLQRELAEVEKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  499



>gb|AFW78991.1| hypothetical protein ZEAMMB73_932976 [Zea mays]
Length=356

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPA
Sbjct  173  HVLGIDLSVNMVSFAIERAIGRKCSVEFEVADCTTKDYPENSFDVIYSRDTILHIQDKPA  232

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD + YGQML+DAGF +V
Sbjct  233  LFRSFFKWLKPGGKVLISDYCKNPGKPSEEFAAYIKQRGYDLHDVKAYGQMLKDAGFHNV  292

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+ VL++E+  VEK K+AF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  293  IAEDRTEQFLNVLQREIGEVEKNKDAFLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  351



>gb|ACV89824.1| S-adenosyl-L-methionine:phosphoethanolamine N-methyltransferase 
[Triticum aestivum]
Length=505

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD TFDVIYSRDTILHIQDKPA
Sbjct  322  HVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPA  381

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLH+ E YGQML++AGF DV
Sbjct  382  LFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHNVETYGQMLQNAGFHDV  441

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  442  VAEDRTDQFLKVLQRELAEVEKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  500



>gb|EMS54147.1| Phosphoethanolamine N-methyltransferase 1 [Triticum urartu]
Length=504

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD TFDVIYSRDTILHIQDKPA
Sbjct  321  HVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPA  380

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLH+ E YGQML++AGF DV
Sbjct  381  LFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHNVETYGQMLQNAGFHDV  440

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  441  VAEDRTDQFLKVLQRELAEVEKNKDEFLADFGQEDYDDIVTGWNAKLQRSSAGEQRWGL  499



>ref|XP_007209943.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11142.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=493

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 161/180 (89%), Gaps = 2/180 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKCAVEFEVADCT+KTY D TFDVIYSRDTILHIQDKPAL
Sbjct  308  VVGIDLSVNMISFALERAIGLKCAVEFEVADCTQKTYADDTFDVIYSRDTILHIQDKPAL  367

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFY+WLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLH+ + YGQML+DAGF++VI
Sbjct  368  FRSFYRWLKPGGKVLISDYCRSAGTPSAEFAEYIKQRGYDLHNVQAYGQMLKDAGFDEVI  427

Query  310  AEDRTDQ--FMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQ     +L++ELDAVEK+K+AFIQDFSEEDY+DIVGGWK KL R  SGEQ+WGL
Sbjct  428  AEDRTDQVCIRLLLQRELDAVEKDKDAFIQDFSEEDYDDIVGGWKAKLIRADSGEQKWGL  487



>ref|XP_004161835.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
1 [Cucumis sativus]
Length=527

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            + V+GIDLS NMI+ ALERAIG KC VEFEVADCT KTYPD TFDVIYSRDTILHIQDKP
Sbjct  342  AEVVGIDLSINMISFALERAIGRKCPVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKP  401

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            ALF+SFYKWLKPGGKVLI+DYC+    P+EEF+ YIKQRGYDLHD + YGQML+DAGF D
Sbjct  402  ALFKSFYKWLKPGGKVLISDYCRSDETPTEEFSEYIKQRGYDLHDVKAYGQMLQDAGFHD  461

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF++VL++EL  +EKEKE FIQDFS EDYN+IV GWK KL R+S+GEQRWGL
Sbjct  462  VIAEDRTDQFIRVLERELSTIEKEKEEFIQDFSVEDYNEIVDGWKAKLVRSSTGEQRWGL  521



>ref|XP_002441466.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
 gb|EES19896.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
Length=510

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPA
Sbjct  327  HVLGIDLSVNMVSFAIERAIGRKCSVEFEVADCTTKDYPEDSFDVIYSRDTILHIQDKPA  386

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD + YGQML+DAGF DV
Sbjct  387  LFRSFFKWLKPGGKVLISDYCKNPGKPSEEFAAYIKQRGYDLHDVKAYGQMLKDAGFHDV  446

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+ VL++EL  VEK KEAF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  447  IAEDRTEQFLNVLRRELGEVEKNKEAFLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  505



>ref|XP_010921205.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921212.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921222.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921230.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921238.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
Length=480

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIG KC+VEFEVADCTKK Y D TF VIYSRDTILHIQDKP L
Sbjct  292  VVGIDLSINMISFALERAIGCKCSVEFEVADCTKKIYSDNTFAVIYSRDTILHIQDKPML  351

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGK+LITDYCKRSG PSEEFA YIKQRGYDLHD E YGQML+DAGF +V 
Sbjct  352  FRSFFKWLKPGGKLLITDYCKRSGTPSEEFAEYIKQRGYDLHDVEAYGQMLKDAGFYEVT  411

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT QF++VL++ELDAVEK+++AFI++FS+EDY++IVGGWK KL R+S GEQRWGL
Sbjct  412  AEDRTTQFLEVLQRELDAVEKDRDAFIKEFSKEDYDEIVGGWKAKLKRSSVGEQRWGL  469



>ref|XP_010540184.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Tarenaya hassleriana]
Length=457

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKK+Y D TFDVIYSRDTILHIQDKP L
Sbjct  273  VVGIDLSVNMISFALERAIGLKCSVEFEVADCTKKSYSDNTFDVIYSRDTILHIQDKPTL  332

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F++FYKWLKPGGKVLI+DYC+    PS +FA YIKQRGYDLHD + YGQML+DAGF +VI
Sbjct  333  FKTFYKWLKPGGKVLISDYCRSPKAPSPDFAEYIKQRGYDLHDIQTYGQMLKDAGFNEVI  392

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+QFM+VLK+ELDAVEKEKE FIQDFS+E+Y ++VGGW+ KL R+S GEQRWGL
Sbjct  393  AEDRTNQFMQVLKRELDAVEKEKEEFIQDFSKEEYEEMVGGWRAKLQRSSRGEQRWGL  450



>ref|NP_001043957.1| Os01g0695100 [Oryza sativa Japonica Group]
 dbj|BAF05871.1| Os01g0695100 [Oryza sativa Japonica Group]
Length=499

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALERAIG KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+
Sbjct  316  HVVGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPS  375

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD   YGQML +AGF DV
Sbjct  376  LFKSFFKWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDVRAYGQMLENAGFHDV  435

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF+ VL++EL  VEK K  F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  436  IAEDRTDQFLDVLERELAKVEKNKNEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  494



>gb|AEY75253.1| phosphoethanolamine N-methyltransferase [Atriplex canescens]
Length=494

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALER+IGLK AVEFEVADCTKK YP+ +FDVIYSRDTILHIQDKPAL
Sbjct  311  VVGIDLSINMISFALERSIGLKYAVEFEVADCTKKDYPENSFDVIYSRDTILHIQDKPAL  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF KWLKPGGKVLI+DYCK +GPPS EFAAYIKQRGYDLHD + YGQML+DAGF +VI
Sbjct  371  FRSFLKWLKPGGKVLISDYCKSAGPPSSEFAAYIKQRGYDLHDVKAYGQMLKDAGFIEVI  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF+KVL++EL A+E EK+ FI DFSE+DYNDIV GWK KL RT  GEQRWGL
Sbjct  431  AEDRTDQFIKVLQRELYALEMEKDEFIADFSEQDYNDIVDGWKAKLVRTKGGEQRWGL  488



>ref|XP_010921197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Elaeis guineensis]
Length=499

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIG KC+VEFEVADCTKK Y D TF VIYSRDTILHIQDKP L
Sbjct  311  VVGIDLSINMISFALERAIGCKCSVEFEVADCTKKIYSDNTFAVIYSRDTILHIQDKPML  370

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGK+LITDYCKRSG PSEEFA YIKQRGYDLHD E YGQML+DAGF +V 
Sbjct  371  FRSFFKWLKPGGKLLITDYCKRSGTPSEEFAEYIKQRGYDLHDVEAYGQMLKDAGFYEVT  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT QF++VL++ELDAVEK+++AFI++FS+EDY++IVGGWK KL R+S GEQRWGL
Sbjct  431  AEDRTTQFLEVLQRELDAVEKDRDAFIKEFSKEDYDEIVGGWKAKLKRSSVGEQRWGL  488



>gb|EEE55232.1| hypothetical protein OsJ_03109 [Oryza sativa Japonica Group]
Length=509

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALERAIG KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+
Sbjct  326  HVVGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPS  385

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD   YGQML +AGF DV
Sbjct  386  LFKSFFKWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDVRAYGQMLENAGFHDV  445

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF+ VL++EL  VEK K  F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  446  IAEDRTDQFLDVLERELAKVEKNKNEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  504



>ref|XP_006297517.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
 gb|EOA30415.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
Length=491

 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF+DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQFM+VL++EL+ VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  427  IAEDRTDQFMQVLRRELERVEKEKEEFIADFSKEDYDDIVGGWKAKLERCASDEQKWGL  485



>gb|KJB53040.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=489

 Score =   300 bits (769),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            +V+GIDLS NMI+ ALERA GL C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  305  YVVGIDLSINMISFALERANGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  364

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR FYKWLKPGGKVLI+DYCK +G  S EFA YIKQRGYDLHD + YGQML DAGF+ V
Sbjct  365  LFRYFYKWLKPGGKVLISDYCKSAGASSPEFAEYIKQRGYDLHDVKAYGQMLTDAGFDQV  424

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++ELD VEK+K+ FI DFS+EDY+DIVGGWK KL RT SGEQRWGL
Sbjct  425  IAEDRTDQFIQVLQRELDKVEKDKDTFITDFSQEDYDDIVGGWKAKLIRTRSGEQRWGL  483



>gb|KJB53039.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=488

 Score =   300 bits (769),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            +V+GIDLS NMI+ ALERA GL C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  304  YVVGIDLSINMISFALERANGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  363

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR FYKWLKPGGKVLI+DYCK +G  S EFA YIKQRGYDLHD + YGQML DAGF+ V
Sbjct  364  LFRYFYKWLKPGGKVLISDYCKSAGASSPEFAEYIKQRGYDLHDVKAYGQMLTDAGFDQV  423

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++ELD VEK+K+ FI DFS+EDY+DIVGGWK KL RT SGEQRWGL
Sbjct  424  IAEDRTDQFIQVLQRELDKVEKDKDTFITDFSQEDYDDIVGGWKAKLIRTRSGEQRWGL  482



>ref|XP_010487709.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Camelina sativa]
Length=494

 Score =   300 bits (769),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  310  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  369

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF+DV
Sbjct  370  LFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDV  429

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF +VL++EL++VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  430  IAEDRTDQFTQVLRRELESVEKEKEEFISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  488



>ref|XP_010487710.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=491

 Score =   300 bits (768),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF+DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF +VL++EL++VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  427  IAEDRTDQFTQVLRRELESVEKEKEEFISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  485



>gb|AAS57723.1| phosphoethanolamine N-methyltransferase [Oryza sativa]
Length=499

 Score =   300 bits (769),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALERAIG KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+
Sbjct  316  HVVGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPS  375

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD   YGQML +AGF DV
Sbjct  376  LFKSFFKWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDVRAYGQMLENAGFHDV  435

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF+ VL++EL  VEK    F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  436  IAEDRTDQFLDVLERELAKVEKNNNEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  494



>gb|AAM13092.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+V FEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLSCSVGFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFTDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQFM+VLK+ELD VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  427  IAEDRTDQFMQVLKRELDRVEKEKEKFISDFSKEDYDDIVGGWKSKLERCASDEQKWGL  485



>ref|XP_009404071.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=497

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NM++ ALERAIG KCAVEFEVADCTKKTYP+ TFDVIYSRDTILHIQDKP L
Sbjct  314  VVGIDLSINMVSFALERAIGRKCAVEFEVADCTKKTYPENTFDVIYSRDTILHIQDKPTL  373

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGK+LI+DYCK+ G PS++FAAYIKQRGYDLHD + YGQML++AGF  VI
Sbjct  374  FRSFFKWLKPGGKLLISDYCKKLGTPSDDFAAYIKQRGYDLHDVDAYGQMLKNAGFNKVI  433

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+QF++VL++ELDAVE  KE FI+DFS+EDY++IV GWK KL R+S GEQRWGL
Sbjct  434  AEDRTNQFLEVLQRELDAVEMGKEGFIRDFSQEDYDEIVNGWKAKLKRSSVGEQRWGL  491



