BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF020C10

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234574.1|  succinyl-CoA ligase [ADP-forming] subunit al...    224   6e-68   Solanum lycopersicum
gb|AFL48180.1|  succinyl-CoA synthetase                                 224   6e-68   Capsicum annuum
gb|ABB29950.1|  succinyl-CoA ligase alpha 1 subunit-like                221   1e-67   Solanum tuberosum [potatoes]
gb|AIS71903.1|  mitochondrial succinyl-CoA ligase ADP-forming sub...    223   2e-67   Nicotiana tabacum [American tobacco]
ref|XP_006350379.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    222   5e-67   Solanum tuberosum [potatoes]
ref|XP_006348504.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    221   6e-67   Solanum tuberosum [potatoes]
ref|NP_001234277.1|  succinyl-CoA ligase [ADP-forming] subunit al...    221   7e-67   
ref|XP_009623368.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    221   9e-67   Nicotiana tomentosiformis
ref|XP_009781531.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    221   1e-66   Nicotiana sylvestris
ref|XP_009355925.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    218   2e-65   Pyrus x bretschneideri [bai li]
gb|EYU45725.1|  hypothetical protein MIMGU_mgv1a012075mg                215   3e-65   Erythranthe guttata [common monkey flower]
ref|XP_004161847.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    212   5e-65   
ref|XP_009606229.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    211   8e-65   Nicotiana tomentosiformis
ref|XP_004299462.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    216   8e-65   Fragaria vesca subsp. vesca
gb|ABK95068.1|  unknown                                                 215   1e-64   Populus trichocarpa [western balsam poplar]
emb|CDP14400.1|  unnamed protein product                                215   2e-64   Coffea canephora [robusta coffee]
ref|XP_008467310.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    215   3e-64   Cucumis melo [Oriental melon]
gb|ABK94372.1|  unknown                                                 214   4e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011022031.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    214   6e-64   Populus euphratica
ref|XP_002307162.2|  hypothetical protein POPTR_0005s09370g             214   7e-64   
ref|XP_004137529.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    213   2e-63   Cucumis sativus [cucumbers]
ref|XP_006658733.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    210   6e-63   Oryza brachyantha
ref|XP_010923343.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    211   7e-63   Elaeis guineensis
sp|Q6ZL94.1|SUCA_ORYSJ  RecName: Full=Probable succinyl-CoA ligas...    211   7e-63   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK03449.1|  predicted protein                                      211   8e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008796686.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    211   9e-63   Phoenix dactylifera
dbj|BAJ94034.1|  predicted protein                                      211   9e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002872045.1|  hypothetical protein ARALYDRAFT_489184             211   1e-62   
ref|XP_006399319.1|  hypothetical protein EUTSA_v10013993mg             211   1e-62   Eutrema salsugineum [saltwater cress]
ref|XP_002318347.2|  hypothetical protein POPTR_0012s033101g            206   1e-62   
gb|ACN28789.1|  unknown                                                 208   2e-62   Zea mays [maize]
gb|EPS68438.1|  hypothetical protein M569_06331                         210   2e-62   Genlisea aurea
ref|XP_004958125.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    210   2e-62   Setaria italica
ref|XP_008788992.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    210   3e-62   Phoenix dactylifera
ref|XP_009413310.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    209   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009125723.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    209   3e-62   Brassica rapa
ref|XP_003562832.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    209   4e-62   Brachypodium distachyon [annual false brome]
ref|XP_002460917.1|  hypothetical protein SORBIDRAFT_02g037420          209   5e-62   Sorghum bicolor [broomcorn]
emb|CDY44764.1|  BnaC02g01230D                                          209   5e-62   Brassica napus [oilseed rape]
ref|XP_001762925.1|  predicted protein                                  209   5e-62   
gb|ACG31861.1|  succinyl-CoA ligase alpha-chain 2                       208   5e-62   Zea mays [maize]
ref|XP_006847834.1|  hypothetical protein AMTR_s00029p00055000          208   6e-62   
ref|XP_010934473.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    209   6e-62   Elaeis guineensis
ref|XP_007152547.1|  hypothetical protein PHAVU_004G139300g             208   6e-62   Phaseolus vulgaris [French bean]
gb|KDP45810.1|  hypothetical protein JCGZ_17417                         209   6e-62   Jatropha curcas
emb|CDX81092.1|  BnaC03g03460D                                          209   6e-62   
ref|NP_001149702.1|  succinyl-CoA ligase alpha-chain 2                  208   7e-62   Zea mays [maize]
ref|XP_009131054.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    209   7e-62   Brassica rapa
ref|NP_001136494.1|  succinyl-CoA ligase alpha-chain 2                  208   1e-61   Zea mays [maize]
gb|EEC82322.1|  hypothetical protein OsI_26601                          211   1e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_002514509.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    207   1e-61   Ricinus communis
emb|CDY21531.1|  BnaC09g47610D                                          208   1e-61   Brassica napus [oilseed rape]
ref|XP_002514510.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    207   2e-61   Ricinus communis
ref|XP_001765853.1|  predicted protein                                  207   2e-61   
ref|XP_008375061.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   2e-61   Malus domestica [apple tree]
gb|EMS53891.1|  putative succinyl-CoA ligase [ADP-forming] subuni...    209   2e-61   Triticum urartu
emb|CDY61908.1|  BnaC07g49680D                                          207   3e-61   Brassica napus [oilseed rape]
ref|XP_003548295.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    207   3e-61   Glycine max [soybeans]
ref|NP_197716.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha-2     207   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423114.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010491456.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010452813.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   3e-61   Camelina sativa [gold-of-pleasure]
ref|NP_196447.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha-1     207   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008240339.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    206   4e-61   Prunus mume [ume]
ref|XP_011047755.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    207   4e-61   Populus euphratica
emb|CDX78333.1|  BnaA03g02450D                                          207   4e-61   
ref|XP_010241497.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    207   5e-61   Nelumbo nucifera [Indian lotus]
ref|XP_007209332.1|  hypothetical protein PRUPE_ppa008341mg             206   5e-61   Prunus persica
ref|XP_006288079.1|  hypothetical protein CARUB_v10001317mg             207   5e-61   Capsella rubella
ref|XP_002871316.1|  hypothetical protein ARALYDRAFT_487662             207   6e-61   
gb|KHN24503.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    207   6e-61   Glycine soja [wild soybean]
emb|CDX69957.1|  BnaA10g23060D                                          206   6e-61   
emb|CDY02216.1|  BnaA03g39510D                                          206   6e-61   
ref|XP_009136375.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    206   6e-61   Brassica rapa
ref|XP_011091459.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    206   7e-61   Sesamum indicum [beniseed]
gb|KDP45811.1|  hypothetical protein JCGZ_17418                         206   7e-61   Jatropha curcas
emb|CAA48891.1|  succinate--CoA ligase (GDP-forming)                    206   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KJB79846.1|  hypothetical protein B456_013G069200                    205   1e-60   Gossypium raimondii
ref|XP_002268479.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    205   1e-60   Vitis vinifera
emb|CBI35274.3|  unnamed protein product                                205   1e-60   Vitis vinifera
ref|XP_004515280.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    205   1e-60   Cicer arietinum [garbanzo]
gb|EYU19899.1|  hypothetical protein MIMGU_mgv1a009825mg                205   2e-60   Erythranthe guttata [common monkey flower]
ref|XP_006493424.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    205   2e-60   Citrus sinensis [apfelsine]
gb|AAM65450.1|  succinyl-CoA synthetase, alpha subunit                  205   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KHG06820.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-2...    204   2e-60   Gossypium arboreum [tree cotton]
ref|XP_008393504.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    204   2e-60   Malus domestica [apple tree]
ref|XP_006441425.1|  hypothetical protein CICLE_v10020931mg             205   2e-60   Citrus clementina [clementine]
gb|AGT16123.1|  succinyl-CoA ligase                                     208   3e-60   Saccharum hybrid cultivar R570
ref|XP_006484523.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    204   3e-60   Citrus sinensis [apfelsine]
ref|XP_010547709.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    204   5e-60   Tarenaya hassleriana [spider flower]
ref|XP_006394592.1|  hypothetical protein EUTSA_v10004347mg             206   6e-60   
ref|NP_001241205.1|  uncharacterized protein LOC100782001               203   6e-60   Glycine max [soybeans]
gb|KHN23614.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    203   8e-60   Glycine soja [wild soybean]
ref|XP_010546242.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    203   1e-59   Tarenaya hassleriana [spider flower]
gb|KJB31853.1|  hypothetical protein B456_005G211200                    203   1e-59   Gossypium raimondii
gb|KHG04322.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    203   1e-59   Gossypium arboreum [tree cotton]
ref|XP_002271746.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    202   2e-59   Vitis vinifera
ref|XP_006437603.1|  hypothetical protein CICLE_v10032075mg             201   4e-59   Citrus clementina [clementine]
ref|XP_003620150.1|  Succinyl-CoA ligase                                201   6e-59   Medicago truncatula
ref|XP_009122444.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    201   7e-59   Brassica rapa
gb|KFK27646.1|  hypothetical protein AALP_AA8G410300                    201   7e-59   Arabis alpina [alpine rockcress]
ref|XP_011003681.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    202   8e-59   Populus euphratica
ref|XP_010031908.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    199   2e-58   Eucalyptus grandis [rose gum]
ref|XP_007043270.1|  Succinyl-CoA ligase, alpha subunit                 199   3e-58   
ref|XP_010454606.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    199   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010493442.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    199   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010421123.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    199   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006288023.1|  hypothetical protein CARUB_v10001256mg             199   9e-58   
ref|XP_010069514.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    198   1e-57   Eucalyptus grandis [rose gum]
ref|XP_006376608.1|  hypothetical protein POPTR_0012s00920g             196   2e-57   
ref|XP_010688675.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    196   6e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009389047.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    194   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT17065.1|  Putative succinyl-CoA ligase (GDP-forming) subuni...    194   4e-56   
ref|XP_001780609.1|  predicted protein                                  182   3e-52   
ref|XP_001693108.1|  succinyl-coa ligase alpha chain                    183   4e-52   Chlamydomonas reinhardtii
gb|KFH07184.1|  succinyl-CoA-synthetase alpha SCSA                      175   3e-51   Toxoplasma gondii MAS
ref|XP_011398589.1|  Succinyl-CoA ligase [ADP-forming] subunit al...    181   3e-51   Auxenochlorella protothecoides
gb|KDD74604.1|  hypothetical protein H632_c1190p0                       180   6e-51   Helicosporidium sp. ATCC 50920
ref|XP_002957241.1|  succinate-coa ligase alpha chain, succinyl-C...    180   7e-51   Volvox carteri f. nagariensis
ref|XP_003078495.1|  putative succinyl-CoA ligase alpha subunit (...    179   2e-50   Ostreococcus tauri
ref|XP_005643816.1|  succinyl-CoA ligase alpha chain                    177   3e-50   Coccomyxa subellipsoidea C-169
ref|XP_005843440.1|  hypothetical protein CHLNCDRAFT_141133             178   4e-50   Chlorella variabilis
ref|XP_001416813.1|  predicted protein                                  178   6e-50   Ostreococcus lucimarinus CCE9901
ref|XP_008889195.1|  succinyl-CoA-synthetase alpha SCSA                 174   2e-48   
ref|XP_002368454.1|  succinyl-CoA ligase alpha subunit, putative        174   2e-48   Toxoplasma gondii ME49
ref|XP_003881225.1|  2-oxoglutarate dehydrogenase E1 component,re...    174   3e-48   Neospora caninum Liverpool
ref|XP_002610474.1|  hypothetical protein BRAFLDRAFT_124275             171   1e-47   Branchiostoma floridae
emb|CBJ28950.1|  Succinate--CoA ligase (GDP-forming), alpha subunit     171   1e-47   Ectocarpus siliculosus
gb|ABE76513.1|  mitochondrial putative GDP-forming succinate-CoA ...    171   2e-47   Toxoplasma gondii
ref|WP_038538362.1|  MULTISPECIES: succinate--CoA ligase                169   3e-47   Candidatus Jidaibacter acanthamoeba
dbj|GAM28077.1|  hypothetical protein SAMD00019534_112530               168   2e-46   Acytostelium subglobosum LB1
gb|EFA80958.1|  Endo-beta-N-acetylglucosaminidase                       177   2e-46   Heterostelium album PN500
ref|XP_004351803.1|  succinate-CoA ligase                               167   3e-46   Cavenderia fasciculata
ref|WP_014363954.1|  succinyl-CoA synthetase subsunit alpha             167   3e-46   Rickettsia canadensis
ref|WP_028099766.1|  succinate--CoA ligase                              167   3e-46   Dongia sp. URHE0060
ref|WP_040257675.1|  MULTISPECIES: succinate--CoA ligase                166   6e-46   spotted fever group
emb|CCQ75435.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha        166   7e-46   Magnetospira sp. QH-2
ref|WP_014014291.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    166   8e-46   spotted fever group
ref|XP_001425910.1|  hypothetical protein                               166   1e-45   Paramecium tetraurelia strain d4-2
ref|WP_017443052.1|  succinyl-CoA synthetase subsunit alpha             165   2e-45   Rickettsia gravesii
ref|XP_005837665.1|  hypothetical protein GUITHDRAFT_157241             165   2e-45   Guillardia theta CCMP2712
ref|WP_014392217.1|  succinyl-CoA synthetase subsunit alpha             165   2e-45   Rickettsia amblyommatis
ref|WP_012152767.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    165   2e-45   spotted fever group
ref|WP_032138585.1|  succinate--CoA ligase                              164   2e-45   Rickettsia tamurae
ref|WP_008579810.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    164   2e-45   Rickettsia
ref|WP_012148768.1|  succinyl-CoA synthetase subsunit alpha             164   2e-45   Rickettsia canadensis
ref|WP_039594975.1|  succinate--CoA ligase                              164   3e-45   Rickettsia felis
ref|WP_011270994.1|  succinyl-CoA synthetase subsunit alpha             164   3e-45   Rickettsia felis
ref|XP_008871215.1|  succinyl-CoA ligase [GDP-forming] subunit al...    165   3e-45   Aphanomyces invadans
ref|WP_014409142.1|  succinyl-CoA synthetase subsunit alpha             164   3e-45   Rickettsia montanensis
gb|ACC73801.1|  succinyl-CoA synthetase, alpha subunit                  163   5e-45   Paraburkholderia phymatum STM815
ref|WP_012151579.1|  succinyl-CoA synthetase subsunit alpha             163   5e-45   Rickettsia bellii
ref|WP_012149562.1|  succinyl-CoA synthetase subsunit alpha             163   6e-45   Rickettsia akari [rickettsialpox]
gb|ELU05339.1|  hypothetical protein CAPTEDRAFT_170724                  164   6e-45   Capitella teleta
ref|WP_008519360.1|  succinyl-CoA synthetase subsunit alpha             163   7e-45   alpha proteobacterium IMCC14465
ref|WP_021777427.1|  3-oxoacyl-Acyl-carrier protein reductase           163   8e-45   Candidatus Micropelagos thuwalensis
ref|WP_012110353.1|  succinyl-CoA synthetase subsunit alpha             163   8e-45   Parvibaculum lavamentivorans
ref|WP_011477883.1|  succinyl-CoA synthetase subsunit alpha             163   8e-45   Rickettsia bellii
ref|XP_001452638.1|  hypothetical protein                               163   9e-45   Paramecium tetraurelia strain d4-2
ref|XP_786544.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-forming...    164   9e-45   Strongylocentrotus purpuratus [purple urchin]
ref|WP_027287415.1|  succinate--CoA ligase                              162   1e-44   Rhodovibrio salinarum
ref|XP_002160938.2|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    164   1e-44   
ref|XP_001442597.1|  hypothetical protein                               164   1e-44   Paramecium tetraurelia strain d4-2
ref|WP_010423152.1|  succinyl-CoA synthetase subsunit alpha             162   1e-44   Rickettsia helvetica
gb|ABW76150.1|  succinyl-CoA synthetase alpha subunit                   163   2e-44   Blastocystis sp. ATCC 50177/Nand II
ref|WP_043950111.1|  succinate--CoA ligase                              162   2e-44   Candidatus Phaeomarinobacter ectocarpi
gb|KHJ84287.1|  succinate-CoA ligase, alpha subunit                     159   2e-44   Oesophagostomum dentatum [nodule worm]
ref|XP_008608930.1|  succinyl-CoA ligase [GDP-forming] subunit al...    162   2e-44   Saprolegnia diclina VS20
gb|KDO21510.1|  succinyl-CoA ligase subunit alpha                       162   2e-44   Saprolegnia parasitica CBS 223.65
ref|WP_013181525.1|  succinyl-CoA synthetase subunit alpha              162   3e-44   Waddlia chondrophila
ref|XP_001007751.3|  succinyl-CoA synthetase, alpha subunit famil...    162   3e-44   Tetrahymena thermophila SB210
ref|XP_003106288.1|  hypothetical protein CRE_15309                     162   3e-44   Caenorhabditis remanei
ref|WP_017972286.1|  succinyl-CoA synthetase subsunit alpha             161   4e-44   
emb|CAP27541.2|  Protein CBR-SUCL-1                                     162   5e-44   Caenorhabditis briggsae
ref|XP_009524111.1|  hypothetical protein PHYSODRAFT_557468             162   5e-44   Phytophthora sojae
ref|WP_016916757.1|  succinyl-CoA synthetase subsunit alpha             161   5e-44   Rickettsia honei
ref|NP_510450.1|  Protein SUCL-1                                        161   6e-44   Caenorhabditis elegans [roundworm]
ref|XP_636263.1|  succinate-CoA ligase                                  161   6e-44   Dictyostelium discoideum AX4
ref|XP_002645849.1|  Hypothetical protein CBG07585                      162   6e-44   Caenorhabditis briggsae
ref|XP_008905429.1|  succinyl-CoA ligase [GDP-forming] subunit al...    161   7e-44   Phytophthora parasitica INRA-310
gb|ETP44985.1|  succinyl-CoA ligase [GDP-forming] subunit alpha, ...    161   7e-44   Phytophthora parasitica P10297
ref|XP_006675876.1|  hypothetical protein BATDEDRAFT_36456              162   8e-44   Batrachochytrium dendrobatidis JAM81
ref|WP_029167294.1|  succinate--CoA ligase                              160   1e-43   
ref|WP_017943586.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    160   1e-43   
ref|WP_017970841.1|  succinyl-CoA synthetase subsunit alpha             160   1e-43   
ref|XP_002908607.1|  succinyl-CoA ligase subunit alpha, mitochond...    161   1e-43   Phytophthora infestans T30-4
gb|AEV92218.1|  Succinyl-CoA synthetase alpha chain                     159   1e-43   Rickettsia slovaca 13-B
gb|AAA85724.1|  succinyl coenzyme A synthetase alpha subunit            160   2e-43   Dictyostelium discoideum AX2
gb|EGT40414.1|  hypothetical protein CAEBREN_13872                      160   2e-43   Caenorhabditis brenneri
ref|WP_025896902.1|  succinate--CoA ligase                              159   2e-43   Sneathiella glossodoripedis
ref|WP_029374459.1|  succinate--CoA ligase                              158   2e-43   
ref|WP_014746522.1|  succinyl-CoA synthetase subsunit alpha             159   2e-43   Tistrella mobilis
ref|XP_004029838.1|  succinyl-CoA synthetase, alpha subunit, puta...    160   2e-43   Ichthyophthirius multifiliis
ref|WP_027300105.1|  succinate--CoA ligase                              159   2e-43   Rhodospirillales bacterium URHD0088
ref|WP_014410679.1|  succinyl-CoA synthetase subsunit alpha             159   2e-43   Rickettsia parkeri
ref|XP_009831202.1|  succinyl-CoA ligase [GDP-forming] subunit al...    160   2e-43   Aphanomyces astaci
ref|WP_014412789.1|  succinyl-CoA synthetase subsunit alpha             159   2e-43   Rickettsia australis
ref|XP_003294260.1|  succinyl coenzyme A synthetase alpha subunit       159   2e-43   Dictyostelium purpureum
ref|WP_014364693.1|  succinyl-CoA synthetase subsunit alpha             159   3e-43   Rickettsia philipii
ref|WP_014419805.1|  succinyl-CoA synthetase subsunit alpha             159   3e-43   Rickettsia slovaca
ref|WP_004995747.1|  succinyl-CoA synthetase subsunit alpha             159   3e-43   Rickettsia sibirica
ref|WP_023507834.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha    158   3e-43   
ref|WP_016770141.1|  succinyl-CoA synthetase subsunit alpha             159   3e-43   Rickettsia sibirica
ref|WP_016926237.1|  succinyl-CoA synthetase subsunit alpha             159   3e-43   Rickettsia conorii
ref|WP_011190880.1|  succinyl-CoA synthetase subsunit alpha             159   4e-43   Rickettsia typhi
emb|CDJ51788.1|  succinyl-CoA ligase alpha subunit, putative            157   4e-43   Eimeria brunetti
ref|XP_002507022.1|  succinate-coa ligase                               159   4e-43   Micromonas commoda
ref|WP_015508452.1|  Succinyl-CoA ligase [ADP-forming] subunit al...    157   5e-43   
ref|WP_010977229.1|  succinyl-CoA synthetase subsunit alpha             158   5e-43   Rickettsia conorii
ref|WP_012736402.1|  succinyl-CoA synthetase subsunit alpha             158   5e-43   Rickettsia peacockii
ref|WP_012150789.1|  succinyl-CoA synthetase subsunit alpha             158   5e-43   Rickettsia rickettsii
ref|WP_028879580.1|  succinate--CoA ligase                              158   6e-43   Terasakiella pusilla
ref|WP_014952624.1|  succinyl-CoA synthetase subsunit alpha             158   6e-43   alpha proteobacterium HIMB5
gb|ETN68207.1|  CoA-ligase                                              154   6e-43   Necator americanus
gb|KHN81599.1|  putative succinyl-CoA ligase [ADP/GDP-forming] su...    160   7e-43   Toxocara canis
emb|CEO17419.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha        158   7e-43   Rickettsia monacensis
emb|CCW71008.1|  unnamed protein product                                158   7e-43   Phytomonas sp. isolate Hart1
ref|XP_005717393.1|  succinyl-CoA synthetase alpha chain                158   7e-43   Chondrus crispus [carageen]
ref|WP_029016458.1|  succinate--CoA ligase                              158   7e-43   
ref|WP_029167879.1|  succinate--CoA ligase                              158   7e-43   
ref|WP_026071683.1|  succinate--CoA ligase                              158   8e-43   Occidentia massiliensis
gb|ACO12801.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    159   8e-43   Lepeophtheirus salmonis
ref|XP_009038265.1|  hypothetical protein AURANDRAFT_28269              158   9e-43   Aureococcus anophagefferens
ref|WP_004597642.1|  succinyl-CoA synthetase subsunit alpha             157   1e-42   Rickettsia prowazekii
ref|XP_002772148.1|  Succinyl-CoA ligase, putative                      158   1e-42   Perkinsus marinus ATCC 50983
ref|WP_027839641.1|  succinate--CoA ligase                              157   1e-42   
ref|XP_002779820.1|  Succinyl-CoA ligase, putative                      158   2e-42   Perkinsus marinus ATCC 50983
gb|EWM26381.1|  succinyl- ligase subunit mitochondrial precursor        158   2e-42   Nannochloropsis gaditana
