BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF019N22

Length=722
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO36650.1|  hypothetical protein CISIN_1g028965mg                   239   2e-75   Citrus sinensis [apfelsine]
ref|XP_009354238.1|  PREDICTED: probable serine incorporator            244   6e-75   Pyrus x bretschneideri [bai li]
ref|XP_011073234.1|  PREDICTED: probable serine incorporator            243   3e-74   Sesamum indicum [beniseed]
ref|XP_007215456.1|  hypothetical protein PRUPE_ppa006404mg             242   5e-74   
ref|XP_008228861.1|  PREDICTED: probable serine incorporator            242   8e-74   Prunus mume [ume]
ref|XP_007215457.1|  hypothetical protein PRUPE_ppa006404mg             241   9e-74   Prunus persica
ref|XP_006493450.1|  PREDICTED: probable serine incorporator-like       241   1e-73   Citrus sinensis [apfelsine]
ref|XP_006427689.1|  hypothetical protein CICLE_v10025720mg             241   2e-73   Citrus clementina [clementine]
gb|KHG09631.1|  Serine incorporator 3                                   241   2e-73   Gossypium arboreum [tree cotton]
gb|KJB67006.1|  hypothetical protein B456_010G170100                    240   2e-73   Gossypium raimondii
ref|XP_008381162.1|  PREDICTED: probable serine incorporator            240   3e-73   
ref|XP_008342757.1|  PREDICTED: probable serine incorporator            240   3e-73   
gb|KJB68287.1|  hypothetical protein B456_010G236500                    240   4e-73   Gossypium raimondii
gb|KJB68285.1|  hypothetical protein B456_010G236500                    240   4e-73   Gossypium raimondii
ref|XP_004158797.1|  PREDICTED: probable serine incorporator-like       239   5e-73   
ref|XP_009365247.1|  PREDICTED: probable serine incorporator            239   9e-73   Pyrus x bretschneideri [bai li]
ref|XP_007024820.1|  Serinc-domain containing serine and sphingol...    237   6e-72   
ref|XP_009615680.1|  PREDICTED: serine incorporator 3 isoform X2        234   5e-71   
ref|XP_009759114.1|  PREDICTED: probable serine incorporator isof...    234   5e-71   Nicotiana sylvestris
ref|XP_010318692.1|  PREDICTED: probable serine incorporator            234   7e-71   Solanum lycopersicum
ref|XP_011466994.1|  PREDICTED: serine incorporator 3                   233   1e-70   Fragaria vesca subsp. vesca
ref|XP_009615679.1|  PREDICTED: probable serine incorporator isof...    233   2e-70   Nicotiana tomentosiformis
gb|KJB68286.1|  hypothetical protein B456_010G236500                    233   3e-70   Gossypium raimondii
ref|XP_006341429.1|  PREDICTED: probable serine incorporator-like...    232   5e-70   Solanum tuberosum [potatoes]
gb|AFK43836.1|  unknown                                                 222   6e-69   Medicago truncatula
ref|XP_004135884.1|  PREDICTED: probable serine incorporator-like       229   1e-68   
gb|KDO36651.1|  hypothetical protein CISIN_1g028965mg                   219   2e-68   Citrus sinensis [apfelsine]
ref|XP_009759116.1|  PREDICTED: probable serine incorporator isof...    227   4e-68   Nicotiana sylvestris
gb|EYU21792.1|  hypothetical protein MIMGU_mgv1a007183mg                227   5e-68   Erythranthe guttata [common monkey flower]
ref|XP_002270610.1|  PREDICTED: probable serine incorporator            227   5e-68   Vitis vinifera
ref|XP_011020548.1|  PREDICTED: probable serine incorporator            226   1e-67   Populus euphratica
ref|XP_009615681.1|  PREDICTED: probable serine incorporator isof...    225   2e-67   Nicotiana tomentosiformis
ref|XP_011082649.1|  PREDICTED: probable serine incorporator            225   3e-67   Sesamum indicum [beniseed]
gb|EMS53525.1|  putative serine incorporator                            222   3e-67   Triticum urartu
ref|XP_006341430.1|  PREDICTED: probable serine incorporator-like...    224   3e-67   Solanum tuberosum [potatoes]
gb|ABR25551.1|  serine incorporator 3                                   218   8e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_007140603.1|  hypothetical protein PHAVU_008G126100g             223   1e-66   Phaseolus vulgaris [French bean]
ref|XP_009399576.1|  PREDICTED: probable serine incorporator            223   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP41926.1|  hypothetical protein JCGZ_26944                         223   2e-66   Jatropha curcas
ref|XP_008461193.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    223   2e-66   Cucumis melo [Oriental melon]
ref|XP_010268463.1|  PREDICTED: serine incorporator 3-like              222   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_004492298.1|  PREDICTED: probable serine incorporator-like       221   5e-66   Cicer arietinum [garbanzo]