>ref|XP_010921188.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Elaeis guineensis]
Length=537

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIG KC+VEFEVADCTKK Y D TF VIYSRDTILHIQDKP L
Sbjct  349  VVGIDLSINMISFALERAIGCKCSVEFEVADCTKKIYSDNTFAVIYSRDTILHIQDKPML  408

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGK+LITDYCKRSG PSEEFA YIKQRGYDLHD E YGQML+DAGF +V 
Sbjct  409  FRSFFKWLKPGGKLLITDYCKRSGTPSEEFAEYIKQRGYDLHDVEAYGQMLKDAGFYEVT  468

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT QF++VL++ELDAVEK+++AFI++FS+EDY++IVGGWK KL R+S GEQRWGL
Sbjct  469  AEDRTTQFLEVLQRELDAVEKDRDAFIKEFSKEDYDEIVGGWKAKLKRSSVGEQRWGL  526



>ref|XP_002456194.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
 gb|EES01314.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
Length=501

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NM++ ALERAIG  C+VEFEVADCT KTYP+ TFDVIYSRDTILHIQDKP
Sbjct  317  AHVVGIDLSINMVSFALERAIGRSCSVEFEVADCTTKTYPENTFDVIYSRDTILHIQDKP  376

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            +LF+SF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD E YGQML+ AGF D
Sbjct  377  SLFKSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLKSAGFRD  436

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF+ VL+KEL   EK K+ F+ DF++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  437  VIAEDRTDQFLGVLEKELAKFEKNKDDFLSDFTQEDYDDIVNGWKAKLQRSSAGEQRWGL  496



>ref|XP_010465872.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Camelina 
sativa]
Length=491

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF+DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCRSPKTPSVEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF +VL++EL++VEKEKE FI DFS+EDY+DIVGGWK KL R +S EQ+WGL
Sbjct  427  IAEDRTDQFTQVLRRELESVEKEKEEFISDFSKEDYDDIVGGWKAKLERCASDEQKWGL  485



>ref|XP_004166029.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase-like 
[Cucumis sativus]
Length=500

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI++ALERAIGLKCAVEFEVADCTKK Y D TFDVIYSRDTILHIQDKPAL
Sbjct  315  VVGIDLSINMISLALERAIGLKCAVEFEVADCTKKVYLDNTFDVIYSRDTILHIQDKPAL  374

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKW+KPGGK+LI+DYCK  G PS EFA YI+QRGYDLHD + Y +ML +AGF +V+
Sbjct  375  FRSFYKWVKPGGKILISDYCKSGGVPSSEFAEYIEQRGYDLHDIKSYAKMLEEAGFNNVV  434

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQFM VL++ELD VEKEK+ FI DFSEEDYNDIVGGWK KL R+  GEQ+WGL
Sbjct  435  AEDRTDQFMSVLQRELDIVEKEKKXFILDFSEEDYNDIVGGWKAKLKRSWCGEQKWGL  492



>gb|AAP83582.1| phosphoethanolamine N-methyltransferase [Brassica napus]
Length=491

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YP+ + DVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPENSXDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYCK S  PS EF+ YIKQRGYDLHD + YGQML+ AGF DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCKSSETPSPEFSEYIKQRGYDLHDVQAYGQMLKXAGFNDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IA+DRTDQFM+VL++EL+ VEKEKE FI DFS+EDY DIVGGWK KL R++SGEQ+WGL
Sbjct  427  IADDRTDQFMQVLRRELERVEKEKEEFISDFSKEDYEDIVGGWKAKLERSASGEQKWGL  485



>ref|NP_001169597.1| uncharacterized LOC100383478 [Zea mays]
 gb|ABF83429.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
 gb|ACN34220.1| unknown [Zea mays]
 gb|AFW78993.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
Length=501

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPA
Sbjct  318  HVLGIDLSVNMVSFAIERAIGRKCSVEFEVADCTTKDYPENSFDVIYSRDTILHIQDKPA  377

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD + YGQML+DAGF +V
Sbjct  378  LFRSFFKWLKPGGKVLISDYCKNPGKPSEEFAAYIKQRGYDLHDVKAYGQMLKDAGFHNV  437

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+ VL++E+  VEK K+AF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  438  IAEDRTEQFLNVLQREIGEVEKNKDAFLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  496



>ref|XP_010506234.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Camelina sativa]
Length=494

 Score =   298 bits (764),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  310  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  369

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF+DV
Sbjct  370  LFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDV  429

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF +VL++EL++VEKEKE FI DFS+EDY+DIVGGWK +L R +S EQ+WGL
Sbjct  430  IAEDRTDQFTQVLRRELESVEKEKEEFISDFSKEDYDDIVGGWKAELERCASDEQKWGL  488



>ref|XP_006644536.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=499

 Score =   298 bits (764),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALERAIG  C+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKP+
Sbjct  316  HVVGIDLSINMVSFALERAIGRSCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPS  375

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SF+ WLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD + YG+ML +AGF DV
Sbjct  376  LFKSFFNWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDVKAYGKMLENAGFHDV  435

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF+ VL++EL  VEK K  F+ DFS+EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  436  VAEDRTDQFLNVLQRELAEVEKNKNEFVSDFSQEDYDDIVNGWKAKLQRSSAGEQRWGL  494



>dbj|BAJ97525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   299 bits (765),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALE AIG KCAVEFEVADCT KTYPD TFDVIYSRDTILHIQDKPA
Sbjct  325  HVVGIDLSINMVSFALEHAIGRKCAVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPA  384

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYC+  G PSEEFA+YIKQRGYDLHD E YGQML +AGF DV
Sbjct  385  LFRSFFKWLKPGGKVLISDYCRSPGKPSEEFASYIKQRGYDLHDVETYGQMLENAGFHDV  444

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAED +DQF+KVL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  445  IAEDHSDQFLKVLQRELAEVEKNKDDFLADFGQEDYDDIVTGWNAKLHRSSAGEQRWGL  503



>ref|XP_010506242.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Camelina sativa]
Length=491

 Score =   298 bits (763),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKHYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+DAGF+DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCRSPKTPSAEFSEYIKQRGYDLHDVQAYGQMLKDAGFKDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF +VL++EL++VEKEKE FI DFS+EDY+DIVGGWK +L R +S EQ+WGL
Sbjct  427  IAEDRTDQFTQVLRRELESVEKEKEEFISDFSKEDYDDIVGGWKAELERCASDEQKWGL  485



>gb|AAV67950.1| putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=495

 Score =   298 bits (764),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NMI  ALER+IG KC VEFEVADCT KTYPD  FDVIYSRDTILHIQDKP
Sbjct  311  THVVGIDLSINMIMFALERSIGCKCLVEFEVADCTTKTYPDHMFDVIYSRDTILHIQDKP  370

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            +LF+SF+KWLKPGGKVLI+DYCK  G PSEEFA YIKQRGYDLHD E YGQML+DAGF +
Sbjct  371  SLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFATYIKQRGYDLHDVEAYGQMLKDAGFHN  430

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRT+QF+ VL++E+  VEK K+AF+ DF++EDY+DIV GW  KL R+S GEQRWGL
Sbjct  431  VIAEDRTEQFLNVLQREIGEVEKNKDAFLADFTQEDYDDIVNGWNAKLKRSSGGEQRWGL  490



>ref|XP_008675144.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Zea mays]
 ref|XP_008675145.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Zea mays]
Length=501

 Score =   298 bits (763),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NMI  ALER+IG KC VEFEVADCT KTYPD  FDVIYSRDTILHIQDKP
Sbjct  317  THVVGIDLSINMIMFALERSIGCKCLVEFEVADCTTKTYPDHMFDVIYSRDTILHIQDKP  376

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            +LF+SF+KWLKPGGKVLI+DYCK  G PSEEFA YIKQRGYDLHD E YGQML++AGF  
Sbjct  377  SLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFATYIKQRGYDLHDVEAYGQMLKNAGFSH  436

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF+ VL+KELD  EK K+ F+ +F++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  437  VIAEDRTDQFLSVLQKELDKFEKNKDDFLSEFAQEDYDDIVNGWKAKLQRSSAGEQRWGL  496



>tpg|DAA57997.1| TPA: putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=498

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NMI  ALER+IG KC VEFEVADCT KTYPD  FDVIYSRDTILHIQDKP
Sbjct  314  THVVGIDLSINMIMFALERSIGCKCLVEFEVADCTTKTYPDHMFDVIYSRDTILHIQDKP  373

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            +LF+SF+KWLKPGGKVLI+DYCK  G PSEEFA YIKQRGYDLHD E YGQML++AGF  
Sbjct  374  SLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFATYIKQRGYDLHDVEAYGQMLKNAGFSH  433

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF+ VL+KELD  EK K+ F+ +F++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  434  VIAEDRTDQFLSVLQKELDKFEKNKDDFLSEFAQEDYDDIVNGWKAKLQRSSAGEQRWGL  493



>ref|NP_175293.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 gb|AAL16223.1|AF428454_1 At1g48600/T1N15_20 [Arabidopsis thaliana]
 gb|AAL36222.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AAM91745.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AEE32324.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=475

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  291  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  350

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YGQML+DAGF+DV
Sbjct  351  LFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDV  410

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  411  IAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWSAKLERTASGEQKWGL  469



>ref|XP_004137342.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 gb|KGN63873.1| hypothetical protein Csa_1G025050 [Cucumis sativus]
Length=468

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI++ALERAIGL C+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+L
Sbjct  284  VVGIDLSVNMISLALERAIGLACSVEFEVADCTKKTYPDHTFDVIYSRDTILHIQDKPSL  343

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGK+ ITDYC+ +G  S EFA YIKQRGYDLHD + YGQM+ DAGF +V+
Sbjct  344  FRSFYKWLKPGGKLFITDYCRNAGTSSPEFAEYIKQRGYDLHDVKAYGQMIEDAGFGEVV  403

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +EDRT+QF++VL++EL+AVE++K+ FI DFSEE YNDIV GWK KL R+ SGEQRWGL
Sbjct  404  SEDRTNQFIQVLQQELEAVEEQKDRFILDFSEEGYNDIVCGWKAKLNRSLSGEQRWGL  461



>ref|XP_004961340.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=498

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ +FDVIYSRDTILHIQDKPA
Sbjct  315  HVLGIDLSVNMVSFAMERAIGRKCSVEFEVADCTTKDYPENSFDVIYSRDTILHIQDKPA  374

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD + YG+ML  AGF DV
Sbjct  375  LFRSFFKWLKPGGKVLISDYCKNPGKPSEEFAAYIKQRGYDLHDVKAYGKMLEGAGFHDV  434

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT+QF+ VL++EL  VEK K+AF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  435  IAEDRTEQFLSVLRRELAEVEKNKDAFVADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  493



>ref|XP_004969637.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NMI  ALERA+G KC+VEFEVADCT KTYPD TFDVIYSRDTILHIQDKP
Sbjct  315  THVVGIDLSINMILFALERAVGRKCSVEFEVADCTTKTYPDHTFDVIYSRDTILHIQDKP  374

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            +LF+SF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YGQML++AGF  
Sbjct  375  SLFKSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHDVDAYGQMLKNAGFSH  434

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF+ +L+KELD  EK K  F+ DFS+ DY+DIV GWK K+ R+S+GEQRWGL
Sbjct  435  VIAEDRTDQFLGILQKELDKFEKSKADFLSDFSQGDYDDIVNGWKAKVQRSSAGEQRWGL  494



>ref|NP_973993.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 sp|Q944H0.2|PEAM2_ARATH RecName: Full=Phosphomethylethanolamine N-methyltransferase; 
Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 
2 [Arabidopsis thaliana]
 gb|AEE32323.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=491

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YGQML+DAGF+DV
Sbjct  367  LFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  427  IAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWSAKLERTASGEQKWGL  485



>ref|XP_003569614.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Brachypodium 
distachyon]
Length=502

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALE +IG KCAVEFEVADCT KTYPD TFDVIYSRDTILHIQDKP+
Sbjct  319  HVVGIDLSINMVSFALENSIGRKCAVEFEVADCTTKTYPDKTFDVIYSRDTILHIQDKPS  378

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYI+QRGYDLHD + YGQML++AGF DV
Sbjct  379  LFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIEQRGYDLHDVQAYGQMLKNAGFHDV  438