ref|WP_022735557.1|  succinyl-CoA synthetase subsunit alpha             157   2e-42   
ref|XP_004831195.1|  succinyl-CoA ligase, putative                      158   2e-42   Theileria equi strain WA
ref|WP_012719686.1|  succinyl-CoA synthetase subsunit alpha             157   2e-42   Rickettsia africae
ref|WP_020401362.1|  succinyl-CoA synthetase subsunit alpha             156   3e-42   Kordiimonas gwangyangensis
ref|XP_002781462.1|  Succinyl-CoA ligase, putative                      157   4e-42   Perkinsus marinus ATCC 50983
ref|WP_026871163.1|  hypothetical protein                               152   5e-42   
gb|ADI19715.1|  hypothetical protein                                    155   5e-42   uncultured bacterium EB000_36F02
emb|CCG84081.1|  protein of unknown function                            156   5e-42   Taphrina deformans PYCC 5710
ref|XP_002117441.1|  hypothetical protein TRIADDRAFT_61514              157   5e-42   Trichoplax adhaerens
gb|EJW73256.1|  succinyl-CoA ligase subunit alpha                       152   5e-42   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|AEI89159.1|  succinyl-CoA synthetase, alpha subunit                  155   5e-42   Candidatus Midichloria mitochondrii IricVA
ref|WP_042311149.1|  succinate--CoA ligase                              155   6e-42   Burkholderiaceae
ref|WP_014415904.1|  succinyl-CoA synthetase subsunit alpha             155   7e-42   Pararhodospirillum photometricum
gb|EKE09873.1|  hypothetical protein ACD_16C00100G0035                  155   7e-42   uncultured bacterium
ref|WP_011388967.1|  succinyl-CoA synthetase subsunit alpha             155   7e-42   Rhodospirillum rubrum
emb|CDZ80070.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha        155   7e-42   Candidatus Rubidus massiliensis
emb|CCI47060.1|  unnamed protein product                                155   9e-42   Albugo candida
ref|WP_018051680.1|  succinyl-CoA synthetase subsunit alpha             155   1e-41   
gb|AEE62179.1|  unknown                                                 155   1e-41   Dendroctonus ponderosae
ref|XP_003383961.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    156   1e-41   Amphimedon queenslandica
ref|WP_026872999.1|  hypothetical protein                               150   1e-41   
ref|WP_041185489.1|  succinate--CoA ligase                              155   1e-41   Candidatus Midichloria mitochondrii
ref|WP_023854650.1|  succinyl-CoA synthetase (ADP-forming) alpha ...    155   1e-41   Candidatus Pelagibacter ubique
dbj|GAA49470.1|  succinyl-CoA synthetase alpha subunit                  156   1e-41   Clonorchis sinensis [oriental liver fluke]
ref|XP_009162469.1|  hypothetical protein T265_00432                    155   1e-41   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|WP_009540580.1|  Succinyl-CoA ligase [ADP-forming] alpha chain      154   1e-41   Caenispirillum salinarum
emb|CDJ80198.1|  CoA-binding and ATP-citrate lyase succinyl-CoA l...    155   1e-41   Haemonchus contortus [red stomach worm]
gb|ETN77515.1|  succinate-CoA ligase, alpha subunit                     155   1e-41   Necator americanus
gb|ENN72632.1|  hypothetical protein YQE_10730                          155   1e-41   Dendroctonus ponderosae
gb|KFM62410.1|  Succinyl-CoA ligase subunit alpha, mitochondrial        155   1e-41   Stegodyphus mimosarum
emb|CDH52273.1|  succinyl-ligase subunit mitochondrialprecursor         155   2e-41   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_004352450.1|  succinyl coenzyme A synthetase alpha subunit       154   2e-41   Acanthamoeba castellanii str. Neff
emb|CCI47059.1|  unnamed protein product                                155   2e-41   Albugo candida
emb|CDS05386.1|  Putative Succinyl-CoA ligase                           155   2e-41   Lichtheimia ramosa
gb|KDR08649.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    155   2e-41   Zootermopsis nevadensis
ref|WP_028035995.1|  succinate--CoA ligase                              154   2e-41   Candidatus Pelagibacter ubique
emb|CDH53782.1|  probable succinyl-coa synthetase alpha gdp-forming     155   2e-41   Lichtheimia corymbifera JMRC:FSU:9682
ref|NP_001002577.2|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    155   2e-41   Danio rerio [leopard danio]
ref|WP_008336471.1|  succinyl-CoA synthetase subsunit alpha             154   2e-41   Alicyclobacillus acidocaldarius
gb|EFX76555.1|  hypothetical protein DAPPUDRAFT_306118                  155   2e-41   Daphnia pulex
emb|CDS02808.1|  Putative Succinyl-CoA ligase                           155   2e-41   Lichtheimia ramosa
gb|ABN12047.1|  putative succinate-CoA ligase, GDP-forming, alpha...    154   3e-41   Maconellicoccus hirsutus [pink hibiscus mealybug]
ref|WP_019645135.1|  succinyl-CoA synthetase subsunit alpha             154   3e-41   Novispirillum itersonii
ref|WP_028466118.1|  succinate--CoA ligase                              154   3e-41   Nisaea denitrificans
emb|CAX74373.1|  succinate-CoA ligase                                   154   3e-41   Schistosoma japonicum
gb|AAX27280.2|  SJCHGC04909 protein                                     154   4e-41   Schistosoma japonicum
ref|WP_004599470.1|  succinyl-CoA synthetase subsunit alpha             153   4e-41   Rickettsia prowazekii
gb|ACO14866.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    154   4e-41   Caligus clemensi
ref|WP_029011387.1|  succinate--CoA ligase                              153   5e-41   Azospirillum halopraeferens
emb|CBK25395.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               154   5e-41   Blastocystis hominis
emb|CBK23557.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               154   5e-41   Blastocystis hominis
ref|XP_008022993.1|  hypothetical protein SETTUDRAFT_167715             154   5e-41   
ref|WP_008621975.1|  succinyl-CoA synthetase subunit alpha              153   5e-41   
gb|ERL86130.1|  hypothetical protein D910_03544                         150   5e-41   
ref|WP_011386313.1|  succinyl-CoA synthetase subsunit alpha             153   5e-41   
ref|WP_009868831.1|  COG0074: Succinyl-CoA synthetase, alpha subunit    153   6e-41   
ref|WP_002730338.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    153   6e-41   
ref|XP_011142324.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    154   6e-41   
emb|CCD79067.1|  succinyl-CoA synthetase-related                        154   6e-41   
ref|WP_025280631.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    153   6e-41   
emb|CBK19683.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               154   6e-41   
ref|WP_028582882.1|  succinyl-CoA synthetase subsunit alpha             152   6e-41   
ref|XP_002683450.1|  succinyl-CoA synthetase alpha subunit              154   7e-41   
ref|WP_038035751.1|  hypothetical protein                               152   7e-41   
ref|WP_014464126.1|  succinyl-CoA synthetase subsunit alpha             153   7e-41   
gb|EMD92563.1|  hypothetical protein COCHEDRAFT_1174674                 154   8e-41   
gb|KGB32013.1|  Succinyl-CoA ligase [ADP/GDP-forming] subunit alp...    154   9e-41   
ref|XP_003142812.1|  succinate-CoA ligase                               151   9e-41   
ref|WP_014246680.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    152   9e-41   
ref|WP_019896185.1|  succinyl-CoA synthetase subunit alpha              152   1e-40   
ref|XP_002289446.1|  precursor of synthetase                            152   1e-40   
ref|WP_029453878.1|  succinate--CoA ligase                              152   1e-40   
ref|WP_012975136.1|  succinyl-CoA synthetase subsunit alpha             152   1e-40   
ref|WP_007089205.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    152   1e-40   
ref|XP_001931590.1|  succinyl-CoA ligase subunit alpha                  153   1e-40   
ref|XP_011501014.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    153   1e-40   
ref|WP_023647879.1|  succinyl-CoA synthetase subsunit alpha             152   1e-40   
ref|WP_038603019.1|  succinate--CoA ligase                              152   1e-40   
ref|WP_014703068.1|  succinyl-CoA synthetase subunit alpha              152   1e-40   
ref|XP_003298377.1|  hypothetical protein PTT_09097                     153   1e-40   
emb|CDJ29687.1|  succinyl-CoA ligase alpha subunit, putative            153   1e-40   
ref|WP_014241630.1|  succinyl-CoA synthetase subsunit alpha             152   1e-40   
ref|WP_017932594.1|  succinyl-CoA synthetase subsunit alpha             152   1e-40   
ref|WP_008544437.1|  succinyl-CoA synthetase subsunit alpha             152   1e-40   
ref|WP_026942183.1|  succinate--CoA ligase                              152   1e-40   
ref|WP_034838657.1|  succinate--CoA ligase                              151   1e-40   
ref|WP_028368926.1|  succinate--CoA ligase                              152   1e-40   
ref|XP_007696583.1|  hypothetical protein COCSADRAFT_34282              153   1e-40   
ref|WP_029133306.1|  succinyl-CoA synthetase subunit alpha              152   1e-40   
gb|KFD51556.1|  hypothetical protein M513_07606                         153   1e-40   
ref|XP_007693124.1|  hypothetical protein COCMIDRAFT_109035             153   2e-40   
ref|WP_029455925.1|  succinate--CoA ligase                              152   2e-40   
ref|XP_003844248.1|  similar to succinyl-coa ligase subunit alpha       152   2e-40   
ref|WP_019450887.1|  succinyl-CoA synthetase subsunit alpha             152   2e-40   
ref|WP_012810730.1|  succinyl-CoA synthetase subsunit alpha             152   2e-40   
emb|CEG68719.1|  Putative Succinyl-CoA ligase [GDP-forming] subun...    152   2e-40   
ref|WP_025293182.1|  succinate--CoA ligase                              151   2e-40   
ref|WP_006986959.1|  succinyl-CoA synthetase subunit alpha              151   2e-40   
ref|WP_042087115.1|  succinate--CoA ligase                              151   2e-40   
ref|WP_012520721.1|  succinyl-CoA synthetase subsunit alpha             151   2e-40   
ref|WP_034846091.1|  succinate--CoA ligase                              150   2e-40   
ref|WP_008383363.1|  succinyl-CoA synthetase subsunit alpha             151   2e-40   
gb|EUB56696.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha         152   2e-40   
ref|WP_038528120.1|  succinate--CoA ligase                              151   2e-40   
ref|WP_012227174.1|  succinyl-CoA synthetase subsunit alpha             151   3e-40   
ref|XP_006557408.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    152   3e-40   
ref|WP_024081748.1|  succinyl-CoA synthetase, alpha subunit, NAD(...    151   3e-40   
emb|CEI88671.1|  Putative Succinyl-CoA ligase [GDP-forming] subun...    152   3e-40   
ref|XP_966490.1|  PREDICTED: succinyl-CoA ligase subunit alpha, m...    152   3e-40   
ref|WP_036001007.1|  succinate--CoA ligase                              151   3e-40   
ref|WP_006997672.1|  succinyl-CoA synthetase subsunit alpha             151   3e-40   
ref|WP_037499726.1|  succinate--CoA ligase                              151   4e-40   
ref|XP_001805534.1|  hypothetical protein SNOG_15384                    152   4e-40   
ref|WP_007560100.1|  succinyl-CoA synthetase subsunit alpha             151   4e-40   
ref|WP_011281561.1|  succinyl-CoA synthetase subsunit alpha             150   4e-40   
ref|WP_010301571.1|  succinyl-CoA synthetase subsunit alpha             151   4e-40   
ref|WP_022731741.1|  succinyl-CoA synthetase subsunit alpha             150   4e-40   
gb|EJD74626.1|  succinyl-CoA ligase alpha-chain                         151   4e-40   
ref|XP_007512066.1|  predicted protein                                  153   4e-40   
ref|WP_012774714.1|  succinyl-CoA synthetase subsunit alpha             150   5e-40   
ref|WP_018413618.1|  succinyl-CoA synthetase subsunit alpha             150   5e-40   
ref|XP_001565674.1|  putative succinyl-CoA synthetase alpha subunit     150   5e-40   
ref|WP_012531653.1|  succinyl-CoA synthetase subsunit alpha             150   5e-40   
ref|XP_001891596.1|  succinyl-CoA ligase [GDP-forming] alpha-chai...    151   5e-40   
ref|WP_022699107.1|  succinyl-CoA synthetase subsunit alpha             150   6e-40   
ref|WP_025437909.1|  succinate--CoA ligase                              150   6e-40   
ref|WP_033068019.1|  succinate--CoA ligase                              150   6e-40   
ref|WP_007733326.1|  succinyl-CoA synthetase subsunit alpha             150   6e-40   
ref|WP_026840722.1|  succinate--CoA ligase                              150   6e-40   
ref|WP_035931250.1|  succinate--CoA ligase                              150   6e-40   
ref|WP_044827266.1|  succinate--CoA ligase                              150   6e-40   
ref|WP_008889739.1|  succinyl-CoA synthetase subsunit alpha             150   6e-40   
gb|ACO11392.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    151   6e-40   
ref|WP_035574930.1|  succinate--CoA ligase                              150   6e-40   
ref|WP_004141291.1|  succinyl-CoA synthetase subunit alpha              150   6e-40   
dbj|BAQ15578.1|  succinyl-CoA ligase [ADP-forming] alpha chain          150   7e-40   
emb|CCW64321.1|  unnamed protein product                                150   7e-40   
ref|WP_008652312.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    150   7e-40   
ref|XP_011302934.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    151   7e-40   
gb|EFN82692.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    151   7e-40   
ref|WP_035883441.1|  succinate--CoA ligase                              150   7e-40   
ref|XP_004347867.1|  succinate-CoA ligase                               150   8e-40   
emb|CCA20859.1|  unnamed protein product                                150   8e-40   
ref|WP_012098529.1|  succinyl-CoA synthetase subsunit alpha             150   8e-40   
gb|KFM71011.1|  Succinyl-CoA ligase [ADP/GDP-forming] subunit alp...    150   8e-40   
ref|WP_029309537.1|  succinate--CoA ligase                              150   9e-40   
gb|KIW09471.1|  hypothetical protein PV09_00350                         150   9e-40   
ref|XP_008558493.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    150   1e-39   
ref|XP_006623784.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    150   1e-39   
ref|WP_014188059.1|  succinyl-CoA synthetase subsunit alpha             150   1e-39   
ref|WP_025527854.1|  succinate--CoA ligase                              149   1e-39   
ref|WP_041066241.1|  succinyl-CoA synthetase subunit alpha              149   1e-39   
ref|XP_003876273.1|  putative succinyl-CoA synthetase alpha subunit     150   1e-39   
ref|WP_018953020.1|  succinyl-CoA synthetase subunit alpha              149   1e-39   
emb|CDS28334.1|  succinyl coenzyme A synthetase alpha subunit           150   1e-39   
ref|XP_003876272.1|  putative succinyl-CoA synthetase alpha subunit     150   1e-39   
ref|WP_011518841.1|  succinyl-CoA synthetase subsunit alpha             149   1e-39   
ref|WP_012637389.1|  succinyl-CoA synthetase subunit alpha              149   1e-39   
emb|CDQ00314.1|  Protein Bm13824, isoform d                             152   1e-39   
emb|CDJ86846.1|  CoA-binding and ATP-citrate lyase succinyl-CoA l...    150   1e-39   
dbj|BAN20393.1|  succinyl-CoA synthetase small subunit, putative        150   1e-39   
ref|WP_039735185.1|  succinate--CoA ligase                              149   1e-39   
gb|EYC05957.1|  hypothetical protein Y032_0079g1274                     150   1e-39   
gb|AEE63452.1|  unknown                                                 150   1e-39   
ref|XP_007675614.1|  hypothetical protein BAUCODRAFT_147215             150   1e-39   
ref|WP_004829423.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    149   1e-39   
ref|WP_017775324.1|  succinyl-CoA synthetase subsunit alpha             149   1e-39   
ref|NP_497288.1|  Protein SUCL-2                                        150   1e-39   
ref|WP_010514537.1|  succinyl-CoA synthetase subsunit alpha             149   1e-39   
ref|WP_009770390.1|  succinyl-CoA synthetase subsunit alpha             149   1e-39   
ref|WP_036137555.1|  succinyl-CoA synthetase subunit alpha              149   1e-39   
ref|WP_022792756.1|  succinyl-CoA synthetase subsunit alpha             149   1e-39   
ref|WP_038308672.1|  succinate--CoA ligase                              149   2e-39   
ref|XP_008469540.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    150   2e-39   
ref|WP_029353326.1|  succinate--CoA ligase                              149   2e-39   
gb|EYC05958.1|  hypothetical protein Y032_0079g1274                     150   2e-39   
ref|WP_006447072.1|  succinyl-CoA synthetase subsunit alpha             149   2e-39   
ref|WP_013944023.1|  succinyl-CoA synthetase subunit alpha              149   2e-39   
ref|XP_003111691.1|  hypothetical protein CRE_03008                     150   2e-39   
ref|WP_010665754.1|  succinyl-CoA synthetase subsunit alpha             149   2e-39   
ref|WP_036110573.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    149   2e-39   
ref|WP_041017693.1|  succinate--CoA ligase                              149   2e-39   
ref|WP_043241854.1|  succinate--CoA ligase                              149   2e-39   
ref|WP_027716550.1|  succinate--CoA ligase                              149   2e-39   
ref|WP_006577242.1|  succinyl-CoA synthetase, alpha subunit             149   2e-39   
ref|WP_006341717.1|  succinyl-CoA synthetase subunit alpha              149   2e-39   
ref|WP_042704211.1|  succinate--CoA ligase                              149   2e-39   
ref|XP_007336685.1|  succinate-CoA ligase                               150   2e-39   
ref|WP_012975782.1|  succinyl-CoA synthetase subsunit alpha             149   2e-39   
ref|WP_041471245.1|  succinyl-CoA synthetase subsunit alpha             149   2e-39   
ref|WP_033073970.1|  succinate--CoA ligase                              149   2e-39   
ref|XP_001611906.1|  succinyl-CoA synthetase, alpha subunit famil...    150   2e-39   
ref|WP_013925587.1|  succinyl-CoA synthetase subunit alpha              149   2e-39   
ref|WP_037446206.1|  succinate--CoA ligase                              149   2e-39   
ref|WP_043888020.1|  succinyl-CoA synthetase subunit alpha              149   2e-39   
ref|WP_029938263.1|  succinyl-CoA synthetase subunit alpha              149   2e-39   
ref|XP_002642901.1|  Hypothetical protein CBG15175                      149   2e-39   
gb|ACE03401.1|  succinyl-CoA synthetase, alpha subunit                  149   2e-39   
ref|XP_820834.1|  succinyl-CoA synthetase alpha subunit                 149   2e-39   
ref|WP_043695705.1|  succinyl-CoA synthetase subunit alpha              149   2e-39   
ref|WP_010150335.1|  succinyl-CoA synthetase subsunit alpha             149   2e-39   
gb|EKD41951.1|  hypothetical protein ACD_73C00426G0001                  147   3e-39   
ref|WP_033102339.1|  succinyl-CoA synthetase subsunit alpha             149   3e-39   
ref|WP_012461854.1|  succinyl-CoA synthetase subsunit alpha             149   3e-39   
ref|WP_007039745.1|  succinyl-CoA synthetase subunit alpha              149   3e-39   
gb|KIA76927.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha         149   3e-39   
gb|KIH63986.1|  succinate-CoA ligase, alpha subunit                     149   3e-39   
ref|WP_012567360.1|  succinyl-CoA synthetase subsunit alpha             148   3e-39   
ref|WP_027134502.1|  succinate--CoA ligase                              148   3e-39   
ref|XP_001466253.1|  putative succinyl-CoA synthetase alpha subunit     149   3e-39   
ref|WP_004514035.1|  succinyl-CoA synthetase subsunit alpha             148   3e-39   
gb|KHD05655.1|  succinyl-CoA synthetase subunit alpha                   148   3e-39   
ref|WP_028318490.1|  succinyl-CoA synthetase subsunit alpha             148   3e-39   
ref|XP_001683973.1|  putative succinyl-CoA synthetase alpha subunit     149   3e-39   
ref|XP_623800.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-forming...    149   3e-39   
gb|KJE93223.1|  succinate-CoA ligase                                    150   3e-39   
gb|EKG02561.1|  hypothetical protein TCSYLVIO_006405                    149   3e-39   
ref|XP_002425088.1|  succinyl-CoA ligase subunit alpha , putative       149   3e-39   
emb|CDW58541.1|  succinyl coenzyme A ligase (GDP forming) subunit...    149   4e-39   
ref|WP_011366016.1|  succinyl-CoA synthetase subsunit alpha             148   4e-39   
ref|WP_003823180.1|  succinyl-CoA synthetase subunit alpha              148   4e-39   
ref|XP_004995026.1|  succinyl-CoA ligase subunit alpha                  149   4e-39   
gb|EFZ13224.1|  hypothetical protein SINV_06825                         149   4e-39   
ref|WP_023886805.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    148   4e-39   
ref|WP_036315568.1|  succinyl-CoA synthetase subunit alpha              148   4e-39   
ref|XP_007728137.1|  succinyl-CoA ligase [GDP-forming] subunit al...    149   4e-39   
gb|EYC05959.1|  hypothetical protein Y032_0079g1274                     149   4e-39   
ref|XP_003435805.1|  AGAP001312-PB                                      146   4e-39   
ref|XP_011167335.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    149   4e-39   
ref|WP_016354339.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    148   4e-39   
ref|WP_035502491.1|  succinate--CoA ligase                              148   4e-39   
ref|XP_011349727.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    149   4e-39   
ref|XP_008216372.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    149   4e-39   
ref|XP_011264080.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    149   4e-39   
ref|WP_014955396.1|  succinyl-CoA synthetase subsunit alpha             148   4e-39   
ref|WP_011444840.1|  succinyl-CoA synthetase subsunit alpha             148   4e-39   
ref|WP_039808865.1|  succinyl-CoA synthetase subsunit alpha             148   4e-39   
gb|EPQ18023.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    145   4e-39   
ref|WP_004717274.1|  MULTISPECIES: succinyl-CoA ligase [ADP-formi...    148   4e-39   
ref|WP_043879654.1|  succinate--CoA ligase                              148   4e-39   
dbj|BAF90012.1|  succinyl-CoA ligase alpha subunit                      148   4e-39   
ref|WP_042671903.1|  succinate--CoA ligase                              148   5e-39   
ref|WP_010685286.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    148   5e-39   
gb|EGT47789.1|  hypothetical protein CAEBREN_09545                      149   5e-39   
ref|WP_011370796.1|  succinyl-CoA synthetase subunit alpha              148   5e-39   
ref|WP_043354951.1|  MULTISPECIES: succinate--CoA ligase                148   5e-39   
ref|XP_003694335.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    149   5e-39   
ref|WP_012317924.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    148   5e-39   
ref|WP_035228583.1|  succinyl-CoA synthetase subsunit alpha             148   5e-39   
emb|CDR96783.1|  succinyl-CoA synthetase, alpha subunit family pr...    149   5e-39   
ref|WP_015725041.1|  succinyl-CoA synthetase subsunit alpha             148   5e-39   
ref|WP_022736271.1|  succinyl-CoA synthetase subsunit alpha             148   5e-39   
ref|WP_010509731.1|  succinyl-CoA synthetase subsunit alpha             147   5e-39   
ref|WP_011632769.1|  succinyl-CoA synthetase subsunit alpha             147   5e-39   
ref|WP_043107133.1|  succinyl-CoA synthetase subunit alpha              147   5e-39   
ref|WP_039742538.1|  succinate--CoA ligase                              148   6e-39   
ref|XP_005536091.1|  succinyl-CoA synthetase alpha chain                149   6e-39   
ref|WP_015259246.1|  Succinyl-CoA ligase [ADP-forming] alpha chain      147   6e-39   
ref|NP_001156571.1|  succinyl coenzyme A synthetase alpha subunit       149   6e-39   
ref|WP_029012089.1|  succinate--CoA ligase                              147   6e-39   
ref|WP_003618449.1|  succinyl-CoA synthetase subsunit alpha             147   6e-39   
ref|WP_009725908.1|  succinyl-CoA ligase (ADP-forming) subunit alpha    147   6e-39   
ref|WP_035967511.1|  succinate--CoA ligase                              147   6e-39   
dbj|BAO89370.1|  succinyl-coA ligase [ADP-forming] subunit alpha        147   6e-39   
gb|KDQ20665.1|  hypothetical protein BOTBODRAFT_124404                  149   6e-39   
gb|EAQ24006.1|  succinyl-CoA synthase, alpha subunit                    143   6e-39   
ref|WP_043933339.1|  succinyl-CoA synthetase subsunit alpha             148   6e-39   
ref|WP_029004230.1|  succinate--CoA ligase                              144   7e-39   
ref|WP_029005676.1|  succinate--CoA ligase                              144   7e-39   
ref|WP_021621480.1|  succinyl-CoA synthetase, alpha subunit             147   7e-39   
ref|WP_034954425.1|  succinate--CoA ligase                              147   7e-39   
gb|EPY30588.1|  succinyl-CoA synthetase alpha subunit                   147   7e-39   