gb|EMT13726.1|  Putative serine incorporator                            221   5e-66   
gb|EYU21795.1|  hypothetical protein MIMGU_mgv1a007183mg                219   3e-65   Erythranthe guttata [common monkey flower]
ref|XP_010687311.1|  PREDICTED: probable serine incorporator            219   3e-65   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK46909.1|  unknown                                                 217   4e-65   Lotus japonicus
gb|KEH22798.1|  serinc-domain serine and sphingolipid biosynthesi...    219   6e-65   Medicago truncatula
gb|KEH22799.1|  serinc-domain serine and sphingolipid biosynthesi...    219   7e-65   Medicago truncatula
ref|XP_010107188.1|  putative serine incorporator                       218   8e-65   Morus notabilis
ref|XP_003570284.1|  PREDICTED: probable serine incorporator            218   8e-65   Brachypodium distachyon [annual false brome]
emb|CDO98258.1|  unnamed protein product                                218   2e-64   Coffea canephora [robusta coffee]
ref|XP_006649122.1|  PREDICTED: probable serine incorporator-like       216   4e-64   
gb|EAZ24909.1|  hypothetical protein OsJ_08689                          216   7e-64   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048364.1|  Os02g0792900                                       216   8e-64   
ref|XP_008790112.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    215   1e-63   Phoenix dactylifera
ref|XP_008794380.1|  PREDICTED: probable serine incorporator            214   4e-63   Phoenix dactylifera
ref|XP_009383181.1|  PREDICTED: probable serine incorporator            213   6e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK96018.1|  unknown                                                 213   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010532058.1|  PREDICTED: serine incorporator 3                   213   1e-62   Tarenaya hassleriana [spider flower]
ref|XP_010914044.1|  PREDICTED: probable serine incorporator            212   3e-62   Elaeis guineensis
ref|XP_010929190.1|  PREDICTED: probable serine incorporator isof...    211   5e-62   Elaeis guineensis
ref|XP_010929191.1|  PREDICTED: probable serine incorporator isof...    211   6e-62   Elaeis guineensis
ref|XP_002454688.1|  hypothetical protein SORBIDRAFT_04g035670          211   7e-62   Sorghum bicolor [broomcorn]
ref|XP_004954190.1|  PREDICTED: probable serine incorporator-like       211   8e-62   Setaria italica
ref|XP_006307669.1|  hypothetical protein CARUB_v10009295mg             210   1e-61   Capsella rubella
ref|XP_011034606.1|  PREDICTED: probable serine incorporator            210   1e-61   Populus euphratica
ref|XP_002297693.2|  TMS membrane family protein                        210   1e-61   
ref|XP_010459155.1|  PREDICTED: probable serine incorporator            210   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010497691.1|  PREDICTED: probable serine incorporator            210   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010063622.1|  PREDICTED: probable serine incorporator isof...    210   2e-61   
gb|ACL54492.1|  unknown                                                 209   3e-61   Zea mays [maize]
ref|NP_001130490.1|  hypothetical protein precursor                     209   3e-61   Zea mays [maize]
ref|XP_006845424.1|  hypothetical protein AMTR_s00019p00091080          208   6e-61   Amborella trichopoda
gb|KCW70853.1|  hypothetical protein EUGRSUZ_F03990                     205   1e-60   Eucalyptus grandis [rose gum]
ref|XP_010476724.1|  PREDICTED: serine incorporator 3                   207   2e-60   Camelina sativa [gold-of-pleasure]
emb|CDY52849.1|  BnaA09g56410D                                          206   3e-60   Brassica napus [oilseed rape]
ref|XP_009117776.1|  PREDICTED: serine incorporator 3 isoform X2        206   3e-60   Brassica rapa
ref|XP_010246591.1|  PREDICTED: serine incorporator 3-like              206   4e-60   
emb|CDX81752.1|  BnaC08g38490D                                          205   1e-59   
ref|XP_009110458.1|  PREDICTED: serine incorporator 3-like              205   1e-59   Brassica rapa
emb|CDY70974.1|  BnaAnng35710D                                          205   1e-59   Brassica napus [oilseed rape]
ref|XP_010063623.1|  PREDICTED: probable serine incorporator isof...    204   1e-59   Eucalyptus grandis [rose gum]
ref|XP_003532291.1|  PREDICTED: probable serine incorporator-like       204   2e-59   Glycine max [soybeans]
ref|XP_003552131.1|  PREDICTED: probable serine incorporator-like       204   3e-59   Glycine max [soybeans]
ref|XP_002890152.1|  TMS membrane family protein                        202   1e-58   
ref|XP_002512768.1|  Membrane protein PB1A10.07c, putative              201   2e-58   