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IA+DRTDQF+ VL++EL  VEK K+ F+ DF +EDY+DIV GW  KL R S+GEQRWGL
Sbjct  439  IADDRTDQFLTVLQRELGEVEKNKDDFLADFGQEDYDDIVNGWNAKLERCSAGEQRWGL  497



>dbj|BAH01482.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64589.1| hypothetical protein OsJ_19441 [Oryza sativa Japonica Group]
Length=495

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT KTY   TFDVIYSRDTILHI DKP
Sbjct  311  AHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKTYAPNTFDVIYSRDTILHIHDKP  370

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            ALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF  
Sbjct  371  ALFRSFFKWLKPGGKVLISDYCRNPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHH  430

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF++VL++EL  VEK KEAF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  431  VIAEDRTDQFLRVLQRELAEVEKNKEAFMADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  490



>gb|EEC79642.1| hypothetical protein OsI_20868 [Oryza sativa Indica Group]
Length=504

 Score =   296 bits (757),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT KTY   TFDVIYSRDTILHI DKP
Sbjct  320  AHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKTYAPNTFDVIYSRDTILHIHDKP  379

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            ALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF  
Sbjct  380  ALFRSFFKWLKPGGKVLISDYCRNPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHH  439

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF++VL++EL  VEK KEAF+ DF++EDY+DIV GW  KL R+S+GEQRWGL
Sbjct  440  VIAEDRTDQFLRVLQRELAEVEKNKEAFLADFTQEDYDDIVNGWNAKLKRSSAGEQRWGL  499



>gb|AFW83642.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   296 bits (757),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NM++ ALERAIG  C+VEFEVADCT KTYPD TFDVIYSRDTILHI DKP
Sbjct  318  AHVVGIDLSINMVSFALERAIGRSCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIHDKP  377

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            +LF+SF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLH  E YGQML+ AGF D
Sbjct  378  SLFKSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHAVEAYGQMLKSAGFRD  437

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF+ VL KEL   EK K+ F+ DF++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  438  VIAEDRTDQFLGVLDKELAEFEKNKDDFLSDFTQEDYDDIVNGWKAKLQRSSAGEQRWGL  497



>ref|XP_002456193.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
 gb|EES01313.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
Length=499

 Score =   295 bits (756),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NMI  ALER+IG KC+VEFEVADCT KTYPD  FDVIYSRDTILHIQDKP
Sbjct  315  THVVGIDLSINMILFALERSIGRKCSVEFEVADCTTKTYPDHMFDVIYSRDTILHIQDKP  374

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            +LF+SF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD E YGQML++AGF  
Sbjct  375  SLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFAAYIKQRGYDLHDVEAYGQMLKNAGFSH  434

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF+ VL+KELD  EK K+ F+ +F++ DY+DIV GWK KL RTS+ EQRWGL
Sbjct  435  VIAEDRTDQFLSVLQKELDKFEKNKDDFLSEFAQGDYDDIVNGWKAKLQRTSAREQRWGL  494



>ref|XP_010097563.1| hypothetical protein L484_017373 [Morus notabilis]
 gb|EXB69095.1| hypothetical protein L484_017373 [Morus notabilis]
Length=503

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI++ALERAIGLKC+VEFEVADCTKKTYP+ +FDVIYSRDTILHI DKPAL
Sbjct  313  VVGIDLSINMISLALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHIDDKPAL  372

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLHD E YGQMLRDAGFE+VI
Sbjct  373  FRSFYKWLKPGGKVLISDYCQSAGTPSPEFAKYIKQRGYDLHDVEAYGQMLRDAGFEEVI  432

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQR  146
            AEDRT QF++VL++EL  +EKEK  FI DFSEEDY DIVGGWK KL RT+S   R
Sbjct  433  AEDRTGQFIEVLQRELSVIEKEKNEFISDFSEEDYYDIVGGWKAKLIRTTSVAAR  487



>ref|NP_001148925.1| LOC100282545 [Zea mays]
 gb|ACG33501.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NM++ ALERAIG  C+VEFEVADCT KTYPD TFDVIYSRDTILHI DKP
Sbjct  318  AHVVGIDLSINMVSFALERAIGRSCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIHDKP  377

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            +LF+SF+ WLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLH  E YGQML+ AGF D
Sbjct  378  SLFKSFFNWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHAVEAYGQMLKSAGFRD  437

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            VIAEDRTDQF+ VL KEL   EK K+ F+ DF++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  438  VIAEDRTDQFLGVLDKELAEFEKNKDDFLSDFTQEDYDDIVNGWKAKLQRSSAGEQRWGL  497



>ref|XP_004166030.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase 
1-like [Cucumis sativus]
Length=468

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI++ALERAIGL C+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKP+L
Sbjct  284  VVGIDLSVNMISLALERAIGLACSVEFEVADCTKKXYPDHTFDVIYSRDTILHIQDKPSL  343

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGK+ ITDYC+ +G  S EFA YIKQRGYDLHD + YGQM+ DAGF +V+
Sbjct  344  FRSFYKWLKPGGKLFITDYCRNAGTSSPEFAEYIKQRGYDLHDVKAYGQMIEDAGFGEVV  403

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +EDRT+QF++VL++EL+AVE++K+ FI DFSEE YNDIV GWK KL R+ SGEQRWGL
Sbjct  404  SEDRTNQFIQVLQQELEAVEEQKDRFILDFSEEGYNDIVCGWKAKLNRSLSGEQRWGL  461



>ref|XP_008799258.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Phoenix dactylifera]
Length=447

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GID S NMI+ ALERAIG KC+VEFEVADCTKK YPD TFDVIYSRDTILHIQDKP L
Sbjct  259  VVGIDFSINMISFALERAIGCKCSVEFEVADCTKKIYPDDTFDVIYSRDTILHIQDKPML  318

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGK+LITDYCKRSG PSEEF  YIKQRGYDL+D E Y QML+ AGF +V 
Sbjct  319  FRSFFKWLKPGGKLLITDYCKRSGTPSEEFTEYIKQRGYDLYDVEAYVQMLQGAGFYEVT  378

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT QF++VL++ELDAVEK+++AFI++FS+EDY++IV GWK KL R+S GEQRWGL
Sbjct  379  AEDRTTQFLEVLQRELDAVEKDRDAFIKEFSKEDYDEIVSGWKAKLKRSSVGEQRWGL  436



>ref|XP_006303987.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
 gb|EOA36885.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
Length=491

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YG+ML+DAGFEDV
Sbjct  367  LFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGKMLKDAGFEDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  427  IAEDRTDQFVEVLRRELEKVEKEKEEFINDFSEEDYNDIVGGWSAKLERTASGEQKWGL  485



>ref|XP_010231068.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Brachypodium distachyon]
Length=472

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ TFDVIYSRDTILHIQDKPA
Sbjct  289  HVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKEYPENTFDVIYSRDTILHIQDKPA  348

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+  G PSE+FAAYIKQRGYDLHD + YG+ML +AGF DV
Sbjct  349  LFRNFFKWLKPGGKVLISDYCRSPGKPSEDFAAYIKQRGYDLHDVKTYGKMLENAGFHDV  408

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL   EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  409  IAEDRTDQFLRVLERELAETEKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  467



>ref|XP_003567962.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Brachypodium distachyon]
Length=501

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K YP+ TFDVIYSRDTILHIQDKPA
Sbjct  318  HVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKEYPENTFDVIYSRDTILHIQDKPA  377

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+  G PSE+FAAYIKQRGYDLHD + YG+ML +AGF DV
Sbjct  378  LFRNFFKWLKPGGKVLISDYCRSPGKPSEDFAAYIKQRGYDLHDVKTYGKMLENAGFHDV  437

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL   EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  438  IAEDRTDQFLRVLERELAETEKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  496



>ref|XP_010461752.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Camelina 
sativa]
Length=492

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  308  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YG+ML++AGFEDV
Sbjct  368  LFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGKMLKEAGFEDV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL+ VEKEKE FI DFS+EDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  428  IAEDRTDQFVQVLRRELEKVEKEKEEFISDFSQEDYNDIVGGWTAKLERTASGEQKWGL  486



>ref|XP_010097561.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
 gb|EXB69093.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
Length=519

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 160/201 (80%), Gaps = 23/201 (11%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQ-----  506
            V+GIDLS NMI++ALE AIGLKC+VEFEVADCTKK YP+++FDVIYSRDTILHIQ     
Sbjct  313  VVGIDLSINMISLALENAIGLKCSVEFEVADCTKKEYPESSFDVIYSRDTILHIQYSTLL  372

Query  505  ------------------DKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQR  380
                              DKPALFRSF+KWLKPGGKVLI+DYCK  G PS EF  YIKQR
Sbjct  373  LVPVAQVLLHMTFEPPPQDKPALFRSFFKWLKPGGKVLISDYCKSPGTPSVEFVKYIKQR  432

Query  379  GYDLHDTEEYGQMLRDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYND  200
             YDLHD E YGQMLR AGFEDV+AEDRTDQF++VL++ELD VEK+K+ FI DFSEEDYN+
Sbjct  433  EYDLHDVEAYGQMLRAAGFEDVVAEDRTDQFIQVLQRELDVVEKDKDEFIADFSEEDYNE  492

Query  199  IVGGWKLKLTRTSSGEQRWGL  137
            IVGGWK KL R++SGEQRWGL
Sbjct  493  IVGGWKAKLIRSTSGEQRWGL  513



>gb|AGO59019.1| heat responsive transcription factor protein, partial [Triticum 
aestivum]
Length=460

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ A+ERAIG  C+VEFEVADCT K Y + TFDVIYSRDTILHIQDKPA
Sbjct  281  HVLGIDLSINMVSFAIERAIGRSCSVEFEVADCTTKEYAENTFDVIYSRDTILHIQDKPA  340

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV
Sbjct  341  LFRNFFKWLKPGGKVLISDYCRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDV  400

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF++VL++EL   EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  401  VAEDRTDQFLRVLERELGETEKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  459



>gb|EMT23240.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=497

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ A+ERAIG  C+VEFEVADCT K Y + TFDVIYSRDTILHIQDKPA
Sbjct  314  HVLGIDLSINMVSFAIERAIGRSCSVEFEVADCTTKEYAENTFDVIYSRDTILHIQDKPA  373

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV
Sbjct  374  LFRNFFKWLKPGGKVLISDYCRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDV  433

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF++VL++ELD  EK KEAF+ DF++ED +DIV GW  KL R+S+GEQ+WGL
Sbjct  434  VAEDRTDQFLRVLERELDGTEKSKEAFLADFTQEDSDDIVNGWSAKLKRSSAGEQKWGL  492



>gb|AAL40895.1| phosphoethanolamine methyltransferase [Triticum aestivum]
Length=498

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ A+ERAIG  C+VEFEVADCT K Y + TFDVIYSRDTILHIQDKPA
Sbjct  315  HVLGIDLSINMVSFAIERAIGRSCSVEFEVADCTTKEYAENTFDVIYSRDTILHIQDKPA  374

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV
Sbjct  375  LFRNFFKWLKPGGKVLISDYCRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDV  434

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF++VL++EL   EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  435  VAEDRTDQFLRVLERELGETEKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  493



>ref|XP_006655550.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=495

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NM++ A+ERAIG KC+VEFEVADCT K+Y   TFDVIYSRDTILHI DKP
Sbjct  311  AHVLGIDLSINMVSFAIERAIGRKCSVEFEVADCTTKSYQPNTFDVIYSRDTILHIHDKP  370

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            ALFRSF+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF  
Sbjct  371  ALFRSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHH  430

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            V AEDRTDQF++VL++EL  VEK K+AF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  431  VTAEDRTDQFLRVLQRELAEVEKNKDAFLADFTQEDYDDIVNGWNAKLKRSSAGEQKWGL  490



>gb|KDP23922.1| hypothetical protein JCGZ_27082 [Jatropha curcas]
Length=510

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ AL+RAIGLKCAVEFE+AD TKKTYP+ TFDVIY+RDT+LHI+DKPAL
Sbjct  327  VVGIDLSINMISFALDRAIGLKCAVEFELADITKKTYPNNTFDVIYTRDTMLHIKDKPAL  386

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGK LI+DYCK +G PSEEFA YIKQRGY LH+ + Y QML DAGF+DVI
Sbjct  387  FRSFYKWLKPGGKFLISDYCKSAGTPSEEFAEYIKQRGYYLHEVKPYVQMLTDAGFDDVI  446