>ref|NP_001234574.1| succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial 
[Solanum lycopersicum]
 sp|Q6DQL1.1|SUCA2_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial; Short=SlSCoALalpha2; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAT67464.1| succinyl-CoA ligase alpha 2 subunit [Solanum lycopersicum]
Length=337

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLERF+ADPQTEGIVLIGEIGGTAEE
Sbjct  199  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFIADPQTEGIVLIGEIGGTAEE  258

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVTVCE
Sbjct  259  DAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVTVCE  318

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G TMLDVF +RGL
Sbjct  319  SPAKIGVTMLDVFKQRGL  336



>gb|AFL48180.1| succinyl-CoA synthetase [Capsicum annuum]
 gb|AFL48181.1| succinyl-CoA synthetase [Capsicum annuum]
Length=326

 Score =   224 bits (570),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLERF+ADPQTEGIVLIGEIGGTAEE
Sbjct  188  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFIADPQTEGIVLIGEIGGTAEE  247

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVTVCE
Sbjct  248  DAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVTVCE  307

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G TMLDVF +RGL
Sbjct  308  SPAKIGITMLDVFKQRGL  325



>gb|ABB29950.1| succinyl-CoA ligase alpha 1 subunit-like [Solanum tuberosum]
Length=262

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQTEGIVLIGEIGGTAEE
Sbjct  124  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGTAEE  183

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVTVCE
Sbjct  184  DAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVTVCE  243

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G +ML+VF +RGL+
Sbjct  244  SPAKIGVSMLEVFKQRGLV  262



>gb|AIS71903.1| mitochondrial succinyl-CoA ligase ADP-forming subunit alpha-2 
[Nicotiana tabacum]
Length=340

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FVADPQTEGIVLIGEIGGTAEE
Sbjct  202  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVADPQTEGIVLIGEIGGTAEE  261

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVTVCE
Sbjct  262  DAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVTVCE  321

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G +MLDVF +RGL+
Sbjct  322  SPAKIGASMLDVFKQRGLV  340



>ref|XP_006350379.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Solanum tuberosum]
Length=337

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLERF+ADPQTEGIVLIGEIGGTAEE
Sbjct  199  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFIADPQTEGIVLIGEIGGTAEE  258

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVTVCE
Sbjct  259  DAAALIKASGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVTVCE  318

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G TMLDVF +RGL
Sbjct  319  SPAKIGVTMLDVFKQRGL  336



>ref|XP_006348504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Solanum tuberosum]
Length=332

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQTEGIVLIGEIGGTAEE
Sbjct  194  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGTAEE  253

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVTVCE
Sbjct  254  DAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVTVCE  313

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G +ML+VF +RGL+
Sbjct  314  SPAKIGVSMLEVFKQRGLV  332



>ref|NP_001234277.1| succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Solanum lycopersicum]
 sp|Q8GTQ9.1|SUCA1_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial; Short=SlSCoALalpha1; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAN86619.1| succinyl-CoA ligase alpha 1 subunit [Solanum lycopersicum]
Length=332

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQTEGIVLIGEIGGTAEE
Sbjct  194  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGTAEE  253

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVTVCE
Sbjct  254  DAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVTVCE  313

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G +ML+VF +RGL+
Sbjct  314  SPAKIGVSMLEVFKQRGLV  332



>ref|XP_009623368.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Nicotiana tomentosiformis]
Length=338

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FVADPQTEGIVLIGEIGGTAEE
Sbjct  200  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVADPQTEGIVLIGEIGGTAEE  259

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI  LKEAGVTVCE
Sbjct  260  DAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKITALKEAGVTVCE  319

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G +MLDVF +RGL+
Sbjct  320  SPAKIGASMLDVFKQRGLV  338



>ref|XP_009781531.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Nicotiana sylvestris]
Length=338

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQS+CVGIGGDPFNGTNFVDCLE+FVADPQTEGIVLIGEIGGTAEE
Sbjct  200  LTYEAVFQTTAVGLGQSSCVGIGGDPFNGTNFVDCLEKFVADPQTEGIVLIGEIGGTAEE  259

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVTVCE
Sbjct  260  DAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVTVCE  319

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G +MLDVF +RGL+
Sbjct  320  SPAKIGASMLDVFKQRGLV  338



>ref|XP_009355925.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Pyrus x bretschneideri]
Length=334

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGIVLIGEIGGTAEE
Sbjct  195  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLQDPQTEGIVLIGEIGGTAEE  254

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  255  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  314

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  315  SPAKIGAAMLDVFKQRGLV  333



>gb|EYU45725.1| hypothetical protein MIMGU_mgv1a012075mg [Erythranthe guttata]
Length=262

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCL +F+ DPQTEGIVLIGEIGGTAEE
Sbjct  124  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLRKFLVDPQTEGIVLIGEIGGTAEE  183

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  184  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  243

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+GT ML+VF +RGL+
Sbjct  244  SPAKIGTAMLEVFKQRGLV  262



>ref|XP_004161847.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like, partial [Cucumis sativus]
Length=192

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGIVLIGEIGGTAEE
Sbjct  53   LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIVLIGEIGGTAEE  112

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KP+V FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  113  DAAALIKESGTDKPIVGFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  172

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G +ML+VF +RGL+
Sbjct  173  SPAKIGVSMLEVFKQRGLV  191



>ref|XP_009606229.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=179

 Score =   211 bits (537),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  713  VFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaaf  534
            VFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQTEGIVLIGEIGGTAEE+AAA 
Sbjct  46   VFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGTAEEDAAAL  105

Query  533  IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKL  354
            IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGT+QDKI+ LKEAGVTVCESPAK+
Sbjct  106  IKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTSQDKIKALKEAGVTVCESPAKI  165

Query  353  GTTMLDVFTKRGL  315
            G TMLD F +RGL
Sbjct  166  GVTMLDAFKQRGL  178



>ref|XP_004299462.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=337

 Score =   216 bits (551),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGIVLIGEIGGTAEE
Sbjct  198  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCMEKFLADPQTEGIVLIGEIGGTAEE  257

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  258  DAAALIKASGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  317

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  318  SPAKIGVAMLDVFKQRGLV  336



>gb|ABK95068.1| unknown [Populus trichocarpa]
Length=331

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGIVLIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVEKFLADPQTEGIVLIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA  IKESGTEKPVVAFIAG+TAPPGRRMGHAGAIVSGGKGTAQDKI+TL++AGV V E
Sbjct  252  DAATLIKESGTEKPVVAFIAGVTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVIVVE  311

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+GT MLDVF +RGL+
Sbjct  312  SPAKIGTAMLDVFKERGLV  330



>emb|CDP14400.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FVADPQTEGIVLIGEIGGTAEE
Sbjct  195  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVADPQTEGIVLIGEIGGTAEE  254

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVTV E
Sbjct  255  DAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKILKEAGVTVVE  314

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  + DVF +RGL+
Sbjct  315  SPAKIGAAIFDVFKQRGLV  333



>ref|XP_008467310.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Cucumis melo]
Length=342

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGIVLIGEIGGTAEE
Sbjct  203  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADPQTEGIVLIGEIGGTAEE  262

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KP+V FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  263  DAAALIKESGTDKPIVGFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  322

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G +ML+VF +RGL+
Sbjct  323  SPAKIGVSMLEVFKQRGLV  341



>gb|ABK94372.1| unknown [Populus trichocarpa]
Length=331

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+++F+ADPQTEGIVLIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVKKFLADPQTEGIVLIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA  IKESGTEKPVVAFIAG+TAPPGRRMGHAGAIVSGGKGTAQDKI+TL++AGV V E
Sbjct  252  DAATIIKESGTEKPVVAFIAGVTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVIVVE  311

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+GT MLDVF +RGL+
Sbjct  312  SPAKIGTAMLDVFKERGLV  330



>ref|XP_011022031.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Populus euphratica]
Length=331

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+++F+ADPQTEGIVLIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVKKFLADPQTEGIVLIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA  IKESGTEKPVVAFIAG+TAPPGRRMGHAGAIVSGGKGTAQDKI+TL++AGV V E
Sbjct  252  DAATLIKESGTEKPVVAFIAGVTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVIVVE  311

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+GT MLDVF +RGL+
Sbjct  312  SPAKIGTAMLDVFKERGLV  330



>ref|XP_002307162.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa]
 gb|EEE94158.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa]
Length=331

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+++F+ADPQTEGIVLIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVKKFLADPQTEGIVLIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA  IKESGTEKPVVAFIAG+TAPPGRRMGHAGAIVSGGKGTAQDKI+TL++AGV V E
Sbjct  252  DAATLIKESGTEKPVVAFIAGVTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVIVVE  311

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+GT MLDVF +RGL+
Sbjct  312  SPAKIGTAMLDVFKERGLV  330



>ref|XP_004137529.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Cucumis sativus]
 gb|KGN64210.1| Succinyl-CoA ligase alpha 1 subunit [Cucumis sativus]
Length=342

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGIVLIGEIGGTAEE
Sbjct  203  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIVLIGEIGGTAEE  262

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KP+V FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  263  DAAALIKESGTDKPIVGFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  322

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G +ML+VF +RGL+
Sbjct  323  SPAKIGVSMLEVFKQRGLV  341



>ref|XP_006658733.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like, partial [Oryza brachyantha]
Length=294

 Score =   210 bits (534),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  155  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  214

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV E
Sbjct  215  DAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVE  274

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG+L
Sbjct  275  SPAKIGSTMFEIFKQRGML  293



>ref|XP_010923343.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Elaeis guineensis]
Length=340

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ RF+ DPQTEGIVLIGEIGGTAEE
Sbjct  201  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTRFLDDPQTEGIVLIGEIGGTAEE  260

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA I+ESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  261  DAAALIRESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  320

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF + GL+
Sbjct  321  SPAKIGVAMLDVFKQHGLV  339



>sp|Q6ZL94.1|SUCA_ORYSJ RecName: Full=Probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial; AltName: Full=Succinyl-CoA synthetase 
subunit alpha; Short=SCS-alpha; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAC83073.1| putative succinyl-CoA ligase alpha subunit [Oryza sativa Japonica 
Group]
 gb|EAZ40411.1| hypothetical protein OsJ_24862 [Oryza sativa Japonica Group]
 dbj|BAH01520.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   211 bits (537),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV E
Sbjct  252  DAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVE  311

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG+L
Sbjct  312  SPAKIGSTMFEIFKQRGML  330



>dbj|BAK03449.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVG+GGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  190  LTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  249

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFI+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV E
Sbjct  250  DAAAFIRESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVE  309

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  310  SPAKIGSTMFEIFKQRGMV  328



>ref|XP_008796686.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Phoenix dactylifera]
Length=340

 Score =   211 bits (537),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ RF+ DPQTEGIVLIGEIGGTAEE
Sbjct  201  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTRFLEDPQTEGIVLIGEIGGTAEE  260

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA  I+ESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EA VTV E
Sbjct  261  DAAVLIQESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREADVTVVE  320

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  321  SPAKIGAAMLDVFKQRGLV  339



>dbj|BAJ94034.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92411.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   211 bits (536),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVG+GGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  190  LTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  249

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFI+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV E
Sbjct  250  DAAAFIRESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVE  309

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  310  SPAKIGSTMFEIFKQRGMV  328



>ref|XP_002872045.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48304.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F ADPQTEGIVLIGEIGGTAEE
Sbjct  200  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFADPQTEGIVLIGEIGGTAEE  259

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V E
Sbjct  260  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVE  319

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  320  SPAKIGAAMFEIFQERGLL  338



>ref|XP_006399319.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum]
 gb|ESQ40772.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum]
Length=347

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  267  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M D+F +RGLL
Sbjct  327  SPAKIGAAMYDLFQERGLL  345



>ref|XP_002318347.2| hypothetical protein POPTR_0012s033101g, partial [Populus trichocarpa]
 gb|EEE96567.2| hypothetical protein POPTR_0012s033101g, partial [Populus trichocarpa]
Length=192

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGI+LIGEIGGTAEE
Sbjct  53   LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIILIGEIGGTAEE  112

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  113  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  172

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G  MLDVF +RGL
Sbjct  173  SPAKIGVAMLDVFKQRGL  190



>gb|ACN28789.1| unknown [Zea mays]
Length=263

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  124  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGTAEE  183

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV E
Sbjct  184  DAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVE  243

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  244  SPAKIGSTMFEIFKQRGMV  262



>gb|EPS68438.1| hypothetical protein M569_06331, partial [Genlisea aurea]
Length=329

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ +AV LGQSTCVGIGGDPFNGTNFVDC+++F+ DPQTEGIVLIGEIGGTAEE
Sbjct  192  LTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDCIQKFLVDPQTEGIVLIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  252  DAAALIKESGTEKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  311

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G  MLD F ++GL
Sbjct  312  SPAKIGVAMLDAFKQKGL  329



>ref|XP_004958125.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Setaria italica]
Length=332

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  193  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  252

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV E
Sbjct  253  DAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVE  312

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  313  SPAKIGSTMFEIFKQRGMV  331



>ref|XP_008788992.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Phoenix dactylifera]
Length=341

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T V LGQSTCVGIGGDPFNGTNFVDC+ RF+ DPQTEGIVLIGEIGGTAEE
Sbjct  202  LTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCITRFLEDPQTEGIVLIGEIGGTAEE  261

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA I+ESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  262  DAAALIRESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  321

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF + GL+
Sbjct  322  SPAKIGAAMLDVFKQGGLV  340



>ref|XP_009413310.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Musa acuminata subsp. malaccensis]
Length=336

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCL +F+ DPQTEGIVLIGEIGGTAEE
Sbjct  197  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLRKFLEDPQTEGIVLIGEIGGTAEE  256

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA I+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  257  DAAALIQESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  316

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +R L+
Sbjct  317  SPAKIGVAMLDVFKQRRLV  335



>ref|XP_009125723.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Brassica rapa]
 emb|CDY40757.1| BnaAnng06200D [Brassica napus]
Length=342

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  202  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  261

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  262  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  321

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M D+F +RGLL
Sbjct  322  SPAKIGAAMYDLFKERGLL  340



>ref|XP_003562832.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Brachypodium distachyon]
Length=327

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVG+GGDPFNGTNFVDCLE+FVADPQTEGIV+IGEIGGTAEE
Sbjct  188  LTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNFVDCLEKFVADPQTEGIVVIGEIGGTAEE  247

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFI+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L++AGVTV E
Sbjct  248  DAAAFIQESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALRDAGVTVVE  307

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  308  SPAKIGSTMFELFKQRGMV  326



>ref|XP_002460917.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
 gb|EER97438.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
Length=332

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  193  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  252

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV E
Sbjct  253  DAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVE  312

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  313  SPAKIGSTMFEIFKQRGMV  331



>emb|CDY44764.1| BnaC02g01230D [Brassica napus]
Length=343

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  203  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  262

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  263  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  322

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M D+F +RGLL
Sbjct  323  SPAKIGAAMYDLFKERGLL  341



>ref|XP_001762925.1| predicted protein [Physcomitrella patens]
 gb|EDQ72130.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGG+AEE
Sbjct  186  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGSAEE  245

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFIKESGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI  L+ AGVTVCE
Sbjct  246  DAAAFIKESGTQKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTATDKINALRAAGVTVCE  305

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPA++G+TML VF +R L+
Sbjct  306  SPAQIGSTMLRVFQERALI  324



>gb|ACG31861.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=320

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  181  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  240

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV E
Sbjct  241  DAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVE  300

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  301  SPAKIGSTMFEIFKQRGMV  319



>ref|XP_006847834.1| hypothetical protein AMTR_s00029p00055000 [Amborella trichopoda]
 gb|ERN09415.1| hypothetical protein AMTR_s00029p00055000 [Amborella trichopoda]
Length=314

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+++F+ DPQTEGIVLIGEIGGTAEE
Sbjct  175  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIKKFLEDPQTEGIVLIGEIGGTAEE  234

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+TL+E G TV E
Sbjct  235  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKTLREVGATVVE  294

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M +VF +RGLL
Sbjct  295  SPAKIGAAMHEVFKQRGLL  313



>ref|XP_010934473.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Elaeis guineensis]
Length=340

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T V LGQSTCVGIGGDPFNGTNFVDC+ RF+ DPQT+GIVLIGEIGGTAEE
Sbjct  201  LTYEAVFQTTTVGLGQSTCVGIGGDPFNGTNFVDCITRFLEDPQTKGIVLIGEIGGTAEE  260

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA I+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  261  DAAALIRESRTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  320

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  321  SPAKIGAAMLDVFKQRGLV  339



>ref|XP_007152547.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris]
 gb|ESW24541.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris]
Length=324

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCL +F+ DPQTEGI+LIGEIGGTAEE
Sbjct  185  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLRKFIPDPQTEGIILIGEIGGTAEE  244

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL+EAGVTV E
Sbjct  245  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLREAGVTVVE  304

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  305  SPAKIGAAMLDVFKRRGLV  323



>gb|KDP45810.1| hypothetical protein JCGZ_17417 [Jatropha curcas]
Length=339

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ERF+ADPQTEGI+LIGEIGGTAEE
Sbjct  200  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIERFLADPQTEGIILIGEIGGTAEE  259

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA  IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  260  DAAKLIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  319

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G  MLDVF +RGL
Sbjct  320  SPAKIGLAMLDVFKQRGL  337



>emb|CDX81092.1| BnaC03g03460D [Brassica napus]
Length=346

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  206  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  265

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  266  DAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  325

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M D+F +RGLL
Sbjct  326  SPAKIGAAMYDLFKERGLL  344



>ref|NP_001149702.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gb|ACG36440.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 tpg|DAA41208.1| TPA: succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=331

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV E
Sbjct  252  DAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVE  311

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  312  SPAKIGSTMFEIFKQRGMV  330



>ref|XP_009131054.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Brassica rapa]
Length=343

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  203  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  262

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  263  DAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  322

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M D+F +RGLL
Sbjct  323  SPAKIGAAMYDLFKERGLL  341



>ref|NP_001136494.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gb|ACF82043.1| unknown [Zea mays]
 tpg|DAA63303.1| TPA: succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=331

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV E
Sbjct  252  DAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVE  311

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  312  SPAKIGSTMFEIFKQRGMV  330



>gb|EEC82322.1| hypothetical protein OsI_26601 [Oryza sativa Indica Group]
Length=432

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  293  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  352

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV E
Sbjct  353  DAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVE  412

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG+L
Sbjct  413  SPAKIGSTMFEIFKQRGML  431



>ref|XP_002514509.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF47909.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
Length=334

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGI+LIGEIGGTAEE
Sbjct  195  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADPQTEGIILIGEIGGTAEE  254

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TLKEAGVTV E
Sbjct  255  DAAALIKESGTDKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLKEAGVTVVE  314

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G  MLDVF +RGL
Sbjct  315  SPAKIGVAMLDVFKQRGL  332



>emb|CDY21531.1| BnaC09g47610D [Brassica napus]
Length=347

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  267  DAAALIKASGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+ M D+F +RGLL
Sbjct  327  SPAKIGSAMYDLFKERGLL  345



>ref|XP_002514510.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF47910.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
Length=334

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGI+LIGEIGGTAEE
Sbjct  195  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADPQTEGIILIGEIGGTAEE  254

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TLKEAGVTV E
Sbjct  255  DAAALIKESGTDKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLKEAGVTVVE  314

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G  MLDVF +RGL
Sbjct  315  SPAKIGVAMLDVFKQRGL  332



>ref|XP_001765853.1| predicted protein [Physcomitrella patens]
 gb|EDQ69444.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGG+AEE
Sbjct  186  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGSAEE  245

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFI+ESGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI  L+ AGVTVCE
Sbjct  246  DAAAFIRESGTQKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTATDKINALRAAGVTVCE  305

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPA++G TML VF +R L+
Sbjct  306  SPAQIGATMLKVFEERALI  324



>ref|XP_008375061.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Malus domestica]
Length=334

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+LIGEIGGTAEE
Sbjct  195  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLQDPQTEGIILIGEIGGTAEE  254

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  255  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  314

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  315  SPAKIGAAMLDVFKQRGLV  333



>gb|EMS53891.1| putative succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial 
[Triticum urartu]
Length=383

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVG+GGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  244  LTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  303

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFI+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L++AGVTV E
Sbjct  304  DAAAFIQESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALRDAGVTVVE  363