ref|NP_173069.1|  Serinc-domain containing serine and sphingolipi...    201   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416842.1|  hypothetical protein EUTSA_v10007762mg             200   1e-57   Eutrema salsugineum [saltwater cress]
gb|ABR17762.1|  unknown                                                 197   8e-57   Picea sitchensis
emb|CDX83957.1|  BnaC08g16880D                                          203   1e-56   
ref|XP_006850791.1|  hypothetical protein AMTR_s00025p00104130          188   7e-54   
dbj|BAK02293.1|  predicted protein                                      180   9e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008673654.1|  PREDICTED: uncharacterized protein LOC100191...    182   1e-51   Zea mays [maize]
tpg|DAA49274.1|  TPA: hypothetical protein ZEAMMB73_017777              182   2e-51   
gb|ABR16232.1|  unknown                                                 183   2e-51   Picea sitchensis
ref|NP_001130812.1|  uncharacterized protein LOC100191916               182   8e-51   Zea mays [maize]
ref|XP_002466928.1|  hypothetical protein SORBIDRAFT_01g016840          182   8e-51   Sorghum bicolor [broomcorn]
ref|NP_001050476.1|  Os03g0454100                                       181   2e-50   
ref|XP_004982576.1|  PREDICTED: probable serine incorporator-like       179   1e-49   Setaria italica
ref|XP_008458551.1|  PREDICTED: serine incorporator 3                   179   1e-49   Cucumis melo [Oriental melon]
ref|XP_010546829.1|  PREDICTED: serine incorporator 3 isoform X1        177   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_006650244.1|  PREDICTED: probable serine incorporator-like       177   4e-49   Oryza brachyantha
ref|XP_010237604.1|  PREDICTED: probable serine incorporator            177   5e-49   Brachypodium distachyon [annual false brome]
ref|XP_004150322.1|  PREDICTED: serine incorporator 3-like              176   8e-49   Cucumis sativus [cucumbers]
ref|XP_004169518.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...    176   9e-49   
ref|XP_011090806.1|  PREDICTED: probable serine incorporator            176   1e-48   Sesamum indicum [beniseed]
gb|EYU43840.1|  hypothetical protein MIMGU_mgv1a006662mg                176   1e-48   Erythranthe guttata [common monkey flower]
dbj|BAJ86142.1|  predicted protein                                      175   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008799134.1|  PREDICTED: probable serine incorporator            175   4e-48   Phoenix dactylifera
ref|XP_010546830.1|  PREDICTED: serine incorporator 3 isoform X2        173   2e-47   Tarenaya hassleriana [spider flower]
ref|XP_004296950.1|  PREDICTED: probable serine incorporator            172   3e-47   Fragaria vesca subsp. vesca
ref|XP_009391591.1|  PREDICTED: serine incorporator 3                   171   6e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002280143.1|  PREDICTED: serine incorporator 3                   170   2e-46   Vitis vinifera
ref|XP_010938752.1|  PREDICTED: probable serine incorporator            170   3e-46   Elaeis guineensis
ref|XP_006419802.1|  hypothetical protein CICLE_v10005070mg             170   3e-46   Citrus clementina [clementine]
ref|XP_009365800.1|  PREDICTED: probable serine incorporator isof...    168   8e-46   Pyrus x bretschneideri [bai li]
ref|XP_009365799.1|  PREDICTED: probable serine incorporator isof...    168   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_009342179.1|  PREDICTED: probable serine incorporator            167   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_010693925.1|  PREDICTED: serine incorporator 3                   167   3e-45   Beta vulgaris subsp. vulgaris [field beet]
emb|CDO98987.1|  unnamed protein product                                167   4e-45   Coffea canephora [robusta coffee]
gb|KDO74827.1|  hypothetical protein CISIN_1g039061mg                   166   6e-45   Citrus sinensis [apfelsine]
emb|CDY05246.1|  BnaC05g45570D                                          166   6e-45   
ref|XP_006356686.1|  PREDICTED: serine incorporator 3-like              166   1e-44   Solanum tuberosum [potatoes]
ref|XP_006595390.1|  PREDICTED: probable serine incorporator-like       164   1e-44   
emb|CDY24707.1|  BnaA05g31060D                                          164   2e-44   Brassica napus [oilseed rape]
gb|ACJ84561.1|  unknown                                                 164   3e-44   Medicago truncatula
gb|KHN37564.1|  Putative serine incorporator                            164   4e-44   Glycine soja [wild soybean]