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF +VLK+ELDAVEKEK+ FI DFSE+D+NDIV GWK KL R+S+GEQ W L
Sbjct  447  AEDRTDQFNRVLKRELDAVEKEKDEFIHDFSEKDFNDIVDGWKAKLIRSSAGEQLWIL  504



>gb|EMT23241.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=553

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ A+ERAIG  C+VEFEVADCT K Y + TFDVIY RDTILHIQDKPA
Sbjct  370  HVLGIDLSINMVSFAIERAIGRSCSVEFEVADCTTKEYAENTFDVIYCRDTILHIQDKPA  429

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+  G PSEEFAAYIKQRGYDLHD + YG+ML DAGF DV
Sbjct  430  LFRNFFKWLKPGGKVLISDYCRSPGTPSEEFAAYIKQRGYDLHDVKTYGKMLEDAGFHDV  489

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF++VL++EL   EK KEAF+ DF++EDY+DIV GW  KL R+S+GEQ+WGL
Sbjct  490  VAEDRTDQFLRVLERELGETEKNKEAFLADFTQEDYDDIVNGWSAKLKRSSAGEQKWGL  548



>gb|AAF79705.1|AC020889_13 T1N15.23 [Arabidopsis thaliana]
Length=374

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 162/208 (78%), Gaps = 29/208 (14%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  161  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  220

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLITDYC+ +  PS EFA YIKQRGYDLHD + YGQML+DAGF+DV
Sbjct  221  LFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDV  280

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSE---------------------------  215
            IAEDRTDQF++VL++EL+ VEKEKE FI DFSE                           
Sbjct  281  IAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEVKTFLTTNSFEQNTCLLCSHIDHKILL  340

Query  214  --EDYNDIVGGWKLKLTRTSSGEQRWGL  137
              EDYNDIVGGW  KL RT+SGEQ+WGL
Sbjct  341  LQEDYNDIVGGWSAKLERTASGEQKWGL  368



>emb|CDX93681.1| BnaA06g03670D [Brassica napus]
Length=473

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 158/179 (88%), Gaps = 2/179 (1%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  291  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  350

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SF+KWLKPGG+VLITDYCK +  PS  FA YIKQRGYDLHD + YGQML+DAGFEDV
Sbjct  351  LFKSFFKWLKPGGRVLITDYCKSAETPSPTFAEYIKQRGYDLHDVQAYGQMLKDAGFEDV  410

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGWK KL R  S EQ+WGL
Sbjct  411  IAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWKAKLER--SDEQKWGL  467



>ref|XP_009147956.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Brassica 
rapa]
Length=489

 Score =   285 bits (729),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 158/179 (88%), Gaps = 2/179 (1%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SF+KWLKPGG+VLITDYCK +  PS  FA YIKQRGYDLHD + YGQML+DAGFEDV
Sbjct  367  LFKSFFKWLKPGGRVLITDYCKSAETPSPTFAEYIKQRGYDLHDVQAYGQMLKDAGFEDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGWK KL R  S EQ+WGL
Sbjct  427  IAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWKAKLER--SDEQKWGL  483



>ref|XP_006406666.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
 gb|ESQ48119.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
Length=491

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT K YPD +FDVIYSRDTILHIQDKPA
Sbjct  307  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKQYPDNSFDVIYSRDTILHIQDKPA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGKVLI+DYC+    PS EF+ YIKQRGYDLHD + YGQML+D GF DV
Sbjct  367  LFRTFFKWLKPGGKVLISDYCRSPKTPSPEFSEYIKQRGYDLHDVQAYGQMLKDVGFSDV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQFM+VL++EL+ VE+EKE FI DFS+EDY+DIVGGWK KL R +SGEQ+WGL
Sbjct  427  IAEDRTDQFMQVLRRELERVEREKEEFISDFSKEDYDDIVGGWKAKLERVASGEQKWGL  485



>gb|KJB53038.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=480

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 150/179 (84%), Gaps = 9/179 (5%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            +V+GIDLS NMI+ ALERA GL C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  305  YVVGIDLSINMISFALERANGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  364

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR FYKWLKPGGKVLI+DYCK +G  S EFA YIKQRGYDLHD + YGQ         V
Sbjct  365  LFRYFYKWLKPGGKVLISDYCKSAGASSPEFAEYIKQRGYDLHDVKAYGQ---------V  415

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++ELD VEK+K+ FI DFS+EDY+DIVGGWK KL RT SGEQRWGL
Sbjct  416  IAEDRTDQFIQVLQRELDKVEKDKDTFITDFSQEDYDDIVGGWKAKLIRTRSGEQRWGL  474



>emb|CDY40594.1| BnaC06g02100D [Brassica napus]
Length=473

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 2/179 (1%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGL C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  291  HVVGIDLSVNMISFALERAIGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  350

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF++F+KWLKPGG+VLITDYCK +  PS  FA YIKQRGYDLHD + YGQML+DAGFE V
Sbjct  351  LFKAFFKWLKPGGRVLITDYCKSAETPSPVFAEYIKQRGYDLHDVQAYGQMLKDAGFEYV  410

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL++EL+ VEKEKE FI DFSEEDYNDIVGGWK KL R  S EQ+WGL
Sbjct  411  IAEDRTDQFIQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWKAKLER--SDEQKWGL  467



>gb|ABX10444.1| phosphoethanolamine N-methyltransferase [Gossypium hirsutum]
Length=475

 Score =   276 bits (707),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+G DLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPA
Sbjct  309  HVVGNDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPA  368

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGK+LI+DYCK S  PS EFA YIKQRGYDLHD + YGQML DAGF+ +
Sbjct  369  LFRSFYKWLKPGGKLLISDYCKSSKTPSREFAEYIKQRGYDLHDVKSYGQMLEDAGFDVI  428

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLK  176
            +AEDRTDQF++VL++EL+ VEKEK+AFI DFS+EDY++IVGGW+ K
Sbjct  429  LAEDRTDQFLQVLRRELNQVEKEKDAFISDFSKEDYDEIVGGWEGK  474



>ref|XP_010481025.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=427

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCT KTYPD +FDVIYSRDT LH+QDKPA
Sbjct  243  HVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTFLHVQDKPA  302

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR F+KWLKPGGK+LITD+C+ +G PS E AAY+++R YDLH  + YG ML++AGFEDV
Sbjct  303  LFRKFFKWLKPGGKILITDFCRSAGTPSLEVAAYMERRRYDLHGVQAYGNMLKEAGFEDV  362

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF +VL++EL+ V+ EKE +I DFSE DYNDIV  W  KL + +S E +WGL
Sbjct  363  IAEDRTDQFAQVLRRELEKVKNEKEEYISDFSEGDYNDIVRVWTAKLRKAASDELKWGL  421



>ref|XP_006303561.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
 gb|EOA36459.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
Length=475

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI++ALERAIGLKC+VEFEVADC  KTYPD +FDVIYSRDT LH+QDKPA
Sbjct  288  HVVGIDLSVNMISLALERAIGLKCSVEFEVADCNTKTYPDNSFDVIYSRDTFLHVQDKPA  347

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+KWLKPGGKVLITDYC+ +  PS EF  Y+ +R YDLH  + YG+ML++AGFEDV
Sbjct  348  LFKKFFKWLKPGGKVLITDYCRIADTPSLEFQEYMVRRRYDLHGVQAYGKMLKEAGFEDV  407

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IA+DRTDQF++VL++EL  VEKEKE +I DFSEEDYN IV  W  KL +T SGEQ+WGL
Sbjct  408  IADDRTDQFVQVLRRELAKVEKEKEEYINDFSEEDYNGIVRVWTAKLRKTLSGEQKWGL  466



>ref|XP_002969650.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
 gb|EFJ29738.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
Length=495

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
             V+GIDLS NM++IALER+IG KC VEFEVADCT+K +P  +FDVIYSRDTILHIQDKPA
Sbjct  310  QVVGIDLSVNMVSIALERSIGRKCFVEFEVADCTEKNFPAESFDVIYSRDTILHIQDKPA  369

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF     WLKPGGK+LITDYC+     S EF  YIK+RGYDLHD + YGQMLRDAGF DV
Sbjct  370  LFARLLSWLKPGGKLLITDYCRSKDEVSAEFLEYIKKRGYDLHDVDHYGQMLRDAGFVDV  429

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF+++L KELDAVE+ K++F+QDFSEEDY DIV GWK KL R   G Q+WGL
Sbjct  430  VAEDRTDQFVRILTKELDAVERNKKSFLQDFSEEDYEDIVHGWKSKLVRCGQGHQKWGL  488



>ref|XP_001763293.1| predicted protein [Physcomitrella patens]
 gb|EDQ71823.1| predicted protein [Physcomitrella patens]
Length=491

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            + V+GIDLS NMI+ ALER+IG KCAVEFEV DCTK  YP A+FDVIYSRDTILHIQDKP
Sbjct  305  AEVVGIDLSLNMISFALERSIGRKCAVEFEVGDCTKINYPHASFDVIYSRDTILHIQDKP  364

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            ALF+ FYKWLKPGG+VLI+DYC+    PS EFAAYI+QRGYDLH  ++YG+ML DAGF +
Sbjct  365  ALFQRFYKWLKPGGRVLISDYCRAPQTPSAEFAAYIQQRGYDLHSVQKYGEMLEDAGFVE  424

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            V+AEDRTDQF++VL++EL   E  ++ FI DFSEEDYN IV GWK KL R S+ EQ+WGL
Sbjct  425  VVAEDRTDQFIEVLQRELATTEAGRDQFINDFSEEDYNYIVSGWKSKLKRCSNDEQKWGL  484



>ref|XP_002970912.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
 gb|EFJ28238.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
Length=495

 Score =   272 bits (695),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
             V+GIDLS NM++IALER+IG KC VEFEVADCT+K +P  +FDVIYSRDTILHIQDKPA
Sbjct  310  QVVGIDLSVNMVSIALERSIGRKCFVEFEVADCTEKNFPAESFDVIYSRDTILHIQDKPA  369

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF     WLKPGGK+LITDYC+     S EF  YIK+RGYDLHD + YGQMLRDAGF DV
Sbjct  370  LFARLLSWLKPGGKLLITDYCRSRDEVSAEFLEYIKKRGYDLHDVDHYGQMLRDAGFVDV  429

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRTDQF+++L KELD VE+ K++F+QDFSEEDY DIV GWK KL R   G Q+WGL
Sbjct  430  VAEDRTDQFVRILTKELDTVERNKKSFLQDFSEEDYEDIVQGWKSKLVRCGQGHQKWGL  488



>emb|CAN75113.1| hypothetical protein VITISV_043577 [Vitis vinifera]
Length=431

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 145/178 (81%), Gaps = 7/178 (4%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+IAL+RAIG    VEFEVADCTKKTYPD+TFDVIYSRDTILHIQDKPAL
Sbjct  253  VVGIDLSINMISIALDRAIGRNRLVEFEVADCTKKTYPDSTFDVIYSRDTILHIQDKPAL  312

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGGKVLI+DYCKRSGPPS EF AYI QRGYDLHD E YGQML+DAGF++VI
Sbjct  313  FRSFFKWLKPGGKVLISDYCKRSGPPSPEFEAYIGQRGYDLHDVEAYGQMLKDAGFDEVI  372

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQ    +   +D         I   S+EDY DIVGGWK KL R+S GEQRWGL
Sbjct  373  AEDRTDQPXSEVLFNIDIX-------ILIPSQEDYKDIVGGWKSKLVRSSMGEQRWGL  423



>gb|KHN10536.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=466

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VIGIDLS NMI++A+ERAIGL  AVEF+ ADC +KTYP+ TFDVIY+RDT+LH++DKP L
Sbjct  283  VIGIDLSINMISLAIERAIGLNYAVEFDCADCYRKTYPENTFDVIYTRDTMLHVKDKPTL  342

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGK+LITDYCK +G PS EFA YIK+ GY LHD + Y QML DAGF+DVI
Sbjct  343  FRSFYKWLKPGGKILITDYCKSAGSPSLEFAEYIKKGGYYLHDIKAYRQMLEDAGFDDVI  402