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  364  SPAKIGSTMFELFKQRGMV  382



>emb|CDY61908.1| BnaC07g49680D [Brassica napus]
Length=345

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ +AV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  206  LTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  265

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V E
Sbjct  266  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVE  325

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  326  SPAKIGAAMFELFQERGLL  344



>ref|XP_003548295.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Glycine max]
Length=325

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGTAEE
Sbjct  186  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIGGTAEE  245

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  246  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  305

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  306  SPAKIGAAMLDVFKQRGLV  324



>ref|NP_197716.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
 sp|Q8LAD2.2|SUCA2_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha-2; Short=SCS-alpha-2; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB11180.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gb|AAM12993.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gb|AAM47926.1| succinyl-CoA synthetase alpha subunit [Arabidopsis thaliana]
 gb|AED93141.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
Length=341

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  202  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  261

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKE+GT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V E
Sbjct  262  DAAALIKENGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVE  321

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  322  SPAKIGAAMFELFQERGLL  340



>ref|XP_010423114.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Camelina sativa]
Length=343

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  203  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  262

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  263  DAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  322

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+ M ++F +RGLL
Sbjct  323  SPAKIGSAMYELFQERGLL  341



>ref|XP_010491456.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Camelina sativa]
Length=348

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  208  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  267

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  268  DAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  327

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+ M ++F +RGLL
Sbjct  328  SPAKIGSAMYELFQERGLL  346



>ref|XP_010452813.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Camelina sativa]
Length=347

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  267  DAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+ M ++F +RGLL
Sbjct  327  SPAKIGSAMYELFQERGLL  345



>ref|NP_196447.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis 
thaliana]
 sp|P68209.1|SUCA1_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha-1; Short=SCS-alpha-1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA05023.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 emb|CAC08330.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAL61940.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAM47932.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAM60889.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AED91279.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis 
thaliana]
Length=347

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  267  DAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+ M ++F +RGLL
Sbjct  327  SPAKIGSAMYELFQERGLL  345



>ref|XP_008240339.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Prunus mume]
Length=329

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+LIGEIGGTAEE
Sbjct  190  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLEDPQTEGIILIGEIGGTAEE  249

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  250  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  309

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  310  SPAKIGVAMLDVFKQRGLV  328



>ref|XP_011047755.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
Length=342

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGI+LIGEIGGTAEE
Sbjct  203  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIILIGEIGGTAEE  262

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  263  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  322

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G  MLDVF +RGL
Sbjct  323  SPAKIGVAMLDVFKQRGL  340



>emb|CDX78333.1| BnaA03g02450D [Brassica napus]
Length=346

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  206  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  265

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  266  DAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  325

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M D+F +RG L
Sbjct  326  SPAKIGAAMYDLFKERGFL  344



>ref|XP_010241497.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
 ref|XP_010241498.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
 ref|XP_010241499.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
Length=346

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ +F+ DPQTEGI+LIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCMNKFLVDPQTEGIILIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  267  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGLL
Sbjct  327  SPAKIGAAMLDVFKQRGLL  345



>ref|XP_007209332.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica]
 gb|EMJ10531.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica]
Length=336

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+LIGEIGGTAEE
Sbjct  197  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLEDPQTEGIILIGEIGGTAEE  256

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  257  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  316

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  317  SPAKIGVAMLDVFKQRGLV  335



>ref|XP_006288079.1| hypothetical protein CARUB_v10001317mg [Capsella rubella]
 gb|EOA20977.1| hypothetical protein CARUB_v10001317mg [Capsella rubella]
Length=347

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  267  DAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  327  SPAKIGAAMYELFQERGLL  345



>ref|XP_002871316.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47575.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  267  DAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  327  SPAKIGAAMYELFQERGLL  345



>gb|KHN24503.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Glycine soja]
Length=352

 Score =   207 bits (526),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGTAEE
Sbjct  213  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIGGTAEE  272

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  273  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  332

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  333  SPAKIGAAMLDVFKQRGLV  351



>emb|CDX69957.1| BnaA10g23060D [Brassica napus]
Length=347

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  267  DAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  327  SPAKIGAAMYELFKERGLL  345



>emb|CDY02216.1| BnaA03g39510D [Brassica napus]
Length=346

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ +AV LGQSTCVGIGGDPFNGTNFVDCL++F  DPQTEGIVLIGEIGGTAEE
Sbjct  207  LTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDCLDKFFVDPQTEGIVLIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V E
Sbjct  267  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  327  SPAKIGAAMFELFQERGLL  345



>ref|XP_009136375.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Brassica rapa]
Length=346

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ +AV LGQSTCVGIGGDPFNGTNFVDCL++F  DPQTEGIVLIGEIGGTAEE
Sbjct  207  LTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDCLDKFFVDPQTEGIVLIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V E
Sbjct  267  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  327  SPAKIGAAMFELFQERGLL  345



>ref|XP_011091459.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Sesamum indicum]
Length=330

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGI+LIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIILIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  252  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  311

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+GT ML+VF +RGL
Sbjct  312  SPAKIGTAMLEVFKQRGL  329



>gb|KDP45811.1| hypothetical protein JCGZ_17418 [Jatropha curcas]
Length=341

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ERF+ DPQTEGI+LIGEIGGTAEE
Sbjct  202  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIERFLVDPQTEGIILIGEIGGTAEE  261

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA  IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL+EAG TV E
Sbjct  262  DAAQLIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLREAGATVVE  321

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLD+F +RGL+
Sbjct  322  SPAKIGVAMLDIFKQRGLV  340



>emb|CAA48891.1| succinate--CoA ligase (GDP-forming) [Arabidopsis thaliana]
Length=345

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  206  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  265

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKE+GT+KPVVAFIAGLTAPPGRRMGHAG IVSGGKGTAQDKI++L++AGV V E
Sbjct  266  DAAALIKENGTDKPVVAFIAGLTAPPGRRMGHAGRIVSGGKGTAQDKIKSLRDAGVKVVE  325

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAKLG  M ++F +RGLL
Sbjct  326  SPAKLGAAMFELFQERGLL  344



>gb|KJB79846.1| hypothetical protein B456_013G069200 [Gossypium raimondii]
Length=335

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGTAEE
Sbjct  196  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADPQTEGIILIGEIGGTAEE  255

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  256  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  315

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M DVF +RGLL
Sbjct  316  SPAKIGVAMHDVFKQRGLL  334



>ref|XP_002268479.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Vitis vinifera]
Length=340

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQST VGIGGDPFNGTNFVDC+++F+ DPQTEGIVLIGEIGGTAEE
Sbjct  200  LTYEAVFQTTAVGLGQSTSVGIGGDPFNGTNFVDCIKKFLVDPQTEGIVLIGEIGGTAEE  259

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA  IKES TEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  260  DAAQLIKESKTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  319

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  ML+ F ++GL+
Sbjct  320  SPAKMGVAMLEAFKQKGLI  338



>emb|CBI35274.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQST VGIGGDPFNGTNFVDC+++F+ DPQTEGIVLIGEIGGTAEE
Sbjct  196  LTYEAVFQTTAVGLGQSTSVGIGGDPFNGTNFVDCIKKFLVDPQTEGIVLIGEIGGTAEE  255

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA  IKES TEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  256  DAAQLIKESKTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  315

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  ML+ F ++GL+
Sbjct  316  SPAKMGVAMLEAFKQKGLI  334



>ref|XP_004515280.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Cicer arietinum]
Length=327

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV+Q TAV LGQSTCVGIGGDPFNGTNFVDCL +F+ADPQTEGI+LIGEIGGTAEE
Sbjct  188  LTYEAVYQTTAVGLGQSTCVGIGGDPFNGTNFVDCLTKFIADPQTEGIILIGEIGGTAEE  247

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL+EAGVTV E
Sbjct  248  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLREAGVTVVE  307

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M D+F ++GL+
Sbjct  308  SPAKIGAAMFDIFKQKGLV  326



>gb|EYU19899.1| hypothetical protein MIMGU_mgv1a009825mg [Erythranthe guttata]
Length=330

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLVDPQTEGIILIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  252  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  311

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  ML+VF +RGL+
Sbjct  312  SPAKIGIAMLEVFKQRGLV  330



>ref|XP_006493424.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Citrus sinensis]
Length=347

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T V LGQSTCVGIGGDPFNGTNFVDCLE+F+ DPQTEGI+LIGEIGGTAEE
Sbjct  208  LTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNFVDCLEKFLVDPQTEGIILIGEIGGTAEE  267

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  268  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  327

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G+ ML+VF +RGL
Sbjct  328  SPAKIGSAMLEVFKQRGL  345



>gb|AAM65450.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
Length=341

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  202  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  261

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKE+GT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDK ++L++AGV V E
Sbjct  262  DAAALIKENGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKTKSLRDAGVKVVE  321

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  322  SPAKIGAAMFELFQERGLL  340



>gb|KHG06820.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial 
[Gossypium arboreum]
Length=335

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGTAEE
Sbjct  196  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADPQTEGIILIGEIGGTAEE  255

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  256  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  315

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M DVF +RGLL
Sbjct  316  SPAKIGVAMHDVFKQRGLL  334



>ref|XP_008393504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Malus domestica]
Length=334

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+LIGEIGGTAEE
Sbjct  195  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLQDPQTEGIILIGEIGGTAEE  254

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EA VTV E
Sbjct  255  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREADVTVVE  314

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  315  SPAKIGLAMLDVFKQRGLV  333



>ref|XP_006441425.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
 gb|ESR54665.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
Length=347

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T V LGQSTCVG+GGDPFNGTNFVDCLE+F+ DPQTEGI+LIGEIGGTAEE
Sbjct  208  LTYEAVFQTTVVGLGQSTCVGVGGDPFNGTNFVDCLEKFLVDPQTEGIILIGEIGGTAEE  267

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  268  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  327

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G+ ML+VF +RGL
Sbjct  328  SPAKIGSAMLEVFKQRGL  345



>gb|AGT16123.1| succinyl-CoA ligase [Saccharum hybrid cultivar R570]
Length=458

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV E
Sbjct  252  DAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVE  311

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+TM ++F +RG++
Sbjct  312  SPAKIGSTMFEIFKQRGMV  330



>ref|XP_006484523.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Citrus sinensis]
Length=331

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFIADPQTEGIILIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  252  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  311

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G  ML+VF +RGL
Sbjct  312  SPAKIGAAMLEVFKQRGL  329



>ref|XP_010547709.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Tarenaya hassleriana]
Length=348

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFV+CLE+F  DPQTEGI+LIGEIGGTAEE
Sbjct  202  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVNCLEKFFVDPQTEGIILIGEIGGTAEE  261

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++LK+AGVTV E
Sbjct  262  EAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLKDAGVTVVE  321

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G+ M D+F +RGLL
Sbjct  322  SPAKIGSAMHDIFQERGLL  340



>ref|XP_006394592.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum]
 gb|ESQ31878.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum]
Length=401

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  262  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  321

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++A V V E
Sbjct  322  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAEVKVVE  381

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  382  SPAKIGAAMFELFQERGLL  400



>ref|NP_001241205.1| uncharacterized protein LOC100782001 [Glycine max]
 gb|ACU24596.1| unknown [Glycine max]
Length=324

 Score =   203 bits (517),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGTAEE
Sbjct  185  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIGGTAEE  244

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK+SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGV V E
Sbjct  245  DAAALIKDSGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVMVVE  304

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  305  SPAKIGAAMLDVFKQRGLV  323



>gb|KHN23614.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Glycine soja]
Length=345

 Score =   203 bits (517),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGTAEE
Sbjct  206  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIGGTAEE  265

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK+SGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGV V E
Sbjct  266  DAAALIKDSGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVMVVE  325

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  326  SPAKIGAAMLDVFKQRGLV  344



>ref|XP_010546242.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Tarenaya hassleriana]
Length=346

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGTAEE
Sbjct  202  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGTAEE  261

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGVTV E
Sbjct  262  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVTVVE  321

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLD+F  RGL+
Sbjct  322  SPAKIGAAMLDIFQDRGLV  340



>gb|KJB31853.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=346

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADPQTEGIILIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  267  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M +VF +RGLL
Sbjct  327  SPAKIGVAMHEVFKQRGLL  345



>gb|KHG04322.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Gossypium arboreum]
Length=346

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADPQTEGIILIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  267  DAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M +VF +RGLL
Sbjct  327  SPAKIGVAMHEVFKQRGLL  345



>ref|XP_002271746.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Vitis vinifera]
 emb|CBI29046.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+++F+ADPQTEGI+LIGEIGGTAEE
Sbjct  190  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVKKFLADPQTEGIILIGEIGGTAEE  249

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL++ G TV E
Sbjct  250  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLRDVGATVVE  309

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDVF +RGL+
Sbjct  310  SPAKIGVAMLDVFKQRGLV  328



>ref|XP_006437603.1| hypothetical protein CICLE_v10032075mg [Citrus clementina]
 gb|ESR50843.1| hypothetical protein CICLE_v10032075mg [Citrus clementina]
Length=331

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIGGTAEE
Sbjct  192  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFIADPQTEGIILIGEIGGTAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKES TEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  252  DAAALIKESRTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  311

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G  ML+VF +RGL
Sbjct  312  SPAKIGAAMLEVFKQRGL  329



>ref|XP_003620150.1| Succinyl-CoA ligase [Medicago truncatula]
 gb|AES76368.1| succinyl-CoA ligase [ADP-forming] subunit alpha-2 [Medicago truncatula]
Length=323

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV+Q TAV LGQSTCVGIGGDPFNGTNFVDCL +F+ADPQTEGI+LIGEIGGTAEE
Sbjct  184  LTYEAVYQTTAVGLGQSTCVGIGGDPFNGTNFVDCLTKFLADPQTEGIILIGEIGGTAEE  243

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI TL+EAGVTV E
Sbjct  244  DAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKISTLREAGVTVVE  303

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F ++GL+
Sbjct  304  SPAKIGAAMFEIFKQKGLV  322



>ref|XP_009122444.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Brassica rapa]
Length=347

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IK +GT  PVV+FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L +AGV V E
Sbjct  267  DAAALIKANGTVNPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLNDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M D+F +RGLL
Sbjct  327  SPAKIGAAMYDLFKERGLL  345



>gb|KFK27646.1| hypothetical protein AALP_AA8G410300 [Arabis alpina]
Length=347

 Score =   201 bits (511),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGTAEE
Sbjct  208  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGTAEE  267

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V E
Sbjct  268  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVE  327

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M D+F +RGLL
Sbjct  328  SPAKIGAAMFDIFQERGLL  346



>ref|XP_011003681.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
 ref|XP_011003682.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
Length=373

 Score =   202 bits (513),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+AD QTEGI+LIGEIGGTAEE
Sbjct  234  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADSQTEGIILIGEIGGTAEE  293

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGTEKPV AFIAG TAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  294  DAAALIKESGTEKPVAAFIAGQTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  353

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G  MLDVF +RGL
Sbjct  354  SPAKIGVAMLDVFKQRGL  371



>ref|XP_010031908.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Eucalyptus grandis]
 gb|KCW51304.1| hypothetical protein EUGRSUZ_J00864 [Eucalyptus grandis]
Length=333

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ +F+ DPQTEGI+LIGEIGGTAEE
Sbjct  194  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIRKFLVDPQTEGIILIGEIGGTAEE  253

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKES TEKPVV FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  254  DAAALIKESKTEKPVVGFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  313

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  ML+VF +RGL+
Sbjct  314  SPAKIGAAMLEVFKQRGLV  332



>ref|XP_007043270.1| Succinyl-CoA ligase, alpha subunit [Theobroma cacao]
 gb|EOX99101.1| Succinyl-CoA ligase, alpha subunit [Theobroma cacao]
Length=351

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDC+ +F+ DPQTEGIV+IGEIGGTAEE
Sbjct  212  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLDDPQTEGIVIIGEIGGTAEE  271

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV E
Sbjct  272  DAAALIKESGTKKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVE  331

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  ML+VF +RGL+
Sbjct  332  SPAKIGVAMLNVFKERGLV  350



>ref|XP_010454606.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Camelina sativa]
Length=346

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGTAEE
Sbjct  207  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGTAEE  266

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V E
Sbjct  267  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVE  326

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  327  SPAKIGAAMFEIFQERGLL  345



>ref|XP_010493442.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Camelina sativa]
Length=345

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGTAEE
Sbjct  206  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGTAEE  265

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V E
Sbjct  266  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVE  325

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  326  SPAKIGAAMFEIFQERGLL  344



>ref|XP_010421123.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Camelina sativa]
Length=345

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGTAEE
Sbjct  206  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGTAEE  265

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V E
Sbjct  266  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVE  325

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  326  SPAKIGAAMFEIFQERGLL  344



>ref|XP_006288023.1| hypothetical protein CARUB_v10001256mg, partial [Capsella rubella]
 gb|EOA20921.1| hypothetical protein CARUB_v10001256mg, partial [Capsella rubella]
Length=359

 Score =   199 bits (505),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGTAEE
Sbjct  220  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGTAEE  279

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V E
Sbjct  280  DAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVE  339

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +RGLL
Sbjct  340  SPAKIGAAMFEIFQERGLL  358



>ref|XP_010069514.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Eucalyptus grandis]
 gb|KCW57892.1| hypothetical protein EUGRSUZ_H00643 [Eucalyptus grandis]
Length=339

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ TAV LGQSTCVGIGGDPFNGTNFVDCLERFV DPQTEGI+LIGEIGGTAEE
Sbjct  199  LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVVDPQTEGIILIGEIGGTAEE  258

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAFIKES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ KI  L+EAGVTV E
Sbjct  259  DAAAFIKESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQGKIEALREAGVTVVE  318

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  MLDV  ++GL+
Sbjct  319  SPAKIGAAMLDVLKQKGLV  337



>ref|XP_006376608.1| hypothetical protein POPTR_0012s00920g [Populus trichocarpa]
 gb|ERP54405.1| hypothetical protein POPTR_0012s00920g [Populus trichocarpa]
Length=282

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  722  YEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeea  543
            ++ VFQ TAV LGQSTCVGIGGDPFNGTNFVDC+E+F+AD QTEGI+LIGEIGGTAEE+A
Sbjct  145  HDMVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADSQTEGIILIGEIGGTAEEDA  204

Query  542  aafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESP  363
            AA IKESGTEKPVVAFIAG TAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV ESP
Sbjct  205  AALIKESGTEKPVVAFIAGQTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESP  264

Query  362  AKLGTTMLDVFTKRGL  315
            AK+G  MLDVF +RGL
Sbjct  265  AKIGVAMLDVFKQRGL  280



>ref|XP_010688675.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=342

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ +AV LGQST VGIGGDPFNGTNFVDCLE+F+ DPQTEGI+LIGEIGGTAEE
Sbjct  203  LTYEAVFQTSAVGLGQSTVVGIGGDPFNGTNFVDCLEKFIEDPQTEGIILIGEIGGTAEE  262

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA IKES TEKPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI TL+ AGVTV E
Sbjct  263  DAAAVIKESKTEKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKITTLRGAGVTVVE  322

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPA++G  MLDVF +RGLL
Sbjct  323  SPAQMGAAMLDVFKQRGLL  341



>ref|XP_009389047.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Musa acuminata subsp. malaccensis]
Length=341

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T V LGQSTCVGIGGDPFNGTNFVDC+ +F+ DPQTEGI+LIGEIGGTAEE
Sbjct  202  LTYEAVFQTTNVGLGQSTCVGIGGDPFNGTNFVDCITKFLDDPQTEGIILIGEIGGTAEE  261

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA I ESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGV V E
Sbjct  262  DAAALILESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVMVVE  321

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPAK+G  ML+VF +RGL
Sbjct  322  SPAKIGVAMLEVFKQRGL  339



>gb|EMT17065.1| Putative succinyl-CoA ligase (GDP-forming) subunit alpha, mitochondrial 
[Aegilops tauschii]
Length=356

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 131/165 (79%), Gaps = 26/165 (16%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTE--------------  591
            LTYEAVFQ TAV LGQSTCVG+GGDPFNGTNFVDCLE+FV DPQTE              
Sbjct  191  LTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNFVDCLEKFVDDPQTEVMFSSVNAVISLLS  250

Query  590  ------------GIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  447
                        GIVLIGEIGGTAEE+AAAFI+ES TEKPVVAFIAGLTAPPGRRMGHAG
Sbjct  251  IILIGKIGMCLLGIVLIGEIGGTAEEDAAAFIRESKTEKPVVAFIAGLTAPPGRRMGHAG  310

Query  446  AIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  312
            AIVSGGKGTAQDKI+ L++AGVTV ESPAK+G+TM ++F +RG++
Sbjct  311  AIVSGGKGTAQDKIKALRDAGVTVVESPAKIGSTMFELFKQRGMV  355



>ref|XP_001780609.1| predicted protein [Physcomitrella patens]
 gb|EDQ54592.1| predicted protein [Physcomitrella patens]
Length=299

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T V LGQSTC+GIGGDPF+GT+FVDCL  FV DPQTEG+VLIGEIGG+ EE
Sbjct  161  LTYEAVFQTTRVGLGQSTCIGIGGDPFSGTSFVDCLRCFVKDPQTEGVVLIGEIGGSGEE  220

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FI  SGT+KPVVAF+AGLTAPPGRRMGHAGAI++GG+GTAQ K++ L+ AGVTV E
Sbjct  221  DAARFIVSSGTQKPVVAFVAGLTAPPGRRMGHAGAIIAGGRGTAQAKMKALRAAGVTVVE  280

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPA LG T+L VF  R LL
Sbjct  281  SPAHLGKTILKVFRDRRLL  299



>ref|XP_001693108.1| succinyl-coa ligase alpha chain [Chlamydomonas reinhardtii]
 ref|XP_001693109.1| succinyl-CoA ligase [Chlamydomonas reinhardtii]
 gb|EDP03134.1| succinyl-coa ligase alpha chain [Chlamydomonas reinhardtii]
 gb|EDP03135.1| succinyl-CoA ligase [Chlamydomonas reinhardtii]
Length=329

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T   LGQST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGGTAEE
Sbjct  191  LTYEAVFQTTNQGLGQSTVVGIGGDPFNGTNFVDCLERFVKDPQTEGIIMIGEIGGTAEE  250

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA FI++SGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI+ L+EAGVTV  
Sbjct  251  EAAEFIRKSGTKKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTATDKIKALEEAGVTVTR  310

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPA++G TM+ V  +RGL
Sbjct  311  SPAQMGVTMMRVMKERGL  328



>gb|KFH07184.1| succinyl-CoA-synthetase alpha SCSA, partial [Toxoplasma gondii 
MAS]
Length=147

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+AEE
Sbjct  8    LTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGSAEE  67

Query  548  eaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAAA++KE   E KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV V 
Sbjct  68   EAAAWLKEHNKEQKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVV  127