ref|XP_010464184.1|  PREDICTED: probable serine incorporator            164   5e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010486107.1|  PREDICTED: probable serine incorporator            164   6e-44   Camelina sativa [gold-of-pleasure]
gb|KJB28193.1|  hypothetical protein B456_005G040500                    163   7e-44   Gossypium raimondii
ref|XP_009129653.1|  PREDICTED: probable serine incorporator            163   8e-44   Brassica rapa
ref|XP_009799680.1|  PREDICTED: probable serine incorporator            162   1e-43   Nicotiana sylvestris
ref|XP_006297798.1|  hypothetical protein CARUB_v10013833mg             162   1e-43   
ref|XP_010436570.1|  PREDICTED: probable serine incorporator            162   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_007147778.1|  hypothetical protein PHAVU_006G154400g             160   1e-42   Phaseolus vulgaris [French bean]
gb|AAF30310.1|AC018907_10  hypothetical protein                         158   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010322266.1|  PREDICTED: serine incorporator 3                   160   1e-42   Solanum lycopersicum
ref|XP_001765634.1|  predicted protein                                  159   2e-42   
ref|XP_002882452.1|  TMS membrane family protein                        159   2e-42   Arabidopsis lyrata subsp. lyrata
ref|NP_187268.2|  Serinc-domain containing serine and sphingolipi...    158   7e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623079.1|  PREDICTED: probable serine incorporator            157   1e-41   Nicotiana tomentosiformis
ref|XP_007034589.1|  Serinc-domain containing serine and sphingol...    157   1e-41   
emb|CAN71158.1|  hypothetical protein VITISV_036762                     155   2e-41   Vitis vinifera
gb|AFK47365.1|  unknown                                                 152   2e-41   Lotus japonicus
ref|XP_010255869.1|  PREDICTED: probable serine incorporator            156   3e-41   Nelumbo nucifera [Indian lotus]
gb|EPS68630.1|  hypothetical protein M569_06136                         156   4e-41   Genlisea aurea
ref|XP_004486156.1|  PREDICTED: probable serine incorporator-like       156   4e-41   Cicer arietinum [garbanzo]
ref|XP_008340909.1|  PREDICTED: probable serine incorporator            155   5e-41   Malus domestica [apple tree]
ref|XP_010103434.1|  putative serine incorporator                       155   1e-40   Morus notabilis
ref|XP_008223013.1|  PREDICTED: probable serine incorporator            155   1e-40   Prunus mume [ume]
ref|XP_008390818.1|  PREDICTED: probable serine incorporator            154   2e-40   
ref|XP_011010290.1|  PREDICTED: probable serine incorporator            152   8e-40   Populus euphratica
ref|XP_006407969.1|  hypothetical protein EUTSA_v10020853mg             150   1e-39   
gb|KDP40096.1|  hypothetical protein JCGZ_02094                         151   2e-39   Jatropha curcas
ref|XP_002312742.1|  TMS membrane family protein                        152   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006407970.1|  hypothetical protein EUTSA_v10020853mg             150   6e-39   Eutrema salsugineum [saltwater cress]
ref|XP_002516786.1|  Membrane protein PB1A10.07c, putative              149   1e-38   Ricinus communis
ref|XP_007222705.1|  hypothetical protein PRUPE_ppa006444mg             149   1e-38   Prunus persica
ref|XP_010024424.1|  PREDICTED: serine incorporator 3                   148   3e-38   Eucalyptus grandis [rose gum]
ref|XP_009117775.1|  PREDICTED: wall-associated receptor kinase-l...    148   8e-37   Brassica rapa
ref|XP_002956760.1|  hypothetical protein VOLCADRAFT_83749              142   4e-36   Volvox carteri f. nagariensis
ref|XP_005651318.1|  TMS membrane protein/tumor differentially hy...    141   1e-35   Coccomyxa subellipsoidea C-169
gb|KJB67012.1|  hypothetical protein B456_010G170100                    137   3e-34   Gossypium raimondii
ref|XP_002979274.1|  hypothetical protein SELMODRAFT_110336             130   5e-32   
gb|KIZ05916.1|  putative serine incorporator                            130   2e-31   Monoraphidium neglectum
ref|XP_002506090.1|  predicted protein                                  128   7e-31   Micromonas commoda
gb|ABF97020.1|  TMS membrane family protein, putative, expressed        123   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001416509.1|  predicted protein                                  123   3e-29   Ostreococcus lucimarinus CCE9901
ref|XP_002988580.1|  hypothetical protein SELMODRAFT_128126             121   1e-28   
ref|XP_011397622.1|  putative serine incorporator                       120   7e-28   Auxenochlorella protothecoides
gb|AEW08633.1|  hypothetical protein CL976Contig1_02                    112   9e-28   Pinus radiata