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF+  L++EL+A+E +K+ FI DFSEEDYN+IV  WK K TR +S EQ WGL
Sbjct  403  AEDRTDQFVNTLQQELNALENKKDDFIGDFSEEDYNEIVERWKAKQTRGASREQMWGL  460



>ref|XP_003525185.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
Length=488

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VIGIDLS NMI++A+ERAIGL  AVEF+ ADC +KTYP+ TFDVIY+RDT+LH++DKP L
Sbjct  305  VIGIDLSINMISLAIERAIGLNYAVEFDCADCYRKTYPENTFDVIYTRDTMLHVKDKPTL  364

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGGK+LITDYCK +G PS EFA YIK+ GY LHD + Y QML DAGF+DVI
Sbjct  365  FRSFYKWLKPGGKILITDYCKSAGSPSLEFAEYIKKGGYYLHDIKAYRQMLEDAGFDDVI  424

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF+  L++EL+A+E +K+ FI DFSEEDYN+IV  WK K TR +S EQ WGL
Sbjct  425  AEDRTDQFVNTLQQELNALENKKDDFIGDFSEEDYNEIVERWKAKQTRGASREQMWGL  482



>gb|KDO63824.1| hypothetical protein CISIN_1g043471mg [Citrus sinensis]
Length=485

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEFEVADCTKKTYP+ +FDVIYSRDTILHIQDKPA
Sbjct  308  HVVGIDLSINMISFALERAIGLKCSVEFEVADCTKKTYPENSFDVIYSRDTILHIQDKPA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SF+KWLKPGG VLI+DYCK  G PS EF+ YIKQRGYDLHD + YGQML+DAGF D+
Sbjct  368  LFKSFFKWLKPGGTVLISDYCKSFGTPSVEFSEYIKQRGYDLHDVKSYGQMLKDAGFVDI  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSE  215
            IAEDRT+QF++VL++ELDA+EK+K+AFI+DFSE
Sbjct  428  IAEDRTEQFVQVLQRELDAIEKDKDAFIKDFSE  460



>gb|AFK34318.1| unknown [Lotus japonicus]
Length=192

 Score =   254 bits (648),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
             VIGIDLS NMI++A+ERAIGLK  VEF+ ADC KKTYPD TFDVIY+RD +LHI+DKP 
Sbjct  8    EVIGIDLSINMISLAIERAIGLKYMVEFDCADCCKKTYPDKTFDVIYTRDAMLHIKDKPT  67

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            +FRSFYKWLKPGGK+LITDYCK +G PS EFA YIK+ GY +HD + Y QML +AGF+D+
Sbjct  68   VFRSFYKWLKPGGKLLITDYCKSAGSPSLEFAEYIKKGGYYIHDMKAYEQMLENAGFDDI  127

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAE+RTD F+K LK+EL+A+E +K+ FI +F EEDYN+IV  WK K  R  S EQ WGL
Sbjct  128  IAENRTDLFVKTLKQELEALENKKDDFICEFGEEDYNEIVERWKAKQIRGESLEQMWGL  186



>gb|KJB30123.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=464

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPA
Sbjct  309  HVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPA  368

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ +
Sbjct  369  LFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVI  428

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSE  215
            +AEDRTDQF++VL++EL+ VEKEK+AFI DFS+
Sbjct  429  LAEDRTDQFLQVLQRELNQVEKEKDAFISDFSK  461



>ref|XP_007160542.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32536.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=496

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI++A+ERAIGL  AVEF+ ADC KK+YPD TFDVIY+RDT+LH++DKP L
Sbjct  313  VVGIDLSINMISLAIERAIGLNYAVEFDCADCFKKSYPDNTFDVIYTRDTMLHVKDKPTL  372

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYK LKPGGK+LITDYCK +  PS EFA YIK+ GY LHD + Y +ML DAGF+D+I
Sbjct  373  FRSFYKGLKPGGKILITDYCKSAQSPSSEFAEYIKKGGYYLHDMKAYEKMLEDAGFDDLI  432

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRTDQF+K L+KELDA+E +K+ FI+DFSEEDYN+IV  WK K +R +S EQ WGL
Sbjct  433  AEDRTDQFVKTLQKELDALENKKDDFIRDFSEEDYNEIVERWKAKQSRGASKEQMWGL  490



>gb|EAY75471.1| hypothetical protein OsI_03371 [Oryza sativa Indica Group]
Length=456

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 140/179 (78%), Gaps = 18/179 (10%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NM++ ALERAIG KC+VEFEVADCTKKTYPD TFDVIYSRDTILHIQDKP+
Sbjct  291  HVVGIDLSINMVSFALERAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPS  350

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+SF+KWLKPGGKVLI+DYCK  G PSEEFAAYIKQRGYDLHD   YG           
Sbjct  351  LFKSFFKWLKPGGKVLISDYCKCPGKPSEEFAAYIKQRGYDLHDVRAYG-----------  399

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
                   QF+ VL++EL  VEK K  F+ DFS+EDY+ IV GWK KL R+S+GEQRWGL
Sbjct  400  -------QFLDVLERELAKVEKNKNEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQRWGL  451



>ref|XP_008675146.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Zea mays]
Length=483

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 139/180 (77%), Gaps = 18/180 (10%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            +HV+GIDLS NMI  ALER+IG KC VEFEVADCT KTYPD  FDVIYSRDTILHIQDKP
Sbjct  317  THVVGIDLSINMIMFALERSIGCKCLVEFEVADCTTKTYPDHMFDVIYSRDTILHIQDKP  376

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            +LF+SF+KWLKPGGKVLI+DYCK  G PSEEFA YIKQRGYDLHD E YG          
Sbjct  377  SLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFATYIKQRGYDLHDVEAYG----------  426

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
                    QF+ VL+KELD  EK K+ F+ +F++EDY+DIV GWK KL R+S+GEQRWGL
Sbjct  427  --------QFLSVLQKELDKFEKNKDDFLSEFAQEDYDDIVNGWKAKLQRSSAGEQRWGL  478



>ref|XP_003534138.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN43631.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=490

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS N+I++A+ERAIGLKC+VEFE ADCTKKTYP+ TFDVIYSRDT+LHI+DKP L
Sbjct  307  VVGIDLSINVISLAIERAIGLKCSVEFECADCTKKTYPENTFDVIYSRDTLLHIKDKPPL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLK GG ++ITDYCK  G PS  +A YIK+ GY +HD + Y QML +AGF+DV+
Sbjct  367  FRSFYKWLKRGGTLIITDYCKSEGSPSLGYAEYIKKGGYHIHDMKTYCQMLENAGFDDVV  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+ FMK L++EL+A+E +K+ FI +FSEEDYN I   WK K  R + GEQ WGL
Sbjct  427  AEDRTNLFMKTLQQELNALESKKDDFIDEFSEEDYNGITERWKAKQMRGADGEQIWGL  484



>ref|XP_010500398.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=474

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERAIGLKC+VEF+VADCT KTYPD +FDVIYSRDT LH+ DKP 
Sbjct  290  HVVGIDLSVNMISFALERAIGLKCSVEFDVADCTTKTYPDNSFDVIYSRDTFLHVHDKPP  349

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR+F+KWLKPGGK+LITD+C+ +G PS E   Y+++R YDLH  + YG ML++AGFEDV
Sbjct  350  LFRTFFKWLKPGGKILITDFCRSAGTPSLEVVEYMERRRYDLHGVQAYGNMLKEAGFEDV  409

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRTDQF++VL +EL+ V+KEKE +I DFSE DYNDIV  W  KL + +S E +WGL
Sbjct  410  IAEDRTDQFIQVLSRELEKVKKEKEEYISDFSEGDYNDIVRVWTAKLRKAASNELKWGL  468



>gb|ABK24808.1| unknown [Picea sitchensis]
Length=472

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 138/163 (85%), Gaps = 3/163 (2%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+ IDLS NMI+ ALERAIG +CAVEFEV+DCTKK YP+ TFDVIYSRDTILHIQDKP L
Sbjct  306  VMAIDLSINMISFALERAIGRQCAVEFEVSDCTKKEYPEGTFDVIYSRDTILHIQDKPVL  365

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            F+ FYKWLKPGG++LI+DYCK  G  S EF AYIKQRGYDLHD + YGQMLRDAGF+DV+
Sbjct  366  FQKFYKWLKPGGRLLISDYCKEHGTASLEFHAYIKQRGYDLHDVDAYGQMLRDAGFDDVV  425

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYN---DIVG  191
            AEDRTDQF+K+L+KEL + EK+K+AFI+DFSE   N    IVG
Sbjct  426  AEDRTDQFIKILQKELSSAEKDKDAFIRDFSEVSLNSNLSIVG  468



>ref|XP_003619840.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=419

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+ IDLS NMI++A+ERAIGLK AVEFE  DCTKK+YPD TFDVIYSRDT+LHI+DKP L
Sbjct  236  VVAIDLSINMISLAIERAIGLKYAVEFECVDCTKKSYPDKTFDVIYSRDTLLHIKDKPTL  295

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGG +LITDYCK  G  S E+A YIK+RGY +HD + Y QML +AGF+DVI
Sbjct  296  FRSFYKWLKPGGTLLITDYCKSVGSLSVEYAEYIKKRGYYIHDMKAYFQMLENAGFDDVI  355

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            A D+T+ F+K L+ EL+A+E +K  FI DFSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  356  AVDQTNLFLKTLQMELNALENKKVDFIDDFSEDDYNEIVERWKAKQMRGVAGEQIWGL  413



>ref|XP_003619836.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AES76054.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=497

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+ IDLS NMI++A+ERAIGLK AVEFE  DCTKK+YPD TFDVIYSRDT+LHI+DKP L
Sbjct  314  VVAIDLSINMISLAIERAIGLKYAVEFECVDCTKKSYPDKTFDVIYSRDTLLHIKDKPTL  373

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGG +LITDYCK  G  S E+A YIK+RGY +HD + Y QML +AGF+DVI
Sbjct  374  FRSFYKWLKPGGTLLITDYCKSVGSLSVEYAEYIKKRGYYIHDMKAYFQMLENAGFDDVI  433

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            A D+T+ F+K L+ EL+A+E +K  FI DFSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  434  AVDQTNLFLKTLQMELNALENKKVDFIDDFSEDDYNEIVERWKAKQMRGVAGEQIWGL  491



>gb|AFK45429.1| unknown [Medicago truncatula]
Length=341

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+G+DLS N+I+ A+ERAIGLK  VEF+ ADC+KKTYP+ T+DVIY+RD +L+I+DKP L
Sbjct  159  VVGVDLSINVISRAIERAIGLKYTVEFDCADCSKKTYPEKTYDVIYTRDAMLYIKDKPTL  218

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +AGF DVI
Sbjct  219  FRSFFKWLKPGGQLLITDYCKSAGSPSSEFAEYIKEGGYYIHDMKEYEQMLENAGF-DVI  277

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             EDRTDQF+K L++EL  +E +K+ FI DFS +DY++IV  WK K  R   GEQ+WGL
Sbjct  278  VEDRTDQFVKTLQQELITLESQKDDFISDFSNDDYDEIVERWKAKQIRGERGEQKWGL  335



>ref|XP_003528975.2| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN44632.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=531

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS N+I++A+ERAIGLKC VEFE ADCTKKT+P  TFDVIYSRDT+LHI+DKP+L
Sbjct  349  VVGIDLSINIISLAIERAIGLKCCVEFECADCTKKTFPVNTFDVIYSRDTLLHIKDKPSL  408

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLK GG +LITDYCK  G  S  +A YIK+ GY +HD + Y +ML +AGF+DV+
Sbjct  409  FRSFYKWLKRGGTLLITDYCKSEGSLSLGYAEYIKKGGYYIHDMKTYCRMLENAGFDDVV  468

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            AEDRT+ FMK L++EL+A+  +K+ FI DFSEEDYN+I   WK K  R + GEQ W L
Sbjct  469  AEDRTNLFMKTLQQELNALHSKKDDFIDDFSEEDYNEITERWKAKQMRGADGEQIWSL  526



>ref|XP_004512745.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Cicer arietinum]
Length=496

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VI IDLS NMI++A+ERAIGLK AVEFE  DCTKKTYP+ TFDVIY+RDT+LHI+DKP L
Sbjct  313  VIAIDLSINMISLAIERAIGLKYAVEFECVDCTKKTYPEKTFDVIYTRDTLLHIKDKPTL  372