Query  371  ESPAKLGTTMLDVFTKRGL  315
             +PA +G  ML+V    GL
Sbjct  128  RNPAAMGQKMLEVMQAAGL  146



>ref|XP_011398589.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Auxenochlorella protothecoides]
 gb|KFM25693.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Auxenochlorella protothecoides]
Length=321

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T   LGQST VGIGGDPFNGTNFVDCLERFVADPQTEGI++IGEIGGTAEE
Sbjct  183  LTYEAVFQTTQQGLGQSTVVGIGGDPFNGTNFVDCLERFVADPQTEGIIMIGEIGGTAEE  242

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F++ SGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI  L+ AGVTV +
Sbjct  243  EAADFLRASGTDKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTAGDKIAALEAAGVTVSQ  302

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPA++G  M  +F +RGLL
Sbjct  303  SPAQMGVAMKKLFEERGLL  321



>gb|KDD74604.1| hypothetical protein H632_c1190p0 [Helicosporidium sp. ATCC 50920]
Length=326

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV+Q TA  LGQST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGGTAEE
Sbjct  188  LTYEAVYQTTAEGLGQSTVVGIGGDPFNGTNFVDCLERFVEDPQTEGIIMIGEIGGTAEE  247

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA FI+ SGT+KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA DKI  L+ AGVTV +
Sbjct  248  EAAEFIRASGTDKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAADKIAALEAAGVTVSQ  307

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPA++G  M  +F +R LL
Sbjct  308  SPAQMGAAMKRIFKERNLL  326



>ref|XP_002957241.1| succinate-coa ligase alpha chain, succinyl-CoA synthetase mitochondrial 
precursor [Volvox carteri f. nagariensis]
 gb|EFJ41739.1| succinate-coa ligase alpha chain, succinyl-CoA synthetase mitochondrial 
precursor [Volvox carteri f. nagariensis]
Length=328

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T   LGQST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGGTAEE
Sbjct  190  LTYEAVFQTTNQGLGQSTVVGIGGDPFNGTNFVDCLERFVKDPQTEGIIMIGEIGGTAEE  249

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA FIK SGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG A DKI  L+ AGVTV  
Sbjct  250  EAAEFIKASGTQKPVVSFIAGLTAPPGRRMGHAGAIISGGKGRASDKIEALESAGVTVTR  309

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPA++G+TM+ V  +RGL
Sbjct  310  SPAQMGSTMMRVMRERGL  327



>ref|XP_003078495.1| putative succinyl-CoA ligase alpha subunit (ISS) [Ostreococcus 
tauri]
 emb|CAL53236.1| Succinyl-CoA synthetase-like [Ostreococcus tauri]
Length=331

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV+Q T   LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGI++IGEIGGTAEE
Sbjct  193  LTYEAVYQTTVTGLGQSTCVGIGGDPFNGTNFVDCLEKFVKDPQTEGIIMIGEIGGTAEE  252

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA FI+ SGT+KP+V+FIAGLTAPPGRRMGHAGAI+SGGKG A DKI  L+ AGV V +
Sbjct  253  EAAEFIRASGTDKPIVSFIAGLTAPPGRRMGHAGAIISGGKGGASDKIAALEAAGVRVVK  312

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M D+F +R +L
Sbjct  313  SPAKMGQAMYDMFAERKML  331



>ref|XP_005643816.1| succinyl-CoA ligase alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE19272.1| succinyl-CoA ligase alpha chain [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T   LGQST VGIGGDPFNGTNFVDCLERF+ DPQTEGI++IGEIGGTAEE
Sbjct  161  LTYEAVFQTTQQGLGQSTVVGIGGDPFNGTNFVDCLERFLKDPQTEGIIMIGEIGGTAEE  220

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA  IK SGT+KP+++FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI  L+ AGVTV +
Sbjct  221  EAAELIKASGTDKPILSFIAGLTAPPGRRMGHAGAIISGGKGTATDKINALESAGVTVVK  280

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPA++GT M  + ++RGL
Sbjct  281  SPAQMGTAMKKIMSERGL  298



>ref|XP_005843440.1| hypothetical protein CHLNCDRAFT_141133 [Chlorella variabilis]
 gb|EFN51338.1| hypothetical protein CHLNCDRAFT_141133 [Chlorella variabilis]
Length=330

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T   LGQST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGG+AEE
Sbjct  192  LTYEAVFQTTNEGLGQSTVVGIGGDPFNGTNFVDCLERFVLDPQTEGIIMIGEIGGSAEE  251

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+  SGT KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTAQDKI+ L+ AGVTV  
Sbjct  252  EAAEFLIASGTTKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTAQDKIKALEAAGVTVTN  311

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPA++G TM  V  +RGL
Sbjct  312  SPAQMGVTMKRVMQERGL  329



>ref|XP_001416813.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95106.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=344

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV+Q T   LGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGI++IGEIGGTAEE
Sbjct  206  LTYEAVYQTTVAGLGQSTCVGIGGDPFNGTNFVDCLEKFVKDPQTEGIIMIGEIGGTAEE  265

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA FI+ SGTEKP+V+FIAGLTAPPGRRMGHAGAI+SGGKG+A DKI  L+  GV V +
Sbjct  266  EAAEFIRASGTEKPIVSFIAGLTAPPGRRMGHAGAIISGGKGSAGDKIAALERVGVRVVK  325

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAK+G  M ++F +R +L
Sbjct  326  SPAKMGQAMYEMFGERNML  344



>ref|XP_008889195.1| succinyl-CoA-synthetase alpha SCSA [Hammondia hammondi]
 gb|KEP60333.1| succinyl-CoA-synthetase alpha SCSA [Hammondia hammondi]
Length=333

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+AEE
Sbjct  194  LTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGSAEE  253

Query  548  eaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAAA++KE   E KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV V 
Sbjct  254  EAAAWLKEHNKERKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVV  313

Query  371  ESPAKLGTTMLDVFTKRGL  315
             +PA +G  ML+V    GL
Sbjct  314  RNPAAMGQKMLEVMQAAGL  332



>ref|XP_002368454.1| succinyl-CoA ligase alpha subunit, putative [Toxoplasma gondii 
ME49]
 gb|EPR59792.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii GT1]
 gb|EPT28025.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii ME49]
 gb|ESS33942.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii VEG]
 gb|KFG27848.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii p89]
 gb|KFG42366.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG53411.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii FOU]
 gb|KFG62784.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii RUB]
 gb|KFH09138.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii VAND]
Length=333

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+AEE
Sbjct  194  LTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGSAEE  253

Query  548  eaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAAA++KE   E KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV V 
Sbjct  254  EAAAWLKEHNKEQKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVV  313

Query  371  ESPAKLGTTMLDVFTKRGL  315
             +PA +G  ML+V    GL
Sbjct  314  RNPAAMGQKMLEVMQAAGL  332



>ref|XP_003881225.1| 2-oxoglutarate dehydrogenase E1 component,related [Neospora caninum 
Liverpool]
 emb|CBZ51192.1| 2-oxoglutarate dehydrogenase E1 component,related [Neospora caninum 
Liverpool]
Length=361

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+AEE
Sbjct  222  LTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGSAEE  281

Query  548  eaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAAA++KE   E KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV V 
Sbjct  282  EAAAWLKEHNKEQKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVV  341

Query  371  ESPAKLGTTMLDVFTKRGL  315
             +PA +G  ML+V    GL
Sbjct  342  RNPAAMGQKMLEVMQAAGL  360



>ref|XP_002610474.1| hypothetical protein BRAFLDRAFT_124275 [Branchiostoma floridae]
 gb|EEN66484.1| hypothetical protein BRAFLDRAFT_124275 [Branchiostoma floridae]
Length=323

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 114/141 (81%), Gaps = 3/141 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQ+ C+GIGGDPFNGTNFVDCLE F+ DP T+GIV+IGEIGG+ EE
Sbjct  183  LTYEAVHQTTRAGLGQTLCIGIGGDPFNGTNFVDCLEVFLGDPATKGIVMIGEIGGSMEE  242

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
             AA ++KE  T   +KPVV+FIAG+TAPPGRRMGHAGAI+SGGKG AQDKI+ L+EAGV 
Sbjct  243  SAAEYLKEHNTGPNKKPVVSFIAGVTAPPGRRMGHAGAIISGGKGAAQDKIQALQEAGVE  302

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V  SPA++GTTML    K GL
Sbjct  303  VTMSPAQMGTTMLQEMQKLGL  323



>emb|CBJ28950.1| Succinate--CoA ligase (GDP-forming), alpha subunit [Ectocarpus 
siliculosus]
Length=322

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV+Q T   +GQSTCVGIGGDPFNGTNF+DCLERF  DP+TEGIV+IGEIGG AEE
Sbjct  182  LTYEAVWQTTVTGMGQSTCVGIGGDPFNGTNFIDCLERFTKDPETEGIVMIGEIGGQAEE  241

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            +AA ++ E G   KPVV+FIAG TAPPGRRMGHAGAI+SGGKGTA  K   L++AGV + 
Sbjct  242  DAAEWLMEHGDPAKPVVSFIAGSTAPPGRRMGHAGAIISGGKGTAAAKFAALEDAGVYIS  301

Query  371  ESPAKLGTTMLDVFTKRGL  315
             SPA+LG+TM+  F +RG+
Sbjct  302  RSPAQLGSTMVRAFEERGM  320



>gb|ABE76513.1| mitochondrial putative GDP-forming succinate-CoA ligase alpha 
subunit [Toxoplasma gondii]
Length=333

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+AEE
Sbjct  194  LTYEAVNQTTQTGLGQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGSAEE  253

Query  548  eaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAAA++KE   E KPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV V 
Sbjct  254  EAAAWLKEHNKEQKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVV  313

Query  371  ESPAKLGTTMLDVF  330
             +PA +G  ML+V 
Sbjct  314  RNPAAMGQKMLEVM  327



>ref|WP_038538362.1| MULTISPECIES: succinate--CoA ligase [unclassified Holosporaceae]
 gb|AIF80946.1| succinyl-CoA synthetase subunit alpha [endosymbiont of Acanthamoeba 
sp. UWC8]
 gb|KIE05138.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [endosymbiont 
of Acanthamoeba sp. UWC36]
Length=292

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVD LE FV D +TE I++IGEIGGTAE 
Sbjct  157  LTYEAVAQTTAVNLGQSTCVGIGGDPVNGTNFVDVLELFVKDEETEAIIMIGEIGGTAEV  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            + A FIKES T+KPVV FIAG+TAPPG+RMGHAGAIVSGG+ TA+ KI  +K AG+ V E
Sbjct  217  DGANFIKESKTKKPVVGFIAGITAPPGKRMGHAGAIVSGGQDTAESKIEAMKSAGIFVSE  276

Query  368  SPAKLGTTMLDVFTKR  321
            SPA LGTTMLD    +
Sbjct  277  SPASLGTTMLDALKSK  292



>dbj|GAM28077.1| hypothetical protein SAMD00019534_112530 [Acytostelium subglobosum 
LB1]
Length=320

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG AEE
Sbjct  184  LTYEAVAQTTAVGLGQSTCVGIGGDPFNGTNFVDCLKLFTQDPQTEGIILIGEIGGEAEE  243

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA +++++ T KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG A  K++ L++AGV +  
Sbjct  244  EAAQWLRDNPTNKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGADSKMKALQDAGVVMSL  303

Query  368  SPAKLGTTMLDVFTKR  321
            SPAKLGTTML+V   R
Sbjct  304  SPAKLGTTMLEVMNSR  319



>gb|EFA80958.1| Endo-beta-N-acetylglucosaminidase [Polysphondylium pallidum PN500]
Length=1362

 Score =   177 bits (448),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG AEE
Sbjct  183  LTYEAVAQTTAVGLGQSTCVGIGGDPFNGTNFVDCLKLFTKDPQTEGIILIGEIGGEAEE  242

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA +++E+ T+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG A  K++ L++AGV +  
Sbjct  243  EAAQWLRENPTDKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGADSKMKALQDAGVIMSL  302

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAKLGTTML+   +R   
Sbjct  303  SPAKLGTTMLEAMNRRNFF  321



>ref|XP_004351803.1| succinate-CoA ligase [Dictyostelium fasciculatum]
 gb|EGG15083.1| succinate-CoA ligase [Dictyostelium fasciculatum]
Length=320

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG AEE
Sbjct  182  LTYEAVAQTTAVGLGQSTCVGIGGDPFNGTNFVDCLKLFTKDPQTEGIILIGEIGGEAEE  241

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA ++KE+ T+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG A  K++ L++AGV +  
Sbjct  242  EAALWLKENPTDKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGADSKMKALQDAGVIMSL  301

Query  368  SPAKLGTTMLDVFTKRG  318
            SPAKLG TML+   K G
Sbjct  302  SPAKLGVTMLEAMKKIG  318



>ref|WP_014363954.1| succinyl-CoA synthetase subsunit alpha [Rickettsia canadensis]
 gb|AFB21145.1| succinyl-CoA synthetase subunit alpha [Rickettsia canadensis 
str. CA410]
Length=292

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +A+ FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AG+T+  
Sbjct  217  DASDFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGITITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_028099766.1| succinate--CoA ligase [Dongia sp. URHE0060]
Length=291

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNFVDCL+ F+ DP+T+GIV+IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFVDCLDLFLGDPETQGIVMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A DKI  +K AG++V E
Sbjct  217  EAATFLKASKVKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGGAGDKIEAMKSAGISVAE  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA LG+ M+    K
Sbjct  277  SPASLGSAMVKAMGK  291



>ref|WP_040257675.1| MULTISPECIES: succinate--CoA ligase [spotted fever group]
 gb|KIJ89270.1| succinate--CoA ligase [Candidatus Rickettsia asemboensis]
Length=292

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>emb|CCQ75435.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Magnetospira 
sp. QH-2]
Length=291

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQSTC+GIGGDP NGTNF+DCL+ F+ADP+T+GIV+IGEIGG+AEE
Sbjct  157  LTYEAVAQTTTAGLGQSTCIGIGGDPVNGTNFIDCLDLFLADPETQGIVMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S T+KPVV FIAG+TAPPG+RMGHAGAI+SGGKGTA  KI  ++ AG+ V +
Sbjct  217  DAAEFIKQSKTKKPVVGFIAGVTAPPGKRMGHAGAIISGGKGTADAKIEAMRSAGIEVAD  276

Query  368  SPAKLGTTML  339
            SPA LG+TML
Sbjct  277  SPAALGSTML  286



>ref|WP_014014291.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [spotted 
fever group]
 gb|AEK74640.1| succinyl-CoA synthetase subunit alpha [Rickettsia heilongjiangensis 
054]
 dbj|BAK96677.1| succinyl-CoA synthetase alpha subunit [Rickettsia japonica YH]
Length=292

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ GG G+A+DK+ TL+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGGTGSAEDKLETLQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|XP_001425910.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK58512.1| unnamed protein product [Paramecium tetraurelia]
Length=312

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQST VGIGGDPFNGTNF+D LERF+ DP+TEGIV+IGEIGG  EE
Sbjct  173  LTYEAVDQTTRAGLGQSTVVGIGGDPFNGTNFIDVLERFMVDPETEGIVMIGEIGGENEE  232

Query  548  eaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
             AA +IK++  + KPVV FIAG+TAPP RRMGHAGAIVS GKG+A +KIR L++AG+ V 
Sbjct  233  MAAEWIKQNNPKNKPVVGFIAGITAPPERRMGHAGAIVSKGKGSAPEKIRALEQAGIRVV  292

Query  371  ESPAKLGTTMLDVFTKRGL  315
            +SPA++G TML+V  +RGL
Sbjct  293  KSPAQIGKTMLEVMKERGL  311



>ref|WP_017443052.1| succinyl-CoA synthetase subsunit alpha [Candidatus Rickettsia 
gravesii]
Length=292

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG G+A+DK+  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGTGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|XP_005837665.1| hypothetical protein GUITHDRAFT_157241 [Guillardia theta CCMP2712]
 gb|EKX50685.1| hypothetical protein GUITHDRAFT_157241 [Guillardia theta CCMP2712]
Length=297

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV+Q T + LGQS  VGIGGDPFNGT+  DC+E F+ DP TEGIVLIGEIGG++EE
Sbjct  162  LTYEAVYQTTQMGLGQSIVVGIGGDPFNGTSHKDCVEFFLQDPDTEGIVLIGEIGGSSEE  221

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA  +K S  +KP V+FIAGLTAPPGRRMGHAGAI+SGGKGTAQDKI+ L+ AGV V  
Sbjct  222  EAAEVMKNSKIKKPAVSFIAGLTAPPGRRMGHAGAIISGGKGTAQDKIKALESAGVYVTN  281

Query  368  SPAKLGTTMLDVFTK  324
            SPAK+G TM+    K
Sbjct  282  SPAKIGETMMKAMGK  296



>ref|WP_014392217.1| succinyl-CoA synthetase subsunit alpha [Candidatus Rickettsia 
amblyommii]
 gb|AFC69698.1| succinyl-CoA synthetase subunit alpha [Candidatus Rickettsia 
amblyommii str. GAT-30V]
Length=292

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG G+A+DK+  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIITGGTGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_012152767.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [spotted 
fever group]
 gb|ABV84792.1| Succinyl-CoA synthetase alpha chain [Rickettsia massiliae MTU5]
 gb|AFB31772.1| succinyl-CoA synthetase subunit alpha [Rickettsia massiliae str. 
AZT80]
 gb|AFC72363.1| succinyl-CoA synthetase subunit alpha [Rickettsia rhipicephali 
str. 3-7-female6-CWPP]
Length=292

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG G+A+DK+  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGTGSAKDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_032138585.1| succinate--CoA ligase [Rickettsia tamurae]
Length=292

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP N TNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNDTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_008579810.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [Rickettsia]
 gb|EER21581.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia endosymbiont 
of Ixodes scapularis]
 gb|KDO03309.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia sp. 
ISO7]
Length=292

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP N TNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNDTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_012148768.1| succinyl-CoA synthetase subsunit alpha [Rickettsia canadensis]
 gb|ABV73572.1| succinyl-CoA synthetase alpha subunit [Rickettsia canadensis 
str. McKiel]
Length=292

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +A+ FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AG+T+  
Sbjct  217  DASDFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGITITR  276

Query  368  SPAKLGTTMLDVFTK  324
             PA +G TMLD+  K
Sbjct  277  CPADIGKTMLDLLNK  291



>ref|WP_039594975.1| succinate--CoA ligase [Rickettsia felis]
 gb|KHO03566.1| succinate--CoA ligase [Rickettsia felis]
Length=292

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TM D+  K
Sbjct  277  SPADIGKTMFDLLNK  291



>ref|WP_011270994.1| succinyl-CoA synthetase subsunit alpha [Rickettsia felis]
 sp|Q4ULQ8.1|SUCD_RICFE RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia felis URRWXCal2]
 gb|AAY61515.1| Succinyl-CoA synthetase alpha chain [Rickettsia felis URRWXCal2]
 gb|KHO02928.1| succinate--CoA ligase [Rickettsia felis str. LSU]
Length=292

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TM D+  K
Sbjct  277  SPADIGKTMFDLLNK  291



>ref|XP_008871215.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces invadans]
 gb|ETW00190.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces invadans]
Length=312

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 114/137 (83%), Gaps = 1/137 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGGTAEE
Sbjct  173  LTYEAVHQTTTTGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGTAEE  232

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++ E G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L++AGVTV 
Sbjct  233  EAAEWLMEHGDPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEKAGVTVT  292

Query  371  ESPAKLGTTMLDVFTKR  321
             SPA+LGTTML  F KR
Sbjct  293  RSPARLGTTMLQQFAKR  309



>ref|WP_014409142.1| succinyl-CoA synthetase subsunit alpha [Rickettsia montanensis]
 emb|CAC33597.1| Succinyl-CoA synthetase alpha subunit [Rickettsia montanensis]
 gb|AFC72998.1| succinyl-CoA synthetase subunit alpha [Rickettsia montanensis 
str. OSU 85-930]
Length=292

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTTVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG G+A+DKI  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGTGSAEDKIEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>gb|ACC73801.1| succinyl-CoA synthetase, alpha subunit [Burkholderia phymatum 
STM815]
Length=278

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQ+TC+GIGGDP NGTNF+DCLE F+AD +TEG+++IGEIGG+AEE
Sbjct  145  LTYEAVAQTTAAGLGQTTCIGIGGDPVNGTNFIDCLEMFLADDETEGVIMIGEIGGSAEE  204

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA F+K+S T KPVV FIAG +APPGRRMGHAGAI+SGGKGTA  KI  ++ AG+ V +
Sbjct  205  DAAQFLKDSRTNKPVVGFIAGTSAPPGRRMGHAGAIISGGKGTAGAKIDAMRSAGIHVAQ  264

Query  368  SPAKLGTTMLDVF  330
            SPA LG TML  F
Sbjct  265  SPAALGETMLKAF  277



>ref|WP_012151579.1| succinyl-CoA synthetase subsunit alpha [Rickettsia bellii]
 gb|ABV78618.1| succinyl-CoA synthetase subunit alpha [Rickettsia bellii OSU 
85-389]
Length=291

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPINGTNFVDCIDMFLQDDETKAIIMIGEIGGDAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
             AA FIK S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  
Sbjct  217  NAADFIKHSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFT  327
            SPA +G TMLD+  
Sbjct  277  SPADIGKTMLDLLN  290



>ref|WP_012149562.1| succinyl-CoA synthetase subsunit alpha [Rickettsia akari]
 gb|ABV74929.1| succinyl-CoA synthetase subunit alpha [Rickettsia akari str. 
Hartford]
Length=292

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG+G+A+DK+  L+ AGVT+ +
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGQGSAEDKLEVLQSAGVTITK  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TM D+  K
Sbjct  277  SPADIGKTMFDLLNK  291



>gb|ELU05339.1| hypothetical protein CAPTEDRAFT_170724 [Capitella teleta]
Length=334

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q + V LGQ+ CVGIGGDPFNGTNF+DCL+ F+ DP+TEGIVLIGEIGG AEE
Sbjct  193  LTYEAVHQTSLVGLGQTVCVGIGGDPFNGTNFIDCLDVFLKDPETEGIVLIGEIGGQAEE  252

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
             AA F+KE  +    KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG AQ+KI  L+ AGV 
Sbjct  253  RAADFLKEHNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGAQEKIAALENAGVL  312

Query  377  VCESPAKLGTTMLDVFTKRG  318
            V  SPA++G+TML      G
Sbjct  313  VTRSPAQMGSTMLKAMQDAG  332



>ref|WP_008519360.1| succinyl-CoA synthetase subsunit alpha [alpha proteobacterium 
IMCC14465]
 gb|EJW21264.1| hypothetical protein IMCC14465_10600 [alpha proteobacterium IMCC14465]
Length=291

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNF+DCLE F+ D QTE I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLELFLGDEQTESIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DK+  ++ AG+TV  
Sbjct  217  EAAEFLKSSAVKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGGAEDKMEAMRSAGITVSP  276

Query  368  SPAKLGTTMLDVFT  327
            SPA LGTT+  +  
Sbjct  277  SPAALGTTLSQILN  290



>ref|WP_021777427.1| 3-oxoacyl-Acyl-carrier protein reductase [alpha proteobacterium 
RS24]
 gb|ERL46449.1| 3-oxoacyl-Acyl-carrier protein reductase [alpha proteobacterium 
RS24]
Length=291

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNF+DCLE F+ D QTE I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLELFLGDDQTESIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DK+  ++ AG+TV  
Sbjct  217  EAAEFLKSSSVKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGGAEDKMEAMRSAGITVSP  276

Query  368  SPAKLGTTMLDVFT  327
            SPA LGTT+  +  
Sbjct  277  SPAALGTTLSQILN  290



>ref|WP_012110353.1| succinyl-CoA synthetase subsunit alpha [Parvibaculum lavamentivorans]
 gb|ABS63073.1| succinyl-CoA synthetase, alpha subunit [Parvibaculum lavamentivorans 
DS-1]
Length=291

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNF+DCLE F+ DP T  I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLEMFLGDPDTTSIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA F+K S  +KP+V FIAG+TAPPGRRMGHAGAI+SGGKG A+DK+  ++ AG+TV +
Sbjct  217  DAAEFLKASKVKKPIVGFIAGVTAPPGRRMGHAGAIISGGKGGAEDKMEAMRSAGITVAK  276

Query  368  SPAKLGTTMLDVF  330
            SP+ LGTT+++V 
Sbjct  277  SPSALGTTLVEVL  289



>ref|WP_011477883.1| succinyl-CoA synthetase subsunit alpha [Rickettsia bellii]
 sp|Q1RH56.1|SUCD_RICBR RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia bellii RML369-C]
 gb|ABE05308.1| Succinyl-CoA synthetase alpha chain [Rickettsia bellii RML369-C]
Length=291

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLQDDETKAIIMIGEIGGDAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
             AA FIK S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  
Sbjct  217  NAADFIKHSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFT  327
            SPA +G TMLD+  
Sbjct  277  SPADIGKTMLDLLN  290



>ref|XP_001452638.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK85241.1| unnamed protein product [Paramecium tetraurelia]
Length=312

 Score =   163 bits (413),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQST VGIGGDPFNGTNF+D LERF+ DP+TEGIV+IGEIGG  EE
Sbjct  173  LTYEAVDQTTRAGLGQSTVVGIGGDPFNGTNFIDVLERFMVDPETEGIVMIGEIGGENEE  232

Query  548  eaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
             AA +IK++  + KPVV FIAG+TAPP RRMGHAGAIVS GKG+A +KIR L++AG+ V 
Sbjct  233  MAADWIKKNNPKNKPVVGFIAGITAPPERRMGHAGAIVSKGKGSAPEKIRALEQAGIRVV  292

Query  371  ESPAKLGTTMLDVFTKRGL  315
            +SPA++G TML+V  ++GL
Sbjct  293  KSPAQIGKTMLEVMKEKGL  311



>ref|XP_786544.2| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like [Strongylocentrotus purpuratus]
Length=326

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 113/140 (81%), Gaps = 3/140 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQ+ CVGIGGDPFNGTNFVDCLE F+ DP TEGIVLIGEIGG AEE
Sbjct  185  LTYEAVAQTTAVGLGQTLCVGIGGDPFNGTNFVDCLEIFLNDPATEGIVLIGEIGGGAEE  244

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            +AA F+K+  +    KPV AFIAGLTAPPGRRMGHAGAI+SGGKG A +KI+ LK+AGV 
Sbjct  245  KAAEFLKQHNSGPDAKPVAAFIAGLTAPPGRRMGHAGAIISGGKGGATEKIQALKDAGVV  304

Query  377  VCESPAKLGTTMLDVFTKRG  318
            V  SPA++GTT+L    K G
Sbjct  305  VTMSPAQMGTTILKEMEKIG  324



>ref|WP_027287415.1| succinate--CoA ligase [Rhodovibrio salinarum]
Length=291

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNFVDC++ F+ D +TEGIV+IGEIGGTAEE
Sbjct  157  LTYEAVSQTTAAGLGQSTCIGIGGDPVNGTNFVDCIDMFLKDDETEGIVMIGEIGGTAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K+S  +KP V FIAGLTAPPGRRMGHAGAI+SGGKG A+DKI  +++AG+ V +
Sbjct  217  EAAEFLKQSSVKKPTVGFIAGLTAPPGRRMGHAGAIISGGKGGAEDKIAAMRDAGIHVAD  276

Query  368  SPAKLGTTMLDVF  330
            SPA +G+TM+   
Sbjct  277  SPASIGSTMVKAL  289



>ref|XP_002160938.2| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Hydra vulgaris]
Length=332

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 104/136 (76%), Gaps = 3/136 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigei--ggta  555
            LTYEAV Q + V LGQS CVGIGGDPFNGTNF+DCLE F+ DP+T+G+++IGEI      
Sbjct  185  LTYEAVHQTSTVGLGQSLCVGIGGDPFNGTNFIDCLEVFLKDPETKGMIMIGEIGGAAEE  244

Query  554  eeeaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
                      SG  +KP+V FIAGLTAPPGRRMGHAGAI+SGGKG A+DKI+ L+EAGVT
Sbjct  245  RAAEYLLKYNSGPNKKPIVGFIAGLTAPPGRRMGHAGAIISGGKGGAEDKIKALEEAGVT  304

Query  377  VCESPAKLGTTMLDVF  330
            V  SPA++GTT+  VF
Sbjct  305  VTRSPAQMGTTLRTVF  320



>ref|XP_001442597.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK75200.1| unnamed protein product [Paramecium tetraurelia]
Length=337

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQST VGIGGDPFNGTNF+D LERF+ DP+TEGIV+IGEIGG  EE
Sbjct  198  LTYEAVDQTTRAGLGQSTVVGIGGDPFNGTNFIDVLERFMVDPETEGIVMIGEIGGENEE  257

Query  548  eaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
             AA +IK++  + KPVV FIAG+TAPP RRMGHAGAIVS GKG+A +KIR L++AG+ V 
Sbjct  258  MAADWIKKNNPKNKPVVGFIAGITAPPERRMGHAGAIVSKGKGSAPEKIRALEQAGIRVV  317

Query  371  ESPAKLGTTMLDVFTKRGL  315
            +SPA++G TML+V  ++GL
Sbjct  318  KSPAQIGKTMLEVMKEKGL  336



>ref|WP_010423152.1| succinyl-CoA synthetase subsunit alpha [Rickettsia helvetica]
Length=292

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ +++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEIFLKDDETKAMIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++ GKG+A+DK+  L+ AGVT+  
Sbjct  217  DAADFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIITRGKGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>gb|ABW76150.1| succinyl-CoA synthetase alpha subunit [Blastocystis sp. NandII]
 gb|ABY62723.1| mitochondrial succinyl-CoA synthetase alpha subunit [Blastocystis 
sp. ATCC 50177]
Length=318

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQST VGIGGDPFNGTNF+DCLERF  DPQTEGIV+IGEIGGTAEE
Sbjct  179  LTYEAVHQTTMYGLGQSTVVGIGGDPFNGTNFIDCLERFTNDPQTEGIVMIGEIGGTAEE  238

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            +AA ++K+ G   KPVV+FIAG TAPPGRRMGHAGAI+SGGKGTA+ K+  L  AGV V 
Sbjct  239  DAAEWLKQYGNPNKPVVSFIAGRTAPPGRRMGHAGAIISGGKGTAKAKMEALTSAGVKVV  298

Query  371  ESPAKLGTTMLDVFTKRG  318
            E+PA +G  M ++    G
Sbjct  299  ETPAMIGEAMFNMMKAAG  316



>ref|WP_043950111.1| succinate--CoA ligase [Candidatus Phaeomarinobacter ectocarpi]
 emb|CDO59471.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Candidatus Phaeomarinobacter 
ectocarpi]
Length=291

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQ+TC+GIGGDP NGTNF+DCL+ F+ D +TE I++IGEIGG+AEE
Sbjct  157  LTYEAVGQTTAAGLGQTTCIGIGGDPVNGTNFIDCLDMFLGDDKTESIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA F+K+S T+KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A  KI  +K AG+TV  
Sbjct  217  DAAEFLKQSKTKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGDAASKIEAMKSAGITVSP  276

Query  368  SPAKLGTTMLDVF  330
            SPA LG+T++DV 
Sbjct  277  SPAALGSTLVDVL  289



>gb|KHJ84287.1| succinate-CoA ligase, alpha subunit, partial [Oesophagostomum 
dentatum]
Length=196

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 111/139 (80%), Gaps = 3/139 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQ+ CVGIGGDPFNGTNF+DCL  F+ DP T+G++LIGEIGG+AEE
Sbjct  52   LTYEAVHQTTQVGLGQTLCVGIGGDPFNGTNFIDCLSIFLEDPHTKGMILIGEIGGSAEE  111

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            EAA F+ E+ +    KPV AFIAGLTAPPGRRMGHAGAI+S GKGTA DKI+ LKEAGV 
Sbjct  112  EAAQFLVENNSGPNAKPVAAFIAGLTAPPGRRMGHAGAIISRGKGTATDKIKALKEAGVH  171

Query  377  VCESPAKLGTTMLDVFTKR  321
            V +SP+KLG T+     ++
Sbjct  172  VTDSPSKLGITIAKALLEK  190



>ref|XP_008608930.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Saprolegnia diclina VS20]
 gb|EQC37410.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Saprolegnia diclina VS20]
Length=312

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T+  LGQST +GIGGDPFNGT+F+DCLERF  DP+TEGI++IGEIGGTAEE
Sbjct  173  LTYEAVHQTTSTGLGQSTVIGIGGDPFNGTDFIDCLERFTNDPETEGIIMIGEIGGTAEE  232

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++KE G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L+ AGVTV 
Sbjct  233  EAAEWLKEFGNPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEGAGVTVT  292

Query  371  ESPAKLGTTMLDVFTKRGL  315
             SP++LGTTML    +RGL
Sbjct  293  RSPSRLGTTMLQQMARRGL  311



>gb|KDO21510.1| succinyl-CoA ligase subunit alpha [Saprolegnia parasitica CBS 
223.65]
Length=312

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T+  LGQST +GIGGDPFNGT+F+DCLERF  DP+TEGI++IGEIGGTAEE
Sbjct  173  LTYEAVHQTTSTGLGQSTVIGIGGDPFNGTDFIDCLERFTNDPETEGIIMIGEIGGTAEE  232

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++KE G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L+ AGVTV 
Sbjct  233  EAAEWLKEFGNPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEGAGVTVT  292

Query  371  ESPAKLGTTMLDVFTKRGL  315
             SP++LGTTML    +RGL
Sbjct  293  RSPSRLGTTMLQQMARRGL  311



>ref|WP_013181525.1| succinyl-CoA synthetase subunit alpha [Waddlia chondrophila]
 gb|ADI37797.1| Succinyl-CoA synthetase, alpha subunit [Waddlia chondrophila 
WSU 86-1044]
 emb|CCB91956.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Waddlia chondrophila 
2032/99]
Length=297

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 109/136 (80%), Gaps = 1/136 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV+Q T + LGQS+CVGIGGDP NGTNF+D LE F  DP+TEGI+LIGEIGG AEE
Sbjct  158  LTYEAVWQTTQLELGQSSCVGIGGDPLNGTNFIDVLELFENDPETEGILLIGEIGGDAEE  217

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA +I+E    KPV AF+AG TAPPGRRMGHAGAI+SG +GTAQ+KI  LK AGVTV E
Sbjct  218  QAAEWIRER-CSKPVAAFVAGQTAPPGRRMGHAGAIISGNQGTAQNKIEALKHAGVTVAE  276

Query  368  SPAKLGTTMLDVFTKR  321
            +PA LG  ML  F ++
Sbjct  277  TPADLGKAMLSAFNEK  292



>ref|XP_001007751.3| succinyl-CoA synthetase, alpha subunit family protein [Tetrahymena 
thermophila]
 gb|EAR87506.3| succinyl-CoA synthetase alpha subunit [Tetrahymena thermophila 
SB210]
Length=310

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 111/134 (83%), Gaps = 1/134 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQST VGIGGDPFNGTNF+D LERFV DP+TEGI+LIGEIGG AEE
Sbjct  172  LTYEAVDQTTKAGLGQSTVVGIGGDPFNGTNFIDVLERFVEDPETEGILLIGEIGGEAEE  231

Query  548  eaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            +AAA++K +  T KPVV+FIAG+TAPP RRMGHAGAIVSGGKG+A +KI+ L+ AG+ VC
Sbjct  232  QAAAWLKANNKTNKPVVSFIAGVTAPPERRMGHAGAIVSGGKGSATEKIKALESAGIKVC  291

Query  371  ESPAKLGTTMLDVF  330
             SPA LG  ML++ 
Sbjct  292  RSPATLGQEMLNLM  305



>ref|XP_003106288.1| hypothetical protein CRE_15309 [Caenorhabditis remanei]
 gb|EFO98230.1| hypothetical protein CRE_15309 [Caenorhabditis remanei]
Length=322

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 113/136 (83%), Gaps = 3/136 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V  GQ+ CVGIGGDPFNGTNF+DCL+ F+ DP+T+GI+LIGEIGG+AEE
Sbjct  183  LTYEAVHQTTQVGFGQTLCVGIGGDPFNGTNFIDCLQVFLEDPETKGIILIGEIGGSAEE  242

Query  548  eaaafIKESG---TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            EAA F+KE     T KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA DKI  L+EAGV 
Sbjct  243  EAAQFLKEHNSGKTRKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAADKINALREAGVI  302

Query  377  VCESPAKLGTTMLDVF  330
            V +SPAKLGT+M   F
Sbjct  303  VTDSPAKLGTSMATAF  318



>ref|WP_017972286.1| succinyl-CoA synthetase subsunit alpha [alpha proteobacterium 
SCGC AAA280-B11]
Length=291

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T + LGQSTC+GIGGDP NGTNF+DCLE F+ D +T+ I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTVLGLGQSTCIGIGGDPINGTNFIDCLELFLKDDETKSIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA FIK S T+KPV+ FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI T++  G+TV  
Sbjct  217  EAAEFIKSSKTKKPVIGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIETMRSCGITVAN  276

Query  368  SPAKLGTTMLD  336
            SPA +G T+ D
Sbjct  277  SPADIGKTLFD  287



>emb|CAP27541.2| Protein CBR-SUCL-1 [Caenorhabditis briggsae]
Length=322

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 113/136 (83%), Gaps = 3/136 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V  GQ+ CVGIGGDPFNGTNF+DCL  F+ DP+T+GI+LIGEIGG+AEE
Sbjct  183  LTYEAVHQTTQVGFGQTLCVGIGGDPFNGTNFIDCLHVFLEDPETKGIILIGEIGGSAEE  242

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            EAA F+K+  T   +KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA DKI  L+EAGV 
Sbjct  243  EAAQFLKDHNTGVNKKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAADKINALREAGVV  302

Query  377  VCESPAKLGTTMLDVF  330
            V +SPAKLGT+M   F
Sbjct  303  VTDSPAKLGTSMAKAF  318



>ref|XP_009524111.1| hypothetical protein PHYSODRAFT_557468 [Phytophthora sojae]
 gb|EGZ21394.1| hypothetical protein PHYSODRAFT_557468 [Phytophthora sojae]
Length=316

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA+ LGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+AEE
Sbjct  179  LTYEAVAQTTALGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGSAEE  238

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++   G   KPVV+FIAG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV V 
Sbjct  239  EAAEWLMAHGDPNKPVVSFIAGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGVAVT  298

Query  371  ESPAKLGTTMLDVFTKR  321
             SPA+LG T+ +   KR
Sbjct  299  RSPARLGATLFEEMKKR  315



>ref|WP_016916757.1| succinyl-CoA synthetase subsunit alpha [Rickettsia honei]
Length=292

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|NP_510450.1| Protein SUCL-1 [Caenorhabditis elegans]
 sp|P53596.1|SUCA_CAEEL RecName: Full=Probable succinyl-CoA ligase [ADP/GDP-forming] 
subunit alpha, mitochondrial; AltName: Full=Succinyl-CoA synthetase 
subunit alpha; Short=SCS-alpha; Flags: Precursor [Caenorhabditis 
elegans]
 emb|CAA94107.1| SUCL-1 [Caenorhabditis elegans]
Length=322

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 113/136 (83%), Gaps = 3/136 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V  GQ+ CVGIGGDPFNGTNF+DCL  F+ DP+T+GI+LIGEIGG+AEE
Sbjct  183  LTYEAVHQTTQVGFGQTLCVGIGGDPFNGTNFIDCLNVFLEDPETKGIILIGEIGGSAEE  242

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            EAAA++KE  +    KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA DKI  L+EAGV 
Sbjct  243  EAAAYLKEHNSGANRKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAADKINALREAGVV  302

Query  377  VCESPAKLGTTMLDVF  330
            V +SPAKLGT+M   F
Sbjct  303  VTDSPAKLGTSMATAF  318



>ref|XP_636263.1| succinate-CoA ligase [Dictyostelium discoideum AX4]
 sp|P36967.3|SUCA_DICDI RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha; Short=SCS-alpha; AltName: Full=p36; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL62749.1| succinate-CoA ligase [Dictyostelium discoideum AX4]
Length=315

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTC+GIGGDPFNGTNF+DCL+ F  DPQTEGI+LIGEIGG AEE
Sbjct  177  LTYEAVAQTTAVGLGQSTCIGIGGDPFNGTNFIDCLKMFTQDPQTEGIILIGEIGGEAEE  236

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA ++ ++ T+KPVV+FIAGL+APPGRRMGHAGAI+SGGKG A  KI  LK AGVTV  
Sbjct  237  EAAQWLIDNPTDKPVVSFIAGLSAPPGRRMGHAGAIISGGKGDANSKIEALKAAGVTVTF  296

Query  368  SPAKLGTTMLDVFTKR  321
            SPAKLG T+L    ++
Sbjct  297  SPAKLGETILQKMNEK  312



>ref|XP_002645849.1| Hypothetical protein CBG07585 [Caenorhabditis briggsae]
Length=344

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 113/136 (83%), Gaps = 3/136 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V  GQ+ CVGIGGDPFNGTNF+DCL  F+ DP+T+GI+LIGEIGG+AEE
Sbjct  205  LTYEAVHQTTQVGFGQTLCVGIGGDPFNGTNFIDCLHVFLEDPETKGIILIGEIGGSAEE  264

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            EAA F+K+  T   +KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA DKI  L+EAGV 
Sbjct  265  EAAQFLKDHNTGVNKKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAADKINALREAGVV  324

Query  377  VCESPAKLGTTMLDVF  330
            V +SPAKLGT+M   F
Sbjct  325  VTDSPAKLGTSMAKAF  340



>ref|XP_008905429.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica INRA-310]
 gb|ETI47142.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P1569]
 gb|ETK87077.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETL40492.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETL93622.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETM46890.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETN09596.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica INRA-310]
 gb|ETO75838.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P1976]
 gb|ETP16936.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica CJ01A1]
Length=318

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA+ LGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+AEE
Sbjct  181  LTYEAVAQTTALGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGSAEE  240

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++   G   KPVV+FIAG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV V 
Sbjct  241  EAAEWLMAHGDPNKPVVSFIAGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGVAVT  300

Query  371  ESPAKLGTTMLDVFTKR  321
             SPA+LG T+ +   KR
Sbjct  301  RSPARLGVTLYEEMQKR  317



>gb|ETP44985.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P10297]
Length=318

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA+ LGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+AEE
Sbjct  181  LTYEAVAQTTALGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGSAEE  240

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++   G   KPVV+FIAG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV V 
Sbjct  241  EAAEWLMAHGDPNKPVVSFIAGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGVAVT  300

Query  371  ESPAKLGTTMLDVFTKR  321
             SPA+LG T+ +   KR
Sbjct  301  RSPARLGVTLYEEMQKR  317



>ref|XP_006675876.1| hypothetical protein BATDEDRAFT_36456 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83302.1| hypothetical protein BATDEDRAFT_36456 [Batrachochytrium dendrobatidis 
JAM81]
Length=342

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 110/137 (80%), Gaps = 4/137 (3%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQ+ CVGIGGDPFNGTNFVDCL+ F+ADP+TEGIVLIGEIGG+AEE
Sbjct  199  LTYEAVAQTTAAGLGQTLCVGIGGDPFNGTNFVDCLKVFLADPETEGIVLIGEIGGSAEE  258

Query  548  eaaafIKESGTE----KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  381
            +AA ++ +        KPVV+FIAGL+APPGRRMGHAGAI+SGGKG A+DK+  L+ AGV
Sbjct  259  DAAEYLMQHNMSRSNPKPVVSFIAGLSAPPGRRMGHAGAIISGGKGKAEDKVAALQRAGV  318

Query  380  TVCESPAKLGTTMLDVF  330
             V +SPAKLG  M   F
Sbjct  319  IVSQSPAKLGYYMKKAF  335



>ref|WP_029167294.1| succinate--CoA ligase [alpha proteobacterium SCGC AAA028-C07]
Length=291

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA+ LGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTALGLGQSTCIGIGGDPINGTNFIDCLDLFLKDDETKSIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            E A FIK S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI T+K  G+TV  
Sbjct  217  EGAEFIKSSKIKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIETMKSCGITVAN  276

Query  368  SPAKLGTTMLD  336
            SPA +G T+ D
Sbjct  277  SPADIGKTLFD  287



>ref|WP_017943586.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [unclassified 
Alphaproteobacteria (miscellaneous)]
Length=291

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA+ LGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTALGLGQSTCIGIGGDPINGTNFIDCLDLFLKDDETKSIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            E A FIK S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI T+K  G+TV  
Sbjct  217  EGAEFIKSSKIKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIETMKSCGITVAN  276

Query  368  SPAKLGTTMLD  336
            SPA +G T+ D
Sbjct  277  SPADIGKTLFD  287



>ref|WP_017970841.1| succinyl-CoA synthetase subsunit alpha [alpha proteobacterium 
SCGC AAA027-J10]
Length=291

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA+ LGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTALGLGQSTCIGIGGDPINGTNFIDCLDLFLKDDETKSIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            E A FIK S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI T+K  G+TV  
Sbjct  217  EGAEFIKSSKIKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIETMKSCGITVAN  276

Query  368  SPAKLGTTMLD  336
            SPA +G T+ D
Sbjct  277  SPADIGKTLFD  287



>ref|XP_002908607.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor [Phytophthora 
infestans T30-4]
 gb|EEY61690.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor [Phytophthora 
infestans T30-4]
Length=339

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA+ LGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+AEE
Sbjct  202  LTYEAVAQTTALGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGSAEE  261

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++   G   KPVV+FIAG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV V 
Sbjct  262  EAAEWLMAHGDPNKPVVSFIAGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGVAVT  321