dbj|BAD94992.1|  hypothetical protein                                   105   2e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CEG01070.1|  TMS membrane protein/tumour differentially expre...    112   2e-25   Ostreococcus tauri
ref|XP_003075128.1|  OJ1249_F12.26 gene product (ISS)                   112   2e-25   
emb|CAN80334.1|  hypothetical protein VITISV_009413                     103   8e-25   Vitis vinifera
ref|XP_004302121.1|  PREDICTED: serine incorporator 3-like              108   2e-24   Fragaria vesca subsp. vesca
gb|ACG35592.1|  hypothetical protein                                    102   2e-24   Zea mays [maize]
gb|EFA77480.1|  TMS membrane protein                                    100   6e-21   Heterostelium album PN500
emb|CEG74958.1|  hypothetical protein RMATCC62417_10078               97.4    2e-20   Rhizopus microsporus
emb|CEG74957.1|  hypothetical protein RMATCC62417_10078               97.4    3e-20   Rhizopus microsporus
emb|CEG74956.1|  hypothetical protein RMATCC62417_10078               97.1    5e-20   Rhizopus microsporus
emb|CEG67769.1|  hypothetical protein RMATCC62417_04149               97.1    5e-20   Rhizopus microsporus
emb|CEG74955.1|  hypothetical protein RMATCC62417_10078               97.1    6e-20   Rhizopus microsporus
emb|CEG74953.1|  hypothetical protein RMATCC62417_10078               96.7    1e-19   Rhizopus microsporus
emb|CEG74954.1|  hypothetical protein RMATCC62417_10078               96.7    1e-19   Rhizopus microsporus
emb|CEJ00743.1|  hypothetical protein RMCBS344292_14792               96.7    1e-19   Rhizopus microsporus
emb|CEJ03265.1|  hypothetical protein RMCBS344292_17253               95.1    1e-19   Rhizopus microsporus
ref|XP_002982341.1|  hypothetical protein SELMODRAFT_179397           90.1    1e-17   Selaginella moellendorffii
ref|XP_001770496.1|  predicted protein                                89.4    3e-17   
ref|XP_004366977.1|  TMS membrane protein                             87.8    2e-16   Cavenderia fasciculata
gb|EXX70672.1|  Tms1p                                                 85.5    2e-16   Rhizophagus irregularis DAOM 197198w
ref|XP_002304839.2|  hypothetical protein POPTR_0003s18530g           86.7    2e-16   
ref|XP_003062471.1|  predicted protein                                87.0    3e-16   Micromonas pusilla CCMP1545
ref|XP_001625531.1|  predicted protein                                86.7    5e-16   Nematostella vectensis
gb|KDD71727.1|  hypothetical protein H632_c4498p0                     82.8    6e-16   Helicosporidium sp. ATCC 50920
ref|XP_002965853.1|  hypothetical protein SELMODRAFT_83891            85.1    7e-16   
ref|XP_009493459.1|  hypothetical protein H696_01290                  81.3    7e-16   Fonticula alba
ref|XP_009336936.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  83.6    1e-15   
ref|XP_002157067.2|  PREDICTED: probable serine incorporator-like     84.7    1e-15   Hydra vulgaris
gb|ESA19644.1|  hypothetical protein GLOINDRAFT_19362                 84.7    2e-15   
ref|XP_008242601.1|  PREDICTED: probable serine incorporator          84.0    2e-15   Prunus mume [ume]
ref|XP_007202140.1|  hypothetical protein PRUPE_ppa006940mg           84.0    2e-15   
ref|XP_009352478.1|  PREDICTED: probable serine incorporator          83.6    3e-15   
ref|NP_741561.1|  Protein Y57E12AL.1, isoform a                       84.0    4e-15   Caenorhabditis elegans [roundworm]
ref|NP_741562.1|  Protein Y57E12AL.1, isoform b                       83.2    4e-15   
gb|KIH42470.1|  TMS membrane protein/tumor differentially express...  78.2    5e-15   Ancylostoma duodenale
ref|XP_010469509.1|  PREDICTED: probable serine incorporator isof...  81.6    6e-15   
ref|XP_004336528.1|  serine incorporator 3, putative                  83.2    6e-15   Acanthamoeba castellanii str. Neff
ref|XP_010440599.1|  PREDICTED: probable serine incorporator          78.2    7e-15   Camelina sativa [gold-of-pleasure]
gb|ESA13270.1|  hypothetical protein GLOINDRAFT_347023                81.6    7e-15   
ref|XP_004287083.1|  PREDICTED: probable serine incorporator isof...  82.8    7e-15   Fragaria vesca subsp. vesca
ref|NP_189089.3|  Serinc-domain containing serine and sphingolipi...  82.8    7e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|GAM29010.1|  hypothetical protein SAMD00019534_121860             81.6    8e-15   Acytostelium subglobosum LB1
ref|XP_011458210.1|  PREDICTED: probable serine incorporator isof...  82.4    8e-15   Fragaria vesca subsp. vesca
ref|XP_008224089.1|  PREDICTED: probable serine incorporator          82.8    8e-15   Prunus mume [ume]
ref|XP_009336915.1|  PREDICTED: probable serine incorporator          82.4    8e-15   