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGG +LI+DYCK  G  S E+A YIK+RGY +HD   Y QML +AGF+ VI
Sbjct  373  FRSFYKWLKPGGTLLISDYCKSVGNLSIEYAEYIKKRGYYIHDMNAYCQMLENAGFDYVI  432

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             +D+T+ F+K L+KEL+++E +K  FI +FSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  433  DQDQTNLFLKTLQKELNSLENKKVDFINEFSEDDYNEIVERWKAKKMRGEAGEQIWGL  490



>ref|XP_004503268.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cicer 
arietinum]
Length=490

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+G+DLS NMI+ A+ERAIGLK  VEF+ ADC+KKTYP+ TFDVIY+RD++L+I+DK  L
Sbjct  307  VVGVDLSINMISHAIERAIGLKYTVEFDCADCSKKTYPEKTFDVIYTRDSMLYIKDKSTL  366

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +AGF+ V+
Sbjct  367  FRSFYKWLKPGGQLLITDYCKCAGSPSSEFAKYIKEGGYHIHDMKEYEQMLENAGFDVVV  426

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             EDRTDQF+K L++EL A+E +K+ FI + S++DYN+IV  WK K  R   GEQ+WGL
Sbjct  427  VEDRTDQFVKTLEQELIALESKKDDFICELSDDDYNEIVERWKGKQIRGECGEQKWGL  484



>ref|XP_004512744.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            VI IDLS NMI++A+ERAIGLK AVEFE  DCTKKTYP+ TFDVIY+RDT+LHI+DKP L
Sbjct  314  VIAIDLSINMISLAIERAIGLKYAVEFECVDCTKKTYPEKTFDVIYTRDTLLHIKDKPTL  373

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGG +LI+DYCK  G  S E+A YIK+RGY +HD   Y QML +AGF+ VI
Sbjct  374  FRSFYKWLKPGGTLLISDYCKSVGNLSIEYAEYIKKRGYYIHDMNAYCQMLENAGFDYVI  433

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             +D+T+ F+K L+KEL+++E +K  FI +FSE+DYN+IV  WK K  R  +GEQ WGL
Sbjct  434  DQDQTNLFLKTLQKELNSLENKKVDFINEFSEDDYNEIVERWKAKKMRGEAGEQIWGL  491



>ref|XP_003631125.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AET05601.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=488

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+G+DLS N+I+ A+ERAIGLK  VEF+ ADC+KKTYP+ T+DVIY+RD +L+I+DKP L
Sbjct  306  VVGVDLSINVISRAIERAIGLKYTVEFDCADCSKKTYPEKTYDVIYTRDAMLYIKDKPTL  365

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +AGF DVI
Sbjct  366  FRSFFKWLKPGGQLLITDYCKSAGSPSSEFAEYIKEGGYYIHDMKEYEQMLENAGF-DVI  424

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             EDRTDQF+K L++EL  +E +K+ FI DFS +DY++IV  WK K  R   GEQ+WGL
Sbjct  425  VEDRTDQFVKTLQQELITLESQKDDFISDFSNDDYDEIVERWKAKQIRGERGEQKWGL  482



>gb|AET05600.2| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=494

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+G+DLS N+I+ A+ERAIGLK  VEF+ ADC+KKTYP+ T+DVIY+RD +L+I+DKP L
Sbjct  312  VVGVDLSINVISRAIERAIGLKYTVEFDCADCSKKTYPEKTYDVIYTRDAMLYIKDKPTL  371

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +AGF DVI
Sbjct  372  FRSFFKWLKPGGQLLITDYCKSAGSPSSEFAEYIKEGGYYIHDMKEYEQMLENAGF-DVI  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             EDRTDQF+K L++EL  +E +K+ FI DFS +DY++IV  WK K  R   GEQ+WGL
Sbjct  431  VEDRTDQFVKTLQQELITLESQKDDFISDFSNDDYDEIVERWKAKQIRGERGEQKWGL  488



>ref|XP_007152684.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
 gb|ESW24678.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
Length=497

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI++A+ER IGLKC+VEFE ADCTKK+YP+ TFDVIYSRDT+LHI+DKP+L
Sbjct  314  VVGIDLSINMISLAIERVIGLKCSVEFECADCTKKSYPENTFDVIYSRDTLLHIKDKPSL  373

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYKWLKPGG +LITDYCK  G  S  +A YI++ GY +H+ + Y QML  AGF DVI
Sbjct  374  FRSFYKWLKPGGTLLITDYCKSVGSLSVGYANYIQKGGYYIHEMKTYSQMLEFAGFNDVI  433

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            A D+++ FMK L++EL+ +E +K+ FI  FS+EDYN I   WK K  R + GEQ WGL
Sbjct  434  AMDQSNLFMKTLQQELNDLESKKDDFIDYFSKEDYNKISERWKAKQMRGADGEQIWGL  491



>ref|XP_003631124.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=495

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+G+DLS N+I+ A+ERAIGLK  VEF+ ADC+KKTYP+ T+DVIY+RD +L+I+DKP L
Sbjct  312  VVGVDLSINVISRAIERAIGLKYTVEFDCADCSKKTYPEKTYDVIYTRDAMLYIKDKPTL  371

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +AGF DVI
Sbjct  372  FRSFFKWLKPGGQLLITDYCKSAGSPSSEFAEYIKEGGYYIHDMKEYEQMLENAGF-DVI  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSE-EDYNDIVGGWKLKLTRTSSGEQRWGL  137
             EDRTDQF+K L++EL  +E +K+ FI DFS  +DY++IV  WK K  R   GEQ+WGL
Sbjct  431  VEDRTDQFVKTLQQELITLESQKDDFISDFSNVDDYDEIVERWKAKQIRGERGEQKWGL  489



>ref|XP_007209941.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11140.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=463

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI+ ALERAIGLKCAVEFEVADCT+KTY D TFDVIYSRDTILHIQDKPAL
Sbjct  308  VVGIDLSVNMISFALERAIGLKCAVEFEVADCTQKTYADDTFDVIYSRDTILHIQDKPAL  367

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFY+WLKPGGKVLI+DYC+ +G PS EFA YIKQRGYDLH+ + YGQML+DAGF++VI
Sbjct  368  FRSFYRWLKPGGKVLISDYCRSAGTPSAEFAEYIKQRGYDLHNVQAYGQMLKDAGFDEVI  427

Query  310  AEDRTDQ  290
            AEDRTDQ
Sbjct  428  AEDRTDQ  434



>gb|KJB30119.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=443

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDLS NMI+ ALERA GLKC+VEFEVADCTKK YPD +FDVIYSRDTILHI DKPA
Sbjct  309  HVVGIDLSVNMISFALERATGLKCSVEFEVADCTKKVYPDNSFDVIYSRDTILHIHDKPA  368

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFRSFYKWLKPGGK+LI+DYCK S  PS EFAAYIKQRGYDLHD + YGQML DAGF+ +
Sbjct  369  LFRSFYKWLKPGGKLLISDYCKSSKTPSTEFAAYIKQRGYDLHDVKSYGQMLEDAGFDVI  428

Query  313  IAEDRTDQ  290
            +AEDRTDQ
Sbjct  429  LAEDRTDQ  436



>ref|XP_007160543.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32537.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=517

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+GIDLS NMI++A+ERAIGL  AVEF+ ADC KK+YPD TFDVIY+RDT+LH++DKP L
Sbjct  313  VVGIDLSINMISLAIERAIGLNYAVEFDCADCFKKSYPDNTFDVIYTRDTMLHVKDKPTL  372

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSFYK LKPGGK+LITDYCK +  PS EFA YIK+ GY LHD + Y +ML DAGF+D+I
Sbjct  373  FRSFYKGLKPGGKILITDYCKSAQSPSSEFAEYIKKGGYYLHDMKAYEKMLEDAGFDDLI  432

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFSE  215
            AEDRTDQF+K L+KELDA+E +K+ FI+DFSE
Sbjct  433  AEDRTDQFVKTLQKELDALENKKDDFIRDFSE  464



>emb|CDY07952.1| BnaC03g35710D [Brassica napus]
Length=396

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDL  NM++ ALERAIGL C+VEFEVADCT  TYPD +FDVIYS  TI HIQDKPA
Sbjct  222  HVVGIDLLVNMMSFALERAIGLNCSVEFEVADCTTNTYPDNSFDVIYSSATIFHIQDKPA  281

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF++F+KWLKPGG+VLITDYCK    PS  FA YIKQ GYD+HD + YGQML+DAGFEDV
Sbjct  282  LFKTFFKWLKPGGRVLITDYCKSDETPSPLFAEYIKQGGYDIHDVQAYGQMLKDAGFEDV  341

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYND  200
            IAEDR DQ           ++K+K  FI DFSE   +D
Sbjct  342  IAEDRIDQVTLTHIHIHVQIKKKKNLFISDFSEVKKHD  379



>gb|KJB53041.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=448

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            +V+GIDLS NMI+ ALERA GL C+VEFEVADCT KTYPD +FDVIYSRDTILHIQDKPA
Sbjct  305  YVVGIDLSINMISFALERANGLNCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPA  364

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR FYKWLKPGGKVLI+DYCK +G  S EFA YIKQRGYDLHD + YGQML DAGF+ V
Sbjct  365  LFRYFYKWLKPGGKVLISDYCKSAGASSPEFAEYIKQRGYDLHDVKAYGQMLTDAGFDQV  424

Query  313  IAEDRTDQ  290
            IAEDRTDQ
Sbjct  425  IAEDRTDQ  432



>ref|XP_010774827.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Notothenia 
coriiceps]
Length=438

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+  A+ERAI  K  +V+FEVAD TK+++PDA+FDVIYSRDTILHI+DK A
Sbjct  254  VLGLDLSDNMVDTAMERAITEKLPSVQFEVADATKRSFPDASFDVIYSRDTILHIEDKLA  313

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGGK+LI+DYC      +  F AY+KQRGY LH   +YGQ +++AGF +V
Sbjct  314  LFKRFHSWLKPGGKLLISDYCCGEKSWTPAFQAYVKQRGYVLHTPSQYGQFIQEAGFCNV  373

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             +EDRT QF++V+K EL   E  ++ FIQ+FSEEDY  IV GW+ KL R++SG+QRWGL
Sbjct  374  RSEDRTAQFIQVIKTELQRAELIRDEFIQEFSEEDYLAIVKGWREKLERSNSGDQRWGL  432



>ref|XP_003970259.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Takifugu 
rubripes]
Length=484

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            VIG+DLS NM+ IA+ERAI  K  +V+FEVAD TK+ +PD +FDVIYSRDTILHI +KPA
Sbjct  300  VIGLDLSENMVNIAMERAIAEKLPSVQFEVADATKRMFPDCSFDVIYSRDTILHIDNKPA  359

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F  Y+KQRGY L+   +YG+ L +AGF +V
Sbjct  360  LFKRFHSWLKPGGQLLISDYCCGEKPWTPVFETYVKQRGYILYTPPQYGKFLTEAGFCNV  419

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRT QF++V++ EL+  E  ++ FI++FS+EDY  IV GWK KL R+ SG+QRWGL
Sbjct  420  LAEDRTAQFIQVIETELERAEAIRKEFIEEFSDEDYLAIVNGWKEKLARSKSGDQRWGL  478



>ref|XP_004073222.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Oryzias 
latipes]
Length=485

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA ERA+  K   V+FEVAD TK+T+P+ +FDV+YSRDTILHI DK A
Sbjct  301  VLGLDLSDNMVEIAAERALTEKLPTVQFEVADATKRTFPEGSFDVVYSRDTILHIDDKLA  360

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR F+ WLKPGG++LI+DYC    P S+ F +Y+KQRGY L+   +YG+ +++AGF +V
Sbjct  361  LFRRFHSWLKPGGQLLISDYCCGEKPWSQAFESYVKQRGYILYTPAQYGKFIQEAGFCEV  420

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  KE FIQ+FSEEDY  +V GWK KL R+++G+QRWGL
Sbjct  421  RAEDRTSQFIQVIKDELKKAEAIKEEFIQEFSEEDYLAVVNGWKEKLERSNTGDQRWGL  479



>ref|NP_001070105.1| phosphoethanolamine methyltransferase [Danio rerio]
 gb|AAI24222.1| Zgc:153034 [Danio rerio]
Length=489