Query  371  ESPAKLGTTMLDVFTKR  321
             SPA+LG T+ +   KR
Sbjct  322  RSPARLGVTLYEEMQKR  338



>gb|AEV92218.1| Succinyl-CoA synthetase alpha chain [Rickettsia slovaca 13-B]
Length=258

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  123  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  182

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  183  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITR  242

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  243  SPADIGKTMLDLLNK  257



>gb|AAA85724.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium discoideum 
AX2]
Length=310

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTC+GIGGDPFNGTNF+DCL+ F  DPQTEGI+LIGEIGG AEE
Sbjct  177  LTYEAVAQTTAVGLGQSTCIGIGGDPFNGTNFIDCLKMFTQDPQTEGIILIGEIGGEAEE  236

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA ++ ++ T+KPVV+FIAGL+APPGRRMGHAGAI+SGGKG A  KI  LK AGVTV  
Sbjct  237  EAAQWLIDNPTDKPVVSFIAGLSAPPGRRMGHAGAIISGGKGDANSKIEALKAAGVTVTF  296

Query  368  SPAKLGTTML  339
            SPAKLG T+L
Sbjct  297  SPAKLGETIL  306



>gb|EGT40414.1| hypothetical protein CAEBREN_13872 [Caenorhabditis brenneri]
Length=322

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 3/139 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV  GQ+ CVGIGGDPFNGTNF+DCL+ F+ D +T+GI+LIGEIGG+AEE
Sbjct  183  LTYEAVHQTTAVGFGQTLCVGIGGDPFNGTNFIDCLKVFLEDQETKGIILIGEIGGSAEE  242

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            EAAAF+KE  +    KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA DKI  L+EAGV 
Sbjct  243  EAAAFLKEHNSGKGRKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAADKINALREAGVV  302

Query  377  VCESPAKLGTTMLDVFTKR  321
            V +SPAKLGT+M   F ++
Sbjct  303  VTDSPAKLGTSMATAFLEQ  321



>ref|WP_025896902.1| succinate--CoA ligase [Sneathiella glossodoripedis]
Length=291

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNF+DCL+ F+ D +TE I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLDMFLHDDETESIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K+S  +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A DK+  ++ AG+TV +
Sbjct  217  EAAEFLKQSKIKKPVVGFIAGVTAPPGRRMGHAGAIISGGKGGADDKMEAMRSAGITVSD  276

Query  368  SPAKLGTTMLDVF  330
            SP+ LG+T++ V 
Sbjct  277  SPSALGSTLVRVL  289



>ref|WP_029374459.1| succinate--CoA ligase, partial [Rickettsia conorii]
Length=258

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTC+GIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  123  LTYEAVAQTTAVGLGQSTCIGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  182

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  183  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITR  242

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  243  SPADIGKTMLDLLNK  257



>ref|WP_014746522.1| succinyl-CoA synthetase subsunit alpha [Tistrella mobilis]
 gb|AFK54845.1| Succinyl-CoA synthetase alpha chain [Tistrella mobilis KA081020-065]
Length=291

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNF+D L+ F+ DP+TE I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCIGIGGDPINGTNFIDALDLFLKDPETEAIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA F+K+S  +KP V FIAG TAPPGRRMGHAGAI+SGGKG A DK+  ++ AG+ + E
Sbjct  217  DAAEFLKQSKVKKPTVGFIAGRTAPPGRRMGHAGAIISGGKGGADDKLEAMRSAGIVIAE  276

Query  368  SPAKLGTTMLDVF  330
            SPA LG+TM+ V 
Sbjct  277  SPAALGSTMVQVL  289



>ref|XP_004029838.1| succinyl-CoA synthetase, alpha subunit, putative [Ichthyophthirius 
multifiliis]
 gb|EGR28602.1| succinyl-CoA synthetase, alpha subunit, putative [Ichthyophthirius 
multifiliis]
Length=311

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQST VGIGGDPFNGTNF+D LERFV DP+T+GI++IGEIGG AEE
Sbjct  172  LTYEAVDQTTKAGLGQSTVVGIGGDPFNGTNFIDVLERFVHDPETKGIMMIGEIGGEAEE  231

Query  548  eaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            +AA ++KE  T+ KPVV+FIAG+TAPP RRMGHAGAIVSGGKG+A +KI+TL+  G+ V 
Sbjct  232  QAAYWLKEHNTQNKPVVSFIAGVTAPPERRMGHAGAIVSGGKGSAPEKIKTLESVGIKVS  291

Query  371  ESPAKLGTTMLDVFTKRGL  315
             SPA LG  ML      GL
Sbjct  292  RSPATLGEEMLKAMKAAGL  310



>ref|WP_027300105.1| succinate--CoA ligase [Rhodospirillales bacterium URHD0088]
Length=292

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNF+DCLE ++AD QT+GIV+IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLEMYLADEQTKGIVMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAAF++   T+KPVV FIAG TAPPGRRMGHAGAI+SGG G A+ K+  ++ AG+T+ +
Sbjct  217  DAAAFLRAHKTKKPVVGFIAGTTAPPGRRMGHAGAIISGGTGGAEHKLEAMRGAGITIAD  276

Query  368  SPAKLGTTML  339
            SPA LG+TML
Sbjct  277  SPASLGSTML  286



>ref|WP_014410679.1| succinyl-CoA synthetase subsunit alpha [Rickettsia parkeri]
 gb|AFC74794.1| succinyl-CoA synthetase subunit alpha [Rickettsia parkeri str. 
Portsmouth]
Length=292

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPANIGKTMLDLLNK  291



>ref|XP_009831202.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces astaci]
 gb|ETV79361.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces astaci]
Length=312

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 114/137 (83%), Gaps = 1/137 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T+  LGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGGTAEE
Sbjct  173  LTYEAVHQTTSTGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGTAEE  232

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++ E G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L++AGV V 
Sbjct  233  EAAEWLAEYGDPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEKAGVAVT  292

Query  371  ESPAKLGTTMLDVFTKR  321
             SPA+LGTTML  F KR
Sbjct  293  RSPARLGTTMLQQFAKR  309



>ref|WP_014412789.1| succinyl-CoA synthetase subsunit alpha [Rickettsia australis]
 gb|AFC71264.1| succinyl-CoA synthetase subunit alpha [Rickettsia australis str. 
Cutlack]
Length=292

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC++ F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GG+G+A+DK+  L+ A VT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGQGSAEDKLEALQSASVTITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G  M D+  K
Sbjct  277  SPADIGKAMFDLLNK  291



>ref|XP_003294260.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium purpureum]
 gb|EGC29214.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium purpureum]
Length=312

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTC+GIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG AEE
Sbjct  174  LTYEAVAQTTAVGLGQSTCIGIGGDPFNGTNFVDCLKMFTKDPQTEGIILIGEIGGEAEE  233

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA ++ ++ T+KPVV+FIAG +APPGRRMGHAGAI+SGGKG A  KI  LK AGVT+  
Sbjct  234  EAAQWLIDNPTDKPVVSFIAGTSAPPGRRMGHAGAIISGGKGDANSKINALKAAGVTISP  293

Query  368  SPAKLGTTMLD  336
            SPAKLG  ML+
Sbjct  294  SPAKLGEAMLE  304



>ref|WP_014364693.1| succinyl-CoA synthetase subsunit alpha [Rickettsia philipii]
 gb|AFB26233.1| succinyl-CoA synthetase subunit alpha [Rickettsia philipii str. 
364D]
Length=292

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVVITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_014419805.1| succinyl-CoA synthetase subsunit alpha [Rickettsia slovaca]
 gb|AFD19623.1| succinyl-CoA synthetase subunit alpha [Rickettsia slovaca str. 
D-CWPP]
Length=292

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_004995747.1| succinyl-CoA synthetase subsunit alpha [Rickettsia sibirica]
 gb|EAA25376.1| succinyl-CoA synthetase alpha chain [Rickettsia sibirica 246]
Length=292

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_023507834.1| Succinyl-CoA ligase [ADP-forming] subunit alpha, partial [Rickettsia 
monacensis]
 emb|CDI29578.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia monacensis 
IrR/Munich]
Length=256

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQSTCVGIGGDP N TNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  123  LTYEAVAQTTTVGLGQSTCVGIGGDPVNDTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  182

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  
Sbjct  183  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITR  242

Query  368  SPAKLGTTMLD  336
            SPA +G TML+
Sbjct  243  SPADIGKTMLE  253



>ref|WP_016770141.1| succinyl-CoA synthetase subsunit alpha [Rickettsia sibirica]
Length=292

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_016926237.1| succinyl-CoA synthetase subsunit alpha [Rickettsia conorii]
Length=292

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_011190880.1| succinyl-CoA synthetase subsunit alpha [Rickettsia typhi]
 sp|Q9AKE1.1|SUCD_RICTY RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia typhi str. Wilmington]
 emb|CAC33725.1| Succinyl-CoA synthetase alpha subunit [Rickettsia typhi]
 gb|AAU03896.1| Succinate thiokinase [Rickettsia typhi str. Wilmington]
 gb|AFE54277.1| succinyl-CoA synthetase subunit alpha [Rickettsia typhi str. 
TH1527]
 gb|AFE55117.1| succinyl-CoA synthetase subunit alpha [Rickettsia typhi str. 
B9991CWPP]
Length=292

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTC+GIGGDP NGT+FV+C+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCIGIGGDPVNGTSFVECIEMFLQDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAP  +RMGHAGAI+SGGKG+A+DK+  L+ AGVT+ +
Sbjct  217  DAADFIKQSKIKKPIVSFIAGITAPSDKRMGHAGAIISGGKGSAKDKLEALQSAGVTITK  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>emb|CDJ51788.1| succinyl-CoA ligase alpha subunit, putative [Eimeria brunetti]
Length=252

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 111/147 (76%), Gaps = 9/147 (6%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTE---------GIVLi  576
            LTYEAV Q T V LGQS CVGIGGDPFNGTNF+DCLERFVADP+T+         GIVLI
Sbjct  105  LTYEAVNQTTQVGLGQSICVGIGGDPFNGTNFIDCLERFVADPETKGRPACMQRSGIVLI  164

Query  575  geiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL  396
            GEIGG+AEEEAA ++K+    KPVV+FIAG +APPGRRMGHAGAIVSG  GTA  K++ L
Sbjct  165  GEIGGSAEEEAAEWLKKHNCGKPVVSFIAGSSAPPGRRMGHAGAIVSGNTGTAAGKVKAL  224

Query  395  KEAGVTVCESPAKLGTTMLDVFTKRGL  315
            + AGV V  +PAK+G  M     ++GL
Sbjct  225  EAAGVVVVNNPAKIGEAMYAAMKEKGL  251



>ref|XP_002507022.1| succinate-coa ligase [Micromonas sp. RCC299]
 gb|ACO68280.1| succinate-coa ligase [Micromonas sp. RCC299]
Length=326

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T V LGQSTCVGIGGDPFNGT+FVDCLERFV D +TEGI++IGEIGG AEE
Sbjct  188  LTYEAVFQTTQVGLGQSTCVGIGGDPFNGTDFVDCLERFVKDDETEGIIMIGEIGGNAEE  247

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK SGT KPVV+FIAGLTAPPGRRMGHAGAI++GGKG AQDKI  L+ AGVTV +
Sbjct  248  QAAEFIKASGTTKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAQDKINALESAGVTVVK  307

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPA++G  M D+F +R +L
Sbjct  308  SPAQMGNVMYDIFKERNML  326



>ref|WP_015508452.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2, partial [Rickettsia 
prowazekii]
 gb|AGJ01924.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2 [Rickettsia 
prowazekii str. NMRC Madrid E]
Length=258

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTCVGIGGDP NGT+FVDC+E F+ D +T+ I++IGEIGG+AEE
Sbjct  123  LTYEAVAQTTAAGLGQSTCVGIGGDPVNGTSFVDCIEMFLQDDETKAIIMIGEIGGSAEE  182

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAP  +RMGHAGAI+SGGKG+A+DK+  L+ AGV +  
Sbjct  183  DAADFIKQSKIKKPIVSFIAGITAPADKRMGHAGAIISGGKGSAEDKVEVLQSAGVIITR  242

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  243  SPADIGKTMLDLLNK  257



>ref|WP_010977229.1| succinyl-CoA synthetase subsunit alpha [Rickettsia conorii]
 sp|Q92I22.1|SUCD_RICCN RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia conorii str. Malish 7]
 gb|AAL03136.1| succinyl-CoA synthetase alpha chain [Rickettsia conorii str. 
Malish 7]
Length=292

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTC+GIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCIGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_012736402.1| succinyl-CoA synthetase subsunit alpha [Rickettsia peacockii]
 ref|YP_002916151.1| succinyl-CoA synthetase subunit alpha [Rickettsia peacockii str. 
Rustic]
 gb|ACR47103.1| succinyl-CoA synthetase subunit alpha [Rickettsia peacockii str. 
Rustic]
Length=292

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLDV  K
Sbjct  277  SPADIGKTMLDVEVK  291



>ref|WP_012150789.1| succinyl-CoA synthetase subsunit alpha [Rickettsia rickettsii]
 ref|YP_001649976.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Iowa]
 emb|CAC33660.1| Succinyl-CoA synthetase alpha subunit [Rickettsia rickettsii]
 gb|ABV76203.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. 'Sheila Smith']
 gb|ABY72570.1| succinyl-CoA synthetase alpha chain [Rickettsia rickettsii str. 
Iowa]
 gb|AFB22216.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Brazil]
 gb|AFB23550.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Colombia]
 gb|AFB24900.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Arizona]
 gb|AFB27584.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Hino]
 gb|AFB28875.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Hlp#2]
 gb|AFB30241.1| succinyl-CoA synthetase subunit alpha [Rickettsia rickettsii 
str. Hauke]
 gb|AJG33050.1| succinyl-CoA synthetase subsunit alpha [Rickettsia rickettsii 
str. R]
 gb|AJG34386.1| succinyl-CoA synthetase subsunit alpha [Rickettsia rickettsii 
str. Morgan]
Length=292

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ +++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAVIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVVITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|WP_028879580.1| succinate--CoA ligase [Terasakiella pusilla]
Length=290

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  +GQSTC+GIGGDP NGTNF+DCLE F+AD +TE IV+IGEIGGTAEE
Sbjct  157  LTYEAVAQTTAAGMGQSTCIGIGGDPVNGTNFIDCLEMFLADDETESIVMIGEIGGTAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EA  F+K+S  +KPVV FIAG+TAPPG+RMGHAGAI+SGG+GTA  K+  ++ AG+ V +
Sbjct  217  EACEFLKQSKVKKPVVGFIAGVTAPPGKRMGHAGAIISGGQGTADAKMEAMRSAGIAVAD  276

Query  368  SPAKLGTTMLDVF  330
            SPA +G+TM+ + 
Sbjct  277  SPASIGSTMVKLL  289



>ref|WP_014952624.1| succinyl-CoA synthetase subsunit alpha [alpha proteobacterium 
HIMB5]
 gb|AFS46791.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [alpha proteobacterium 
HIMB5]
Length=291

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQSTC+GIGGDP NGTNF+DCL+ F+ DP+T+ I++IGEIGGTAEE
Sbjct  157  LTYEAVAQTTVNGLGQSTCIGIGGDPINGTNFIDCLDLFLNDPETQSILMIGEIGGTAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA FIK    +KP+V FIAG+TAPPGRRMGHAGAI+SGGKG AQDKI+ ++E G+T+  
Sbjct  217  EAAEFIKNHKIKKPIVGFIAGITAPPGRRMGHAGAIISGGKGGAQDKIKKMEECGITMSN  276

Query  368  SPAKLGTTMLDVFTK  324
            SP+K+G T+ +  + 
Sbjct  277  SPSKIGETLFNKLSN  291



>gb|ETN68207.1| CoA-ligase [Necator americanus]
Length=160

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 110/136 (81%), Gaps = 3/136 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQ+ CVGIGGDPFNGTNF+DCL+ F+ DP T+GI+LIGEIGG AEE
Sbjct  20   LTYEAVHQTTLAGLGQTLCVGIGGDPFNGTNFIDCLDIFMKDPNTKGIILIGEIGGVAEE  79

Query  548  eaaafIKESGTE---KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            +AA FIK+  ++   KPVVAFIAGLTAPPGRRMGHAGAI++GGKGTA DKI  L+ AGV 
Sbjct  80   QAAQFIKDHNSKGQGKPVVAFIAGLTAPPGRRMGHAGAIIAGGKGTATDKIEALRAAGVH  139

Query  377  VCESPAKLGTTMLDVF  330
            V +SPA LG+TM  V 
Sbjct  140  VTDSPATLGSTMAQVL  155



>gb|KHN81599.1| putative succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Toxocara canis]
Length=377

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 108/132 (82%), Gaps = 3/132 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q + V LGQ+ C+GIGGDPFNGTNF+DCL  F+ DP+T GIVLIGEIGG  EE
Sbjct  177  LTYEAVQQTSDVGLGQTLCIGIGGDPFNGTNFIDCLHIFLNDPETHGIVLIGEIGGQDEE  236

Query  548  eaaafIKE--SGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            +AA F+KE   G+E KPVVAFIAG TAPPGRRMGHAGAI+SGGKGTAQ+KI  LKEAGV 
Sbjct  237  DAAEFLKEFNCGSESKPVVAFIAGRTAPPGRRMGHAGAIISGGKGTAQNKIEALKEAGVV  296

Query  377  VCESPAKLGTTM  342
            V +SPA +G  M
Sbjct  297  VSKSPAHMGALM  308



>emb|CEO17419.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia monacensis]
Length=290

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQSTCVGIGGDP N TNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTTVGLGQSTCVGIGGDPVNDTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITR  276

Query  368  SPAKLGTTMLD  336
            SPA +G TML+
Sbjct  277  SPADIGKTMLE  287



>emb|CCW71008.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=302

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQS CVGIGGDPFNGTN +DCL  F  DP+TEG++LIGEIGGTAEE
Sbjct  164  LTYEAVAQTTEVGLGQSLCVGIGGDPFNGTNMIDCLRFFFNDPETEGVILIGEIGGTAEE  223

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA FIK S  +KPVV+FIAG TAPPGRRMGHAGA+VSGG GTA  K+  LK AGVT+  
Sbjct  224  EAAEFIKNSPVKKPVVSFIAGATAPPGRRMGHAGAVVSGGMGTANGKMEALKAAGVTISH  283

Query  368  SPAKLGTTMLDVFTKR  321
            SP  LG  + DV   +
Sbjct  284  SPTLLGRHIFDVLNNK  299



>ref|XP_005717393.1| succinyl-CoA synthetase alpha chain [Chondrus crispus]
 emb|CDF37522.1| succinyl-CoA synthetase alpha chain [Chondrus crispus]
Length=311

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQS CVGIGGDPFNGT+F+DCL+ F+ D +T+GIV+IGEIGG AEE
Sbjct  173  LTYEAVHQTTAVGLGQSMCVGIGGDPFNGTDFIDCLDYFLQDEETKGIVMIGEIGGQAEE  232

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA F++    +KPVV+FIAG+TAPPGRRMGHAGAI++GGKGTA DKI  L+ AG TV +
Sbjct  233  QAADFLQGHPVKKPVVSFIAGITAPPGRRMGHAGAIIAGGKGTAADKIAALEAAGATVVQ  292

Query  368  SPAKLGTTMLDVFTKRGL  315
            SPA +G TM       GL
Sbjct  293  SPATMGVTMFAELQIAGL  310



>ref|WP_029016458.1| succinate--CoA ligase [alpha proteobacterium SCGC AAA028-D10]
Length=291

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA+ LGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTALGLGQSTCIGIGGDPINGTNFIDCLDLFLKDNETKSIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            E A FIK S  +KP+V FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI  +K  G+TV  
Sbjct  217  EGAEFIKSSKIKKPIVGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIEIMKSCGITVAN  276

Query  368  SPAKLGTTMLD  336
            SPA +G T+ D
Sbjct  277  SPADIGKTLFD  287



>ref|WP_029167879.1| succinate--CoA ligase [alpha proteobacterium SCGC AAA023-L09]
Length=291

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA+ LGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTALGLGQSTCIGIGGDPINGTNFIDCLDLFLKDDETKSIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            E A FIK S  +KP+V FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI  +K  G+TV  
Sbjct  217  EGAEFIKSSKIKKPIVGFIAGVTAPPGRRMGHAGAIISGGKGLAKDKIEIMKSCGITVAN  276

Query  368  SPAKLGTTMLD  336
            SPA +G T+ D
Sbjct  277  SPADIGKTLFD  287



>ref|WP_026071683.1| succinate--CoA ligase [Rickettsiaceae bacterium Os18]
Length=291

 Score =   158 bits (399),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQSTC+GIGGDP NGT+FVDCLE  +AD  T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTEVGLGQSTCIGIGGDPINGTSFVDCLELLLADKDTKAIIMIGEIGGVAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K S  +KPVV+FIAG+TAPPG+RMGHAGAI+ GGKG+A DK+  LK AGV + +
Sbjct  217  EAAEFMKLSKIKKPVVSFIAGITAPPGKRMGHAGAIIDGGKGSAADKLEALKSAGVHIAK  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA++G TM ++  K
Sbjct  277  SPAEIGVTMYNILNK  291



>gb|ACO12801.1| Succinyl-CoA ligase subunit alpha, mitochondrial precursor [Lepeophtheirus 
salmonis]
 gb|ADD38307.1| Succinyl-CoA ligase subunit alpha, mitochondrial [Lepeophtheirus 
salmonis]
Length=327

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 116/141 (82%), Gaps = 3/141 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQ+ C+GIGGDPFNGTNF+DCL+ F+ DP+T+GI++IGEIGG AEE
Sbjct  186  LTYEAVHQTTQVGLGQTLCIGIGGDPFNGTNFIDCLDIFLKDPKTKGIIMIGEIGGAAEE  245

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            +AA +++E  +   +KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTAQ KI  L+ AGV 
Sbjct  246  KAADYLQEHNSGANQKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAQTKIAALEAAGVA  305

Query  377  VCESPAKLGTTMLDVFTKRGL  315
            V  SPAK+GTT++ +  + GL
Sbjct  306  VTSSPAKMGTTLVQLMKESGL  326



>ref|XP_009038265.1| hypothetical protein AURANDRAFT_28269 [Aureococcus anophagefferens]
 gb|EGB07028.1| hypothetical protein AURANDRAFT_28269 [Aureococcus anophagefferens]
Length=310

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQSTCVGIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGG+AEE
Sbjct  166  LTYEAVHQTTVTGLGQSTCVGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGSAEE  225

Query  548  eaaafIKESGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++K  G  +KPVV FIAG TAPPGRRMGHAGAIVSGGKGTA  K    ++AGV + 
Sbjct  226  EAAEWLKAHGDPDKPVVGFIAGTTAPPGRRMGHAGAIVSGGKGTAAAKFAAFEDAGVFIS  285