ref|NP_850202.4|  Serinc-domain containing serine and sphingolipi...  82.4    9e-15   Arabidopsis thaliana [mouse-ear cress]
gb|EJW79555.1|  serine incorporator 2                                 82.4    9e-15   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_010049913.1|  PREDICTED: probable serine incorporator isof...  82.4    1e-14   Eucalyptus grandis [rose gum]
gb|KDP32305.1|  hypothetical protein JCGZ_13230                       82.0    1e-14   Jatropha curcas
gb|EGT39434.1|  hypothetical protein CAEBREN_08033                    82.8    1e-14   Caenorhabditis brenneri
ref|XP_004301051.1|  PREDICTED: probable serine incorporator          82.4    1e-14   Fragaria vesca subsp. vesca
gb|EXX52304.1|  Tms1p                                                 82.4    1e-14   Rhizophagus irregularis DAOM 197198w
ref|XP_010542976.1|  PREDICTED: probable serine incorporator          82.4    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_004665239.1|  PREDICTED: serine incorporator 2                 82.4    1e-14   Jaculus jaculus
ref|XP_003136987.1|  hypothetical protein LOAG_01400                  82.4    1e-14   Loa loa
ref|XP_010469508.1|  PREDICTED: probable serine incorporator isof...  82.0    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010469504.1|  PREDICTED: probable serine incorporator isof...  82.0    2e-14   Camelina sativa [gold-of-pleasure]
emb|CDX93013.1|  BnaA03g37350D                                        81.6    2e-14   
emb|CDY66714.1|  BnaCnng52050D                                        81.6    2e-14   Brassica napus [oilseed rape]
ref|XP_010469507.1|  PREDICTED: probable serine incorporator isof...  81.6    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_001901605.1|  TDE2 protein                                     82.0    2e-14   Brugia malayi [agent of lymphatic filariasis]
ref|XP_007226418.1|  hypothetical protein PRUPE_ppa023345mg           81.6    2e-14   Prunus persica
gb|EGT35951.1|  hypothetical protein CAEBREN_13181                    81.6    2e-14   Caenorhabditis brenneri
ref|XP_010656350.1|  PREDICTED: probable serine incorporator isof...  80.9    2e-14   
gb|ETN74193.1|  TMS membrane protein/tumor differentially express...  82.0    2e-14   Necator americanus
ref|XP_008337449.1|  PREDICTED: probable serine incorporator          81.3    2e-14   
ref|XP_006645562.1|  PREDICTED: probable serine incorporator-like     81.6    2e-14   
gb|ESA09597.1|  hypothetical protein GLOINDRAFT_80906                 81.3    2e-14   
ref|XP_003620496.1|  Serine incorporator                              81.3    2e-14   Medicago truncatula
ref|XP_002994401.1|  hypothetical protein SELMODRAFT_449363           80.9    2e-14   Selaginella moellendorffii
ref|XP_002968524.1|  hypothetical protein SELMODRAFT_89240            81.3    2e-14   
ref|XP_009408948.1|  PREDICTED: probable serine incorporator          81.3    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009141295.1|  PREDICTED: probable serine incorporator isof...  81.3    3e-14   Brassica rapa
ref|XP_010656344.1|  PREDICTED: probable serine incorporator isof...  80.9    3e-14   
ref|XP_006295917.1|  hypothetical protein CARUB_v10025054mg           81.3    3e-14   
ref|XP_011174068.1|  PREDICTED: probable serine incorporator          76.6    3e-14   
emb|CEP13524.1|  hypothetical protein                                 81.6    3e-14   Parasitella parasitica
gb|EGT34050.1|  hypothetical protein CAEBREN_24071                    81.3    3e-14   Caenorhabditis brenneri
ref|XP_002602420.1|  hypothetical protein BRAFLDRAFT_117027           81.3    3e-14   Branchiostoma floridae
ref|XP_010435285.1|  PREDICTED: probable serine incorporator          80.9    3e-14   Camelina sativa [gold-of-pleasure]
dbj|GAN07994.1|  TMS membrane protein/tumor differentially expres...  81.3    3e-14   Mucor ambiguus
ref|XP_005665214.1|  PREDICTED: serine incorporator 2-like            77.0    3e-14   
ref|XP_004968422.1|  PREDICTED: probable serine incorporator-like...  80.9    3e-14   Setaria italica
gb|EXX55775.1|  Tms1p                                                 81.3    4e-14   Rhizophagus irregularis DAOM 197198w
ref|XP_006285723.1|  hypothetical protein CARUB_v10007195mg           80.5    4e-14   Capsella rubella
gb|EPB88143.1|  hypothetical protein HMPREF1544_05087                 81.3    4e-14   Mucor circinelloides f. circinelloides 1006PhL
gb|KHN74385.1|  Serine incorporator 3                                 81.3    4e-14   Toxocara canis
ref|XP_010049722.1|  PREDICTED: probable serine incorporator          80.5    4e-14   Eucalyptus grandis [rose gum]
ref|XP_010450223.1|  PREDICTED: probable serine incorporator          80.5    4e-14   Camelina sativa [gold-of-pleasure]