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCA-VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS+NM+ IA+ERA+  K   V+FEV+D TK+ +PDA FDV+YSRDTILHI+DK  
Sbjct  305  VLGMDLSSNMVEIAMERAVKEKLPLVQFEVSDATKRRFPDAAFDVVYSRDTILHIRDKLH  364

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF +FY W+KPGGK+LI+DYC    P S  F  Y+KQRGY L+  + YGQ LR+ GF +V
Sbjct  365  LFTNFYSWMKPGGKLLISDYCCGEKPWSPAFQDYVKQRGYILYTPQRYGQFLREVGFSNV  424

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT+QF++V+K EL   E+ K+ FIQ+FS+ED++ IV GW  KL R  +G+QRWGL
Sbjct  425  RAEDRTEQFIQVIKSELQRAEEMKDEFIQEFSKEDFDAIVSGWTEKLQRCETGDQRWGL  483



>gb|AAI35513.1| LOC100124841 protein [Xenopus (Silurana) tropicalis]
Length=486

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 133/179 (74%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCA-VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS+NM+ IA+ERAI  K   V+FE+ D TK+++ +A+FDV+YSRDTILHI DK A
Sbjct  297  VLGMDLSSNMVEIAMERAIIEKIPLVQFEIGDATKRSFSEASFDVVYSRDTILHINDKEA  356

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR FY WLKPGGK+LITDYC    P S  F  Y+KQRGY L+  +EYGQ L  AGF +V
Sbjct  357  LFRRFYTWLKPGGKLLITDYCCGERPWSPVFQEYVKQRGYILYTPQEYGQFLEKAGFVNV  416

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             A+DRT+QF+ VL KEL   +  K+ FI+ FSEEDYN I+ GWK K  R S G+QRWGL
Sbjct  417  QAQDRTEQFVNVLNKELGRTQDIKKEFIESFSEEDYNYIIDGWKEKQHRCSLGDQRWGL  475


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 67/146 (46%), Gaps = 9/146 (6%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            SHV  +D   N I    ++  G +  + F  AD T    P+ +FD I+S    +++ D  
Sbjct  65   SHVTAVDFMQNFIEKN-QKDNGFRGNITFLQADVTNLDLPNESFDFIFSNWLFMYLTDAE  123

Query  496  --ALFRSFYKWLKPGGKVLITDYC-KRSGPPSEEF--AAYIKQRGYDLHDTEEYGQMLRD  332
              AL +    WLKPGG +   + C  +SG    +F    Y     Y+L  T     +  D
Sbjct  124  LLALIQKMLGWLKPGGYLFFRESCFFQSGDKQRKFNPTVYRTPAQYNLLLTSA-ASVSGD  182

Query  331  AGFEDVIAEDRTDQFMKVLKKELDAV  254
            +GFE V++  R+ Q    LKK  + V
Sbjct  183  SGFEIVMS--RSVQTYIKLKKNQNQV  206



>ref|XP_007550439.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Poecilia 
formosa]
Length=492

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 137/179 (77%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA   K  +V+FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  308  VLGLDLSDNMVDIAIERARAEKLPSVQFEVADATKRTFPEGSFDVIYSRDTILHIDDKVA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF +V
Sbjct  368  LFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSEYGKFIQEAGFCNV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
              EDRT QF++V++ EL   E  KE FIQ+FSEEDY+ IV GW+ KL R+ SG+QRWGL
Sbjct  428  RVEDRTAQFIQVIQTELQRAEDIKEEFIQEFSEEDYSAIVNGWREKLDRSKSGDQRWGL  486



>ref|NP_001096276.2| phosphoethanolamine methyltransferase [Xenopus (Silurana) tropicalis]
Length=494

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 133/179 (74%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCA-VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS+NM+ IA+ERAI  K   V+FE+ D TK+++ +A+FDV+YSRDTILHI DK A
Sbjct  305  VLGMDLSSNMVEIAMERAIIEKIPLVQFEIGDATKRSFSEASFDVVYSRDTILHINDKEA  364

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LFR FY WLKPGGK+LITDYC    P S  F  Y+KQRGY L+  +EYGQ L  AGF +V
Sbjct  365  LFRRFYTWLKPGGKLLITDYCCGERPWSPVFQEYVKQRGYILYTPQEYGQFLEKAGFVNV  424

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             A+DRT+QF+ VL KEL   +  K+ FI+ FSEEDYN I+ GWK K  R S G+QRWGL
Sbjct  425  QAQDRTEQFVNVLNKELGRTQDIKKEFIESFSEEDYNYIIDGWKEKQHRCSLGDQRWGL  483


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 67/146 (46%), Gaps = 9/146 (6%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            SHV  +D   N I    ++  G +  + F  AD T    P+ +FD I+S    +++ D  
Sbjct  73   SHVTAVDFMQNFIEKN-QKDNGFRGNITFLQADVTNLDLPNESFDFIFSNWLFMYLTDAE  131

Query  496  --ALFRSFYKWLKPGGKVLITDYC-KRSGPPSEEF--AAYIKQRGYDLHDTEEYGQMLRD  332
              AL +    WLKPGG +   + C  +SG    +F    Y     Y+L  T     +  D
Sbjct  132  LLALIQKMLGWLKPGGYLFFRESCFFQSGDKQRKFNPTVYRTPAQYNLLLTSA-ASVSGD  190

Query  331  AGFEDVIAEDRTDQFMKVLKKELDAV  254
            +GFE V++  R+ Q    LKK  + V
Sbjct  191  SGFEIVMS--RSVQTYIKLKKNQNQV  214



>ref|XP_008324913.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Cynoglossus semilaevis]
Length=491

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA+     +V+FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  307  VLGLDLSENMVEIAMERALKENLPSVQFEVADATKRTFPEGSFDVIYSRDTILHIDDKLA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGGK+LI+DYC    P + EF AY+K+RGY L+   +YG+++ +AGF +V
Sbjct  367  LFQRFHSWLKPGGKLLISDYCCGEKPWNPEFEAYVKKRGYILYTPSQYGKVIEEAGFRNV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             A DRT+QF++VLK EL   +  K  FIQ+FSEEDY  IV GW  KL R++SG QRWGL
Sbjct  427  QATDRTEQFIQVLKTELQRAQAMKTQFIQEFSEEDYFAIVNGWSDKLKRSNSGAQRWGL  485



>ref|XP_008324912.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Cynoglossus semilaevis]
Length=495

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 136/183 (74%), Gaps = 5/183 (3%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAI-----GLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQ  506
            V+G+DLS NM+ IA+ERA+      +   V+FEVAD TK+T+P+ +FDVIYSRDTILHI 
Sbjct  307  VLGLDLSENMVEIAMERALKENLPSVHLNVQFEVADATKRTFPEGSFDVIYSRDTILHID  366

Query  505  DKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAG  326
            DK ALF+ F+ WLKPGGK+LI+DYC    P + EF AY+K+RGY L+   +YG+++ +AG
Sbjct  367  DKLALFQRFHSWLKPGGKLLISDYCCGEKPWNPEFEAYVKKRGYILYTPSQYGKVIEEAG  426

Query  325  FEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQR  146
            F +V A DRT+QF++VLK EL   +  K  FIQ+FSEEDY  IV GW  KL R++SG QR
Sbjct  427  FRNVQATDRTEQFIQVLKTELQRAQAMKTQFIQEFSEEDYFAIVNGWSDKLKRSNSGAQR  486

Query  145  WGL  137
            WGL
Sbjct  487  WGL  489



>ref|XP_008324914.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324916.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324917.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
Length=488

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 136/183 (74%), Gaps = 5/183 (3%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAI-----GLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQ  506
            V+G+DLS NM+ IA+ERA+      +   V+FEVAD TK+T+P+ +FDVIYSRDTILHI 
Sbjct  300  VLGLDLSENMVEIAMERALKENLPSVHLNVQFEVADATKRTFPEGSFDVIYSRDTILHID  359

Query  505  DKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAG  326
            DK ALF+ F+ WLKPGGK+LI+DYC    P + EF AY+K+RGY L+   +YG+++ +AG
Sbjct  360  DKLALFQRFHSWLKPGGKLLISDYCCGEKPWNPEFEAYVKKRGYILYTPSQYGKVIEEAG  419

Query  325  FEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQR  146
            F +V A DRT+QF++VLK EL   +  K  FIQ+FSEEDY  IV GW  KL R++SG QR
Sbjct  420  FRNVQATDRTEQFIQVLKTELQRAQAMKTQFIQEFSEEDYFAIVNGWSDKLKRSNSGAQR  479

Query  145  WGL  137
            WGL
Sbjct  480  WGL  482



>ref|XP_004545582.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Maylandia zebra]
Length=491

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA      +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  307  VLGLDLSDNMVDIAIERAKAENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  367  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ FI++FSEEDY +IV GWK KL R++SG+QRWGL
Sbjct  427  RAEDRTAQFIEVIKTELQRAEVIKDEFIKEFSEEDYFEIVNGWKEKLERSNSGDQRWGL  485



>ref|XP_004545581.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Maylandia zebra]
Length=492

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA      +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  308  VLGLDLSDNMVDIAIERAKAENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  368  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ FI++FSEEDY +IV GWK KL R++SG+QRWGL
Sbjct  428  RAEDRTAQFIEVIKTELQRAEVIKDEFIKEFSEEDYFEIVNGWKEKLERSNSGDQRWGL  486



>ref|XP_005723168.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Pundamilia nyererei]
Length=491

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA      +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  307  VLGLDLSDNMVDIAIERAKAENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  367  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  427  RAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  485



>ref|XP_005723169.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Pundamilia nyererei]
Length=485

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA      +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  301  VLGLDLSDNMVDIAIERAKAENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  360

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  361  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  420

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  421  RAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  479



>ref|XP_005723167.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Pundamilia nyererei]
Length=492

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA      +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  308  VLGLDLSDNMVDIAIERAKAENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  368  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  428  RAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  486



>ref|XP_005467629.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X4 [Oreochromis niloticus]
Length=485

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  301  VLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  360

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  361  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  420

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  421  RAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSTSGDQRWGL  479



>ref|XP_005467627.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Oreochromis niloticus]
 ref|XP_005467628.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Oreochromis niloticus]
Length=492

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  308  VLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  368  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  428  RAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSTSGDQRWGL  486



>ref|XP_005913451.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Haplochromis burtoni]
Length=485

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  301  VLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  360

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  361  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  420

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  421  RAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  479



>ref|XP_005913450.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Haplochromis burtoni]
Length=492

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  308  VLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  368  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  428  RAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  486



>ref|XP_003444639.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Oreochromis niloticus]
Length=493

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  309  VLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  368

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  369  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  428

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ FI++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  429  RAEDRTAQFIEVIKTELQRAEAIKDEFIKEFSEEDYFAIVNGWKEKLERSTSGDQRWGL  487



>ref|XP_005643867.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19323.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=498

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 130/180 (72%), Gaps = 3/180 (2%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKP  497
            + V G+DLS NM+T ALER +    +V FE+AD T       ++DV+YSRDTILHI DKP
Sbjct  315  AFVHGVDLSVNMVTTALERTVS---SVSFEIADITTCEMAKESYDVVYSRDTILHIHDKP  371

Query  496  ALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFED  317
            ALF+ F   LKPGG++LI+DYC+  G PS++FAAYI QRGYDLH  ++YG+ML  AGF D
Sbjct  372  ALFKRFLDVLKPGGRLLISDYCRAPGSPSDKFAAYIAQRGYDLHSVDDYGRMLTKAGFVD  431

Query  316  VIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            V AEDRT QF   LKKE++A E  +E F++DFS  D++ IV GW+ KL R   GEQRWGL
Sbjct  432  VKAEDRTWQFEACLKKEVEAAEAGREEFVRDFSAADHDAIVSGWRDKLVRVGEGEQRWGL  491



>ref|XP_006781399.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Neolamprologus 
brichardi]
Length=492

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERA-IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA +    +V FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  308  VLGLDLSDNMVDIAIERAKVENVPSVRFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF  V
Sbjct  368  LFKRFHSWLKPGGQLLISDYCCGKKPWTPAFEAYVKQRGYVLYTPSEYGKFIQEAGFSKV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V+K EL   E  K+ F+++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  428  RAEDRTAQFIEVIKTELQRAEAIKDEFVKEFSEEDYFAIVNGWKEKLGRSNSGDQRWGL  486