Query  371  ESPAKLGTTMLDVFTKRG  318
             SPA+LG+TM+  F + G
Sbjct  286  RSPAQLGSTMIQAFKEHG  303



>ref|WP_004597642.1| succinyl-CoA synthetase subsunit alpha [Rickettsia prowazekii]
 ref|NP_220813.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. Madrid E]
 sp|O08371.1|SUCD_RICPR RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia prowazekii str. Madrid E]
 emb|CAA72446.1| succinyl-CoA synthetase alpha-subunit [Rickettsia prowazekii 
str. Madrid E]
 emb|CAA14889.1| SUCCINYL-COA LIGASE (sucD) [Rickettsia prowazekii str. Madrid 
E]
 gb|AFE52868.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. GvV257]
 gb|AFE53439.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. RpGvF24]
 gb|AFE49245.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. Chernikova]
 gb|AFE50091.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. Katsinyian]
 gb|AFE50936.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. BuV67-CWPP]
 gb|AFE51772.1| succinyl-CoA synthetase subunit alpha [Rickettsia prowazekii 
str. Dachau]
 gb|AGJ02403.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2 [Rickettsia 
prowazekii str. Breinl]
 gb|EOB09799.1| Thiol:disulfide interchange protein dsbA [Rickettsia prowazekii 
str. GvF12]
Length=292

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTCVGIGGDP NGT+FVDC+E F+ D +T+ I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCVGIGGDPVNGTSFVDCIEMFLQDDETKAIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAP  +RMGHAGAI+SGGKG+A+DK+  L+ AGV +  
Sbjct  217  DAADFIKQSKIKKPIVSFIAGITAPADKRMGHAGAIISGGKGSAEDKVEVLQSAGVIITR  276

Query  368  SPAKLGTTMLDVFTK  324
            SPA +G TMLD+  K
Sbjct  277  SPADIGKTMLDLLNK  291



>ref|XP_002772148.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03964.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
Length=332

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 112/137 (82%), Gaps = 1/137 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQST VGIGGDPFNGTNF+DCLERFV DPQTEGI+LIGEIGG AEE
Sbjct  190  LTYEAVNQTTEVGLGQSTVVGIGGDPFNGTNFIDCLERFVQDPQTEGIILIGEIGGAAEE  249

Query  548  eaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++KE+  + KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA  KI  L+  G  V 
Sbjct  250  EAAEWLKENNKDNKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAATKIAALEACGANVV  309

Query  371  ESPAKLGTTMLDVFTKR  321
             SPA LG  ML+++ +R
Sbjct  310  RSPADLGIKMLEMYKQR  326



>ref|WP_027839641.1| succinate--CoA ligase [Mastigocoleus testarum]
Length=291

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNF+DCLE F+AD +TE I++IGEIGG+AEE
Sbjct  157  LTYEAVGQTTAAGLGQSTCIGIGGDPVNGTNFIDCLEMFLADDKTESIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V FIAG+TAPPGRRMGHAGAI+SGGKG A  KI  ++ AG+ V  
Sbjct  217  DAAEFIKQSKVKKPMVGFIAGVTAPPGRRMGHAGAIISGGKGGADSKIEAMESAGIKVSP  276

Query  368  SPAKLGTTMLDVF  330
            SPA LG+T+ +V 
Sbjct  277  SPAALGSTLAEVL  289



>ref|XP_002779820.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
 gb|EER11615.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
Length=333

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 112/137 (82%), Gaps = 1/137 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQST VGIGGDPFNGTNF+DCLERFV DPQTEGI+LIGEIGG AEE
Sbjct  191  LTYEAVNQTTEVGLGQSTVVGIGGDPFNGTNFIDCLERFVQDPQTEGIILIGEIGGAAEE  250

Query  548  eaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++KE+    KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA  KI  L+  G +V 
Sbjct  251  EAAEWLKENNKNNKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAATKIAALEGCGASVV  310

Query  371  ESPAKLGTTMLDVFTKR  321
             SPA LG  ML+++ +R
Sbjct  311  RSPADLGVRMLEMYKQR  327



>gb|EWM26381.1| succinyl- ligase subunit mitochondrial precursor [Nannochloropsis 
gaditana]
Length=338

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 112/135 (83%), Gaps = 1/135 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDPFNGTNF+DCLERF  DP+T+GI++IGEIGG+AEE
Sbjct  201  LTYEAVAQTTAVGLGQSTCVGIGGDPFNGTNFIDCLERFTKDPETKGIIMIGEIGGSAEE  260

Query  548  eaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA +++  G   KPVV+FIAG TAPPGRRMGHAGAI+SGGKGTA  K   L++AGV V 
Sbjct  261  EAAEWLEAHGDASKPVVSFIAGSTAPPGRRMGHAGAIISGGKGTAAGKFEALEKAGVHVT  320

Query  371  ESPAKLGTTMLDVFT  327
             SPA+LGTTML   +
Sbjct  321  RSPAQLGTTMLKAIS  335



>ref|WP_022735557.1| succinyl-CoA synthetase subsunit alpha [Candidatus Pelagibacter 
ubique]
Length=291

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q +A  +GQSTC+GIGGDP NGTNF+DCLE F+ D  T+ IV+IGEIGG+AEE
Sbjct  157  LTYEAVAQTSANGMGQSTCIGIGGDPINGTNFIDCLELFLKDEDTKSIVMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K+   +KP+V FIAGLTAPPGRRMGHAGAI+SGGKG A+DKI T+K AG+T+ +
Sbjct  217  EAAEFLKKEKIKKPMVGFIAGLTAPPGRRMGHAGAIISGGKGGAEDKIETMKSAGITISK  276

Query  368  SPAKLGTTM  342
            SPA +G T+
Sbjct  277  SPADIGKTL  285



>ref|XP_004831195.1| succinyl-CoA ligase, putative [Babesia equi]
 gb|AFZ81529.1| succinyl-CoA ligase, putative [Babesia equi strain WA]
Length=330

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQS C+GIGGDPF+G  F D +++FV DPQT+GI++IGEIGGTAEE
Sbjct  194  LTYEAVSQTTNVGLGQSVCIGIGGDPFSGITFTDAIKKFVKDPQTKGILVIGEIGGTAEE  253

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            + A +IKE+ TEKP+VA IAG+ APPGRRMGHAGAI+SG KGTAQ KI+ L+EAGV V +
Sbjct  254  DLADWIKENPTEKPIVALIAGIAAPPGRRMGHAGAIISGNKGTAQGKIKALREAGVIVPD  313

Query  368  SPAKLGTTMLDVFTKR  321
            +PA++G TM +   ++
Sbjct  314  TPAEMGITMFNALKRQ  329



>ref|WP_012719686.1| succinyl-CoA synthetase subsunit alpha [Rickettsia africae]
 gb|ACP53468.1| Succinyl-CoA synthetase alpha chain [Rickettsia africae ESF-5]
Length=291

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK+S  +KP+V+FIAG+TAPPG+RMGHAGAI+ G  G+A+DK+  L+ AGV +  
Sbjct  217  DAAEFIKQSKIKKPIVSFIAGITAPPGKRMGHAGAIIVGRTGSAEDKLEALQSAGVIITR  276

Query  368  SPAKLGTTMLDVFT  327
            SPA +G TMLD+  
Sbjct  277  SPADIGKTMLDLLN  290



>ref|WP_020401362.1| succinyl-CoA synthetase subsunit alpha [Kordiimonas gwangyangensis]
Length=291

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNF+DCL+ F+ D +T+ I++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLDMFLGDDETQAIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K S  +KP+  FIAG TAPPGR MGHAGAIVSGGKG A+DKI  +K AG+ V +
Sbjct  217  EAAEFLKHSKVKKPIAGFIAGRTAPPGRTMGHAGAIVSGGKGGAEDKIEAMKSAGIVVSD  276

Query  368  SPAKLGTTML  339
            SPA LGTT+L
Sbjct  277  SPAALGTTLL  286



>ref|XP_002781462.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
 gb|EER13257.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
Length=334

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 111/137 (81%), Gaps = 1/137 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQST VGIGGDPFNGTNF+DCLERFV DPQTEGI+LIGEIGG AEE
Sbjct  192  LTYEAVNQTTEVGLGQSTVVGIGGDPFNGTNFIDCLERFVQDPQTEGIILIGEIGGAAEE  251

Query  548  eaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++KE     KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA  KI  L+  G +V 
Sbjct  252  EAAEWLKEHNKNNKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAATKIAALEGCGASVV  311

Query  371  ESPAKLGTTMLDVFTKR  321
             SPA LG  ML+++ +R
Sbjct  312  RSPADLGVRMLEMYKQR  328



>ref|WP_026871163.1| hypothetical protein, partial [Inquilinus limosus]
Length=155

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQ+TC+GIGGDP NGT+FVD LE F+ DP+TEGI++IGEIGG AE 
Sbjct  14   LTYEAVAQTTAAGLGQTTCIGIGGDPVNGTSFVDALELFLGDPETEGIIMIGEIGGDAEV  73

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
              A FIK SGT KPVV FIAG TAPPGRRMGHAGA++SGG  TA  KI  LK AG+ V +
Sbjct  74   MGAEFIKASGTTKPVVGFIAGRTAPPGRRMGHAGAVISGGHDTADHKIEALKAAGIAVAD  133

Query  368  SPAKLGTTMLDVF  330
            SPA LG+TM+ V 
Sbjct  134  SPAALGSTMIRVL  146



>gb|ADI19715.1| hypothetical protein [uncultured bacterium EB000_36F02]
Length=291

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQSTC+GIGGDP NGTNF+DCL+ F+ D +TE I++IGEIGGTAEE
Sbjct  157  LTYEAVAQTTETGLGQSTCIGIGGDPINGTNFIDCLDLFLNDEETESILMIGEIGGTAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K    +KPVV FIAG+TAPPGRRMGHAGAI+SGGKG A+DKI+ ++E G+ + +
Sbjct  217  EAAEFVKNHKIKKPVVGFIAGITAPPGRRMGHAGAIISGGKGGAKDKIKKMEECGIIIAQ  276

Query  368  SPAKLGTTMLDVFT  327
            SP+++G T+L+  +
Sbjct  277  SPSEIGKTLLNKLS  290



>emb|CCG84081.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=318

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQS  +GIGGDPF+GTNF+D L  F+ D +TEGI+LIGEIGG+AEE
Sbjct  180  LTYEAVNQTTNVGLGQSLVIGIGGDPFSGTNFIDALNLFLNDAETEGIILIGEIGGSAEE  239

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA  IKESGT KPVV+FIAG+TAPPGRRMGHAGAI SGG GTA+ K   L+ AGV V E
Sbjct  240  DAARLIKESGTTKPVVSFIAGMTAPPGRRMGHAGAITSGGTGTAKGKQDALRAAGVIVSE  299

Query  368  SPAKLGTTMLDVFTKRGLL  312
            SPAKLG+ MLD FT+R ++
Sbjct  300  SPAKLGSFMLDEFTRRDMI  318



>ref|XP_002117441.1| hypothetical protein TRIADDRAFT_61514 [Trichoplax adhaerens]
 gb|EDV20057.1| hypothetical protein TRIADDRAFT_61514 [Trichoplax adhaerens]
Length=327

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 3/142 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAVFQ T V LGQ+ CVGIGGDPFNGT+F+DCL+ F+ D +TEGIVLIGEIGG AEE
Sbjct  186  LTYEAVFQTTNVGLGQTLCVGIGGDPFNGTDFIDCLDIFLKDDKTEGIVLIGEIGGEAEE  245

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            +AA F+ +  +    KPVV+FIAG+TAPPGRRMGHAGAI+SGGKG A++KI TL+ AGV 
Sbjct  246  KAAEFLAKHNSGPNAKPVVSFIAGITAPPGRRMGHAGAIISGGKGGAEEKIATLEGAGVV  305

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            V +SPA++G+T+ +   K G L
Sbjct  306  VTKSPARIGSTIKEAMQKAGKL  327



>gb|EJW73256.1| succinyl-CoA ligase subunit alpha [Wuchereria bancrofti]
Length=159

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 3/139 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T   LGQ+ CVGIGGDPFNGTNF+DCL+ F+ DPQT+GI+LIGEIGG  EE
Sbjct  20   LTYEAVHQTTICGLGQTLCVGIGGDPFNGTNFIDCLDIFLKDPQTKGIILIGEIGGQDEE  79

Query  548  eaaafIKE--SGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
            +AA F+KE  SGT  KPVV+FIAG TAPPGRRMGHAGAI++GGKGTA DKI  LK  GV 
Sbjct  80   KAAEFLKENNSGTNAKPVVSFIAGQTAPPGRRMGHAGAIIAGGKGTAADKIEALKSVGVL  139

Query  377  VCESPAKLGTTMLDVFTKR  321
            V  SPA++G  M     K+
Sbjct  140  VSASPAQMGAMMAKALMKK  158



>gb|AEI89159.1| succinyl-CoA synthetase, alpha subunit [Candidatus Midichloria 
mitochondrii IricVA]
Length=259

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVD +E F  DP+TE +V+IGEIGG AE 
Sbjct  123  LTYEAVAQTTAVGLGQSTCVGIGGDPINGTNFVDTIEMFFNDPETEAVVMIGEIGGNAEA  182

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK S  +KPVV FIAG TAPPG+RMGHAGAI+SGG  +A+ KI  LK AGV + E
Sbjct  183  DAAHFIKNSKVKKPVVGFIAGRTAPPGKRMGHAGAIISGGGDSAESKIEILKSAGVVISE  242

Query  368  SPAKLGTTMLDVFTKR  321
            SP  +G T+L +   +
Sbjct  243  SPGLIGKTLLQIIQNK  258



>ref|WP_042311149.1| succinate--CoA ligase [Burkholderia terrae]
Length=291

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQ+TC+GIGGDP NGTNF+DCLE F+AD  T+GI++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQTTCIGIGGDPVNGTNFIDCLEMFLADDDTQGIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA F+K+SG++KPVV FIAG +APPGRRMGHAGAI+SGGKGTA  KI  ++ AG+ V +
Sbjct  217  DAAQFLKDSGSKKPVVGFIAGTSAPPGRRMGHAGAIISGGKGTAGAKIDAMRSAGIHVAQ  276

Query  368  SPAKLGTTML  339
            SPA LG TML
Sbjct  277  SPAALGETML  286



>ref|WP_014415904.1| succinyl-CoA synthetase subsunit alpha [Rhodospirillum photometricum]
 emb|CCG09274.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rhodospirillum 
photometricum DSM 122]
Length=291

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNF+DCLE F+ DP+TEGI++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLEMFLGDPETEGIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K+S   KP+  FIAG+TAPPGRRMGHAGAI++GGKGTA+DK+  ++ AG+ V +
Sbjct  217  EAAEFLKQSKIRKPMCGFIAGVTAPPGRRMGHAGAIIAGGKGTAEDKMEAMRSAGILVAD  276

Query  368  SPAKLGTTMLDVF  330
            SP+ LG+TML   
Sbjct  277  SPSALGSTMLQAL  289



>gb|EKE09873.1| hypothetical protein ACD_16C00100G0035 [uncultured bacterium]
Length=298

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA   GQSTC+GIGGDP  GT+FVDCL  F  DPQTE IVLIGEIGGTAEE
Sbjct  157  LTYEAVAQITASGFGQSTCIGIGGDPIVGTSFVDCLGLFHQDPQTEAIVLIGEIGGTAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K     KPVV+FIAG+TAPPGRRMGHAGAI+SG +G A++KI  LK+AGV V E
Sbjct  217  EAALFLKSCKNPKPVVSFIAGMTAPPGRRMGHAGAIISGSQGGAEEKIEALKQAGVVVAE  276

Query  368  SPAKLGTTMLDVFTKRG  318
            SPAK+G T+ +V    G
Sbjct  277  SPAKIGETLYNVLKNWG  293



>ref|WP_011388967.1| succinyl-CoA synthetase subsunit alpha [Rhodospirillum rubrum]
 ref|YP_426300.1| succinyl-CoA synthetase subunit alpha [Rhodospirillum rubrum 
ATCC 11170]
 gb|ABC22013.1| succinyl-CoA synthetase (ADP-forming) alpha subunit [Rhodospirillum 
rubrum ATCC 11170]
 gb|AEO47725.1| succinyl-CoA synthetase subunit alpha [Rhodospirillum rubrum 
F11]
Length=292

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQSTC+GIGGDP NGTNF+DCLE F+ADP+T+GI++IGEIGG+AEE
Sbjct  157  LTYEAVAQTTAAGLGQSTCIGIGGDPVNGTNFIDCLEMFLADPETQGIIMIGEIGGSAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            EAA F+K S  +KP+  FIAG+TAPPG+RMGHAGAI+SGGKGTA DK+  ++ AG+ V +
Sbjct  217  EAAEFLKHSKIKKPMCGFIAGVTAPPGKRMGHAGAIISGGKGTAGDKMDAMRSAGILVAD  276

Query  368  SPAKLGTTMLDVF  330
            SP+ LG+TM++  
Sbjct  277  SPSALGSTMVEAM  289



>emb|CDZ80070.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Chlamydia sp. 
'Rubis']
Length=293

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV+Q T + LGQSTCVGIGGDP NGTNF+D LE F  D QTE I++IGEIGG AEE
Sbjct  158  LTYEAVWQTTLLGLGQSTCVGIGGDPLNGTNFIDILELFEKDDQTEAILMIGEIGGEAEE  217

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
              A +IK++   KPV AFIAG+TAPPGRRMGHAGAI+SGGKG+A DKI  LK A V V +
Sbjct  218  LTAEWIKKN-CSKPVAAFIAGITAPPGRRMGHAGAIISGGKGSAIDKINALKNAKVLVTD  276

Query  368  SPAKLGTTMLDVFTKR  321
            SPAKLG T+ +   KR
Sbjct  277  SPAKLGLTVQEALQKR  292



>emb|CCI47060.1| unnamed protein product [Albugo candida]
Length=301

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 112/137 (82%), Gaps = 1/137 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T+  LGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGG+AEE
Sbjct  162  LTYEAVAQTTSTGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGSAEE  221

Query  548  eaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  372
            EAA ++++ G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K R L+ AGV V 
Sbjct  222  EAADWLQQYGDRNKPVVSFIAGMTAPPGRRMGHAGAIVSGGKGTAEGKFRALEAAGVAVT  281

Query  371  ESPAKLGTTMLDVFTKR  321
             SPA+LG  M ++   R
Sbjct  282  RSPARLGELMAELMKDR  298



>ref|WP_018051680.1| succinyl-CoA synthetase subsunit alpha [SAR324 cluster bacterium 
SCGC AB-629-O05]
Length=289

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q T V LGQSTC+GIGGDP NGTNF+DCL+ F  DPQTE IV+IGEIGG AEE
Sbjct  157  LTYEAVGQLTRVGLGQSTCIGIGGDPVNGTNFIDCLKLFQEDPQTEAIVMIGEIGGDAEE  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AAA+ K++   KP+V+FIAG TAPPGRRMGHAGAI+SGG+GTA +K+  L+EAG+ V +
Sbjct  217  QAAAYAKDN-VSKPIVSFIAGQTAPPGRRMGHAGAIISGGRGTAAEKMSALQEAGIHVVK  275

Query  368  SPAKLGTTMLDVF  330
            +PA++G  ML+  
Sbjct  276  TPAEIGEKMLEAL  288



>gb|AEE62179.1| unknown [Dendroctonus ponderosae]
Length=322

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 98/136 (72%), Gaps = 3/136 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLige---iggt  558
            LTYEAV Q T   LGQ+ CVGIGGDPFNGTNF+DCLE F+ D  TEGIVLIGE   +   
Sbjct  185  LTYEAVHQTTQSGLGQTLCVGIGGDPFNGTNFIDCLEVFLNDTDTEGIVLIGEIGGMDEE  244

Query  557  aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
               E  A   +    KPVVAFIAG+TAPPGRRMGHAGAI+SGGKG A+DK++ L+  GV 
Sbjct  245  NAAEYLAQHNKGSKSKPVVAFIAGMTAPPGRRMGHAGAIISGGKGKAEDKVKALEAVGVK  304

Query  377  VCESPAKLGTTMLDVF  330
            V  SPAK+G T+L+  
Sbjct  305  VTRSPAKIGETLLEAM  320



>ref|XP_003383961.1| PREDICTED: succinyl-CoA ligase subunit alpha, mitochondrial-like 
[Amphimedon queenslandica]
Length=348

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV+Q + V LGQS CVGIGGDPFNGTNFVDCL+ F+ DP T+ IVLIGEIGG+AEE
Sbjct  207  LTYEAVWQTSNVGLGQSLCVGIGGDPFNGTNFVDCLDVFLKDPDTDAIVLIGEIGGSAEE  266

Query  548  eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  378
             AA +++E  +    KPV AFIAGLTAPPGRRMGHAGAI+S GKG AQ+KI++L+ AGV 
Sbjct  267  NAAEYLQEHNSGPNAKPVAAFIAGLTAPPGRRMGHAGAIISQGKGGAQEKIKSLEAAGVH  326

Query  377  VCESPAKLGTTMLDVFTKRGLL  312
            + +SPA +G T+     + G L
Sbjct  327  IAKSPALMGETIRKAMAEAGKL  348



>ref|WP_026872999.1| hypothetical protein, partial [Inquilinus limosus]
Length=146

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TA  LGQ+TC+GIGGDP NGT+FVD LE F+ DP+TEGI++IGEIGG AE 
Sbjct  12   LTYEAVAQTTAAGLGQTTCIGIGGDPVNGTSFVDALELFLGDPETEGIIMIGEIGGDAEV  71

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
              A FIK SGT KPVV FIAG TAPPGRRMGHAGA++SGG  TA  KI  LK AG+ V +
Sbjct  72   MGAEFIKASGTTKPVVGFIAGRTAPPGRRMGHAGAVISGGHDTADHKIEALKAAGIAVAD  131

Query  368  SPAKLGTTML  339
            SPA LG TML
Sbjct  132  SPAALGKTML  141



>ref|WP_041185489.1| succinate--CoA ligase [Candidatus Midichloria mitochondrii]
Length=293

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  728  LTYEAVFQXTAVXLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  549
            LTYEAV Q TAV LGQSTCVGIGGDP NGTNFVD +E F  DP+TE +V+IGEIGG AE 
Sbjct  157  LTYEAVAQTTAVGLGQSTCVGIGGDPINGTNFVDTIEMFFNDPETEAVVMIGEIGGNAEA  216

Query  548  eaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCE  369
            +AA FIK S  +KPVV FIAG TAPPG+RMGHAGAI+SGG  +A+ KI  LK AGV + E
Sbjct  217  DAAHFIKNSKVKKPVVGFIAGRTAPPGKRMGHAGAIISGGGDSAESKIEILKSAGVVISE  276

Query  368  SPAKLGTTMLDVFTKR  321
            SP  +G T+L +   +
Sbjct  277  SPGLIGKTLLQIIQNK  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470