gb|ENN78699.1|  hypothetical protein YQE_04871                        80.9    4e-14   Dendroctonus ponderosae
ref|XP_010440600.1|  PREDICTED: probable serine incorporator          80.1    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002863245.1|  hypothetical protein ARALYDRAFT_497050           80.1    6e-14   
emb|CEG70157.1|  hypothetical protein RMATCC62417_06104               80.5    6e-14   Rhizopus microsporus
ref|XP_010413903.1|  PREDICTED: probable serine incorporator          80.1    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003114570.1|  hypothetical protein CRE_26972                   80.5    6e-14   Caenorhabditis remanei
ref|NP_567403.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            79.7    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362934.1|  PREDICTED: probable serine incorporator          79.7    7e-14   
ref|XP_010650214.1|  PREDICTED: probable serine incorporator          79.7    8e-14   Vitis vinifera
ref|XP_002324973.1|  TMS membrane family protein                      79.7    8e-14   
ref|XP_010532841.1|  PREDICTED: probable serine incorporator          79.7    8e-14   
gb|EGW01137.1|  Serine incorporator 2                                 79.3    9e-14   Cricetulus griseus [Chinese hamsters]
gb|ERL86825.1|  hypothetical protein D910_04228                       80.5    9e-14   Dendroctonus ponderosae
emb|CBI33332.3|  unnamed protein product                              79.7    9e-14   Vitis vinifera
ref|XP_002881267.1|  TMS membrane family protein                      79.7    9e-14   
ref|XP_007624716.1|  PREDICTED: serine incorporator 2 isoform X1      79.7    9e-14   
gb|KFH68151.1|  hypothetical protein MVEG_06880                       80.1    9e-14   Mortierella verticillata NRRL 6337
ref|XP_007637556.1|  PREDICTED: serine incorporator 2 isoform X2      79.7    9e-14   
ref|XP_002637793.1|  Hypothetical protein CBG04578                    79.7    1e-13   Caenorhabditis briggsae
gb|ERE85397.1|  serine incorporator 2-like protein                    79.7    1e-13   
dbj|BAK01836.1|  predicted protein                                    79.7    1e-13   
ref|XP_005079567.1|  PREDICTED: serine incorporator 2 isoform X1      79.7    1e-13   
ref|XP_010688168.1|  PREDICTED: probable serine incorporator          79.3    1e-13   
ref|XP_010509918.1|  PREDICTED: probable serine incorporator          79.3    1e-13   
ref|XP_002515588.1|  conserved hypothetical protein                   79.0    1e-13   
ref|XP_004230114.1|  PREDICTED: probable serine incorporator          79.0    1e-13   
ref|XP_009107689.1|  PREDICTED: probable serine incorporator          78.6    2e-13   
ref|NP_001240143.1|  uncharacterized protein LOC100788574             78.6    2e-13   
emb|CDJ97729.1|  TMS membrane protein tumour differentially expre...  78.6    2e-13   
ref|XP_007318557.1|  hypothetical protein SERLADRAFT_356127           79.3    2e-13   
ref|XP_003102359.1|  hypothetical protein CRE_05000                   79.0    2e-13   
ref|XP_005079568.1|  PREDICTED: serine incorporator 2 isoform X2      78.6    2e-13   
ref|XP_003528920.1|  PREDICTED: probable serine incorporator-like     78.6    2e-13   
ref|XP_009381145.1|  PREDICTED: probable serine incorporator          78.6    2e-13   
emb|CDJ92178.1|  TMS membrane protein tumour differentially expre...  79.0    2e-13   
ref|XP_006414928.1|  hypothetical protein EUTSA_v10025402mg           78.6    2e-13   
ref|XP_006347785.1|  PREDICTED: probable serine incorporator-like...  78.6    2e-13   
ref|XP_011043440.1|  PREDICTED: probable serine incorporator          78.2    2e-13   
ref|XP_007558462.1|  PREDICTED: serine incorporator 1-like            78.6    2e-13   
ref|NP_849373.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            78.2    2e-13   
gb|EIE81637.1|  hypothetical protein RO3G_06342                       79.0    2e-13   
ref|XP_006410459.1|  hypothetical protein EUTSA_v10016703mg           78.6    2e-13   
ref|XP_004167946.1|  PREDICTED: serine incorporator 1-like            76.6    2e-13   
gb|EYB93217.1|  hypothetical protein Y032_0184g1001                   78.2    3e-13   
gb|KFH68448.1|  hypothetical protein MVEG_05263                       78.6    3e-13   
dbj|BAM19260.1|  membrane protein tms1d                               78.6    3e-13   
ref|XP_008458232.1|  PREDICTED: probable serine incorporator isof...  77.0    3e-13   
gb|EYB93216.1|  hypothetical protein Y032_0184g1001                   78.2    3e-13   
ref|XP_008846447.1|  PREDICTED: serine incorporator 2                 78.2    3e-13   