>ref|XP_008278560.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
 ref|XP_008278561.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
Length=492

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 137/179 (77%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLK-CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERAI  K  +V+FEV+D TK+ +P+ +FDVIYSRDTILHI DK A
Sbjct  308  VLGMDLSDNMVDIAMERAIAEKLTSVQFEVSDATKRMFPEGSFDVIYSRDTILHIDDKLA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   +YG+ +++AGF +V
Sbjct  368  LFKRFHSWLKPGGQLLISDYCCGEKPWTPAFEAYVKQRGYVLYTPTQYGKFIQEAGFSNV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             A+DRT  F++V+K EL   E  K+ +I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  428  RADDRTGHFIQVIKTELQRAEAIKDDYIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  486



>emb|CDY35847.1| BnaC09g37790D [Brassica napus]
Length=376

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 118/158 (75%), Gaps = 2/158 (1%)
 Frame = -2

Query  673  HVIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            HV+GIDL  NM++ ALERAIGL C+VEFEVADCT  TYPD +FDVIYS  TI HIQDKPA
Sbjct  208  HVVGIDLLVNMMSFALERAIGLNCSVEFEVADCTTNTYPDNSFDVIYSSATIFHIQDKPA  267

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF++F+KWLKPGG+VLITDYCK    PS  FA YIKQRGYD+HD + YGQ+   AGFEDV
Sbjct  268  LFKTFFKWLKPGGRVLITDYCKSDETPSPVFAEYIKQRGYDIHDVQAYGQVY--AGFEDV  325

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYND  200
            IAEDR DQ           ++K+K  FI DFSE   +D
Sbjct  326  IAEDRIDQVTLTHIHIHVQIKKKKNLFISDFSEVKKHD  363



>emb|CCA16454.1| phosphoethanolamine Nmethyltransferase putative [Albugo laibachii 
Nc14]
Length=494

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 129/179 (72%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIG-LKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+GIDLSTNM+  ALE ++   +  VEFE+ D T + +PD +FDVIYSRDTILHIQDK  
Sbjct  310  VLGIDLSTNMVHRALEHSMNETQLDVEFEICDATTREFPDESFDVIYSRDTILHIQDKTT  369

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F++WL+PGG+VLITDYC+    P+  FA Y++ RGY L   E YG +L +AGF +V
Sbjct  370  LFQRFFRWLRPGGRVLITDYCRGGKRPTNRFADYVQGRGYHLLTVEAYGALLTEAGFRNV  429

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            IAEDRT QFM +L++ELD     K+ FIQ+ S +D+N IV GW+ KL R   G+QRWG 
Sbjct  430  IAEDRTRQFMNILREELDRTVSSKDEFIQETSNDDFNAIVKGWEAKLIRCDEGDQRWGF  488



>gb|KEH21429.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=469

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPAL  491
            V+G+DLS N+I+ A+ERAIGLK  VEF+ ADC+KKTYP+ T+DVIY+RD +L+I+DKP L
Sbjct  312  VVGVDLSINVISRAIERAIGLKYTVEFDCADCSKKTYPEKTYDVIYTRDAMLYIKDKPTL  371

Query  490  FRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDVI  311
            FRSF+KWLKPGG++LITDYCK +G PS EFA YIK+ GY +HD +EY QML +AGF DVI
Sbjct  372  FRSFFKWLKPGGQLLITDYCKSAGSPSSEFAEYIKEGGYYIHDMKEYEQMLENAGF-DVI  430

Query  310  AEDRTDQFMKVLKKELDAVEKEKEAFIQDFS  218
             EDRTDQF+K L++EL  +E +K+ FI DFS
Sbjct  431  VEDRTDQFVKTLQQELITLESQKDDFISDFS  461



>ref|XP_008278559.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Stegastes partitus]
Length=510

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 137/179 (77%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLK-CAVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERAI  K  +V+FEV+D TK+ +P+ +FDVIYSRDTILHI DK A
Sbjct  326  VLGMDLSDNMVDIAMERAIAEKLTSVQFEVSDATKRMFPEGSFDVIYSRDTILHIDDKLA  385

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   +YG+ +++AGF +V
Sbjct  386  LFKRFHSWLKPGGQLLISDYCCGEKPWTPAFEAYVKQRGYVLYTPTQYGKFIQEAGFSNV  445

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             A+DRT  F++V+K EL   E  K+ +I++FSEEDY  IV GWK KL R++SG+QRWGL
Sbjct  446  RADDRTGHFIQVIKTELQRAEAIKDDYIKEFSEEDYFAIVNGWKEKLERSNSGDQRWGL  504



>ref|XP_005806845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Xiphophorus 
maculatus]
Length=492

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA   K  +V+FEVAD TK+T+P+  FDVIYSRDTILHI DK  
Sbjct  308  VLGLDLSDNMVDIAIERARAEKLPSVQFEVADATKRTFPEGLFDVIYSRDTILHIDDKLD  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF +V
Sbjct  368  LFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSEYGKFIQEAGFCNV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
              EDRT QF++V++ EL   E  KE FIQ+FSEEDY+ IV GW+ KL R+ SG+QRWGL
Sbjct  428  RVEDRTAQFIQVIQTELQRAEDIKEEFIQEFSEEDYSAIVDGWREKLDRSKSGDQRWGL  486



>ref|XP_010730440.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Larimichthys crocea]
Length=500

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERAI  K  +V+FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  316  VLGLDLSDNMVDIAMERAITEKLPSVQFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  375

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   +YG+ L +AGF +V
Sbjct  376  LFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSQYGKFLEEAGFCNV  435

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V++ EL   E  K+ F + FSEEDY  I+ GW+ KL R++SG+QRWGL
Sbjct  436  RAEDRTAQFIQVIETELQRAEAIKDEFTEQFSEEDYFAIINGWREKLGRSNSGDQRWGL  494



>ref|XP_010730439.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Larimichthys crocea]
Length=506

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERAI  K  +V+FEVAD TK+T+P+ +FDVIYSRDTILHI DK A
Sbjct  322  VLGLDLSDNMVDIAMERAITEKLPSVQFEVADATKRTFPEDSFDVIYSRDTILHIDDKLA  381

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   +YG+ L +AGF +V
Sbjct  382  LFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSQYGKFLEEAGFCNV  441

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QF++V++ EL   E  K+ F + FSEEDY  I+ GW+ KL R++SG+QRWGL
Sbjct  442  RAEDRTAQFIQVIETELQRAEAIKDEFTEQFSEEDYFAIINGWREKLGRSNSGDQRWGL  500



>ref|XP_009832411.1| hypothetical protein H257_08283 [Aphanomyces astaci]
 gb|ETV78074.1| hypothetical protein H257_08283 [Aphanomyces astaci]
Length=507

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 126/179 (70%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKCA-VEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+GIDLSTNM+  ALE+++      VEFEV D T K YP  +FDVIYSRDTILHIQDK  
Sbjct  323  VVGIDLSTNMVHRALEQSVADPTVDVEFEVCDATTKEYPAGSFDVIYSRDTILHIQDKLG  382

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF  FY+WLKPGG+VLI+DYC+   P S+ F AY+  RGY L    +YG +L  AGF DV
Sbjct  383  LFEKFYRWLKPGGRVLISDYCRGDQPQSDRFQAYVASRGYHLLSPSQYGGVLTAAGFADV  442

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
            +AEDRT+ F  VL+ EL      ++ FI   SE+DY DIVGGW+ KLTR + G+Q+WGL
Sbjct  443  VAEDRTEHFTNVLEAELARTVANRDEFIAQTSEKDYQDIVGGWESKLTRCADGDQKWGL  501



>ref|NP_001167350.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
 gb|ACN11445.1| phosphoethanolamine N-methyltransferase 3 [Salmo salar]
Length=495

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 134/179 (75%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA+  K  +V FEVAD TK+ +P+A+FDV+YSRDTILHI +K A
Sbjct  311  VLGLDLSANMVDIAIERAMEEKLPSVHFEVADATKREFPEASFDVVYSRDTILHIDEKLA  370

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG+VLI+DYC    P + +F  Y+KQRGY L+   +YG+ L+ AGF +V
Sbjct  371  LFKRFHSWLKPGGQVLISDYCCGEKPWTPQFQEYVKQRGYILYTPPQYGKFLQQAGFSNV  430

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
             AEDRT QFM+V++ EL+     K+ FI++FSEEDY  IV GW  KL R  +G+QRWGL
Sbjct  431  RAEDRTAQFMQVIQTELERAAAMKDEFIKEFSEEDYLAIVNGWSDKLKRCKTGDQRWGL  489



>gb|ELT87122.1| hypothetical protein CAPTEDRAFT_189076 [Capitella teleta]
Length=501

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 134/187 (72%), Gaps = 7/187 (4%)
 Frame = -2

Query  676  SHVIGIDLSTNMITIALERA-------IGLKCAVEFEVADCTKKTYPDATFDVIYSRDTI  518
            + VIGIDLS+NMI IA+ERA       +  +C V+FEVAD TK+ YP+ +FDV+YSRDTI
Sbjct  309  AEVIGIDLSSNMIGIAMERANEIGDKRVSQECHVQFEVADATKRDYPENSFDVVYSRDTI  368

Query  517  LHIQDKPALFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQML  338
            LHI+DK +LF SF+KWLKPGG++LI+DYC      S  F +Y+ QRGY L   ++YG++L
Sbjct  369  LHIKDKKSLFASFFKWLKPGGRLLISDYCCSDEEQSPAFTSYVAQRGYILLSPKQYGKVL  428

Query  337  RDAGFEDVIAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSS  158
               GF  V+AEDRT+QF+ VLK EL   E  K+ F+++FS+ DY+ IV GW  KL R   
Sbjct  429  EGVGFVKVLAEDRTNQFVNVLKNELTKFEPMKDEFVKEFSQADYDAIVTGWNDKLYRCGL  488

Query  157  GEQRWGL  137
            G+QRWGL
Sbjct  489  GDQRWGL  495



>ref|XP_008418601.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Poecilia reticulata]
Length=491

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA   K  +V+FEVAD TK+ +P+ +FDVIYSRDTILHI DK A
Sbjct  307  VLGLDLSDNMVDIAIERARAEKLPSVQFEVADATKRMFPEGSFDVIYSRDTILHIDDKLA  366

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF +V
Sbjct  367  LFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSEYGKFVQEAGFCNV  426

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
              EDRT QF++V++ EL   E  K+ FIQ+FSEEDY  IV GW+ KL R+ SG+QRWGL
Sbjct  427  RVEDRTAQFIEVIQTELQRAEDIKDEFIQEFSEEDYLAIVNGWREKLDRSKSGDQRWGL  485



>ref|XP_008418600.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Poecilia reticulata]
Length=492

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 135/179 (75%), Gaps = 1/179 (1%)
 Frame = -2

Query  670  VIGIDLSTNMITIALERAIGLKC-AVEFEVADCTKKTYPDATFDVIYSRDTILHIQDKPA  494
            V+G+DLS NM+ IA+ERA   K  +V+FEVAD TK+ +P+ +FDVIYSRDTILHI DK A
Sbjct  308  VLGLDLSDNMVDIAIERARAEKLPSVQFEVADATKRMFPEGSFDVIYSRDTILHIDDKLA  367

Query  493  LFRSFYKWLKPGGKVLITDYCKRSGPPSEEFAAYIKQRGYDLHDTEEYGQMLRDAGFEDV  314
            LF+ F+ WLKPGG++LI+DYC    P +  F AY+KQRGY L+   EYG+ +++AGF +V
Sbjct  368  LFKRFHSWLKPGGQLLISDYCCGEKPWTPVFEAYVKQRGYILYTPSEYGKFVQEAGFCNV  427

Query  313  IAEDRTDQFMKVLKKELDAVEKEKEAFIQDFSEEDYNDIVGGWKLKLTRTSSGEQRWGL  137
              EDRT QF++V++ EL   E  K+ FIQ+FSEEDY  IV GW+ KL R+ SG+QRWGL
Sbjct  428  RVEDRTAQFIEVIQTELQRAEDIKDEFIQEFSEEDYLAIVNGWREKLDRSKSGDQRWGL  486



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880