ref|XP_005353216.1|  PREDICTED: serine incorporator 2                 78.2    3e-13   
gb|KFD55197.1|  hypothetical protein M513_03838                       78.6    3e-13   
gb|AGG19193.1|  maternal effect embryo arrest 55-1                    77.8    3e-13   
ref|XP_004591703.1|  PREDICTED: serine incorporator 2 isoform X1      78.2    3e-13   
ref|XP_008272011.1|  PREDICTED: serine incorporator 2                 78.2    4e-13   
gb|EPY77486.1|  hypothetical protein CB1_001251006                    74.3    4e-13   
ref|XP_009267712.1|  Membrane protein TMS1                            78.2    4e-13   
ref|XP_004512960.1|  PREDICTED: probable serine incorporator-like     77.8    4e-13   
ref|XP_002957018.1|  hypothetical protein VOLCADRAFT_77374            77.8    4e-13   
gb|EEE53986.1|  hypothetical protein OsJ_00615                        78.2    4e-13   
ref|XP_006734246.1|  PREDICTED: serine incorporator 2-like            76.3    4e-13   
gb|EEC70050.1|  hypothetical protein OsI_00646                        78.2    4e-13   
ref|XP_010527190.1|  PREDICTED: probable serine incorporator          77.8    4e-13   
ref|NP_001042203.1|  Os01g0179800                                     77.8    4e-13   
ref|XP_004591704.1|  PREDICTED: serine incorporator 2 isoform X2      78.2    4e-13   
ref|NP_766290.2|  serine incorporator 2 isoform 1 precursor           77.8    4e-13   
emb|CDP03356.1|  unnamed protein product                              77.8    4e-13   
ref|NP_001026826.1|  serine incorporator 2 precursor                  77.8    4e-13   
gb|KHG16194.1|  Serine incorporator 3                                 77.4    4e-13   
ref|XP_006503126.1|  PREDICTED: serine incorporator 2 isoform X1      77.8    4e-13   
ref|NP_506611.1|  Protein R11H6.2                                     77.8    4e-13   
ref|NP_001240315.1|  serine incorporator 2 isoform 2                  77.4    4e-13   
ref|XP_008146179.1|  PREDICTED: serine incorporator 2 isoform X2      77.8    4e-13   
ref|XP_002126357.1|  PREDICTED: serine incorporator 5-like            77.8    4e-13   
ref|XP_009141296.1|  PREDICTED: probable serine incorporator isof...  77.4    5e-13   
ref|NP_001141791.1|  hypothetical protein                             75.5    5e-13   
ref|XP_006297795.1|  hypothetical protein CARUB_v10013830mg           77.4    5e-13   
gb|KJB54130.1|  hypothetical protein B456_009G023600                  77.4    5e-13   
ref|XP_008146178.1|  PREDICTED: serine incorporator 2 isoform X1      77.8    5e-13   
gb|KJB54127.1|  hypothetical protein B456_009G023600                  77.4    5e-13   
emb|CAP36379.2|  Protein CBG19072                                     77.8    5e-13   
ref|XP_002411145.1|  conserved hypothetical protein                   77.4    5e-13   
ref|XP_002637371.1|  Hypothetical protein CBG19072                    77.4    6e-13   
ref|XP_009688001.1|  PREDICTED: serine incorporator 2-like            77.0    6e-13   
ref|XP_010466851.1|  PREDICTED: probable serine incorporator          77.0    6e-13   
ref|XP_008458224.1|  PREDICTED: probable serine incorporator isof...  77.0    6e-13   
sp|Q58CW5.1|SERC2_BOVIN  RecName: Full=Serine incorporator 2; Alt...  77.4    6e-13   
gb|ETE65034.1|  Serine incorporator 2                                 77.0    6e-13   
ref|XP_008458214.1|  PREDICTED: probable serine incorporator isof...  77.0    6e-13   
dbj|BAC37344.1|  unnamed protein product                              73.6    6e-13   
ref|XP_005993191.1|  PREDICTED: serine incorporator 1-like            77.4    6e-13   
ref|NP_001090209.1|  serine incorporator 1 precursor                  77.4    7e-13   
gb|AAX46603.1|  tumor differentially expressed 2-like                 77.0    7e-13   
gb|AAI26722.1|  SERINC2 protein                                       77.0    7e-13   
ref|XP_010513493.1|  PREDICTED: probable serine incorporator          77.0    7e-13   
ref|XP_004139427.1|  PREDICTED: serine incorporator 1-like            76.6    7e-13   
ref|XP_002426175.1|  serine incorporator, putative                    77.0    7e-13   
gb|AIC61740.1|  SERINC2                                               72.4    8e-13   
ref|XP_008408640.1|  PREDICTED: serine incorporator 1-like            77.0    8e-13   
ref|XP_005676784.1|  PREDICTED: serine incorporator 2 isoform X1      77.0    8e-13   
ref|XP_010249828.1|  PREDICTED: probable serine incorporator          76.6    8e-13   
emb|CEF63556.1|  TMS1                                                 77.0    8e-13   
ref|XP_011356110.1|  PREDICTED: serine incorporator 2 isoform X1      77.0    9e-13   
ref|XP_007013229.1|  Serinc-domain containing serine and sphingol...  76.6    9e-13   
ref|NP_001030362.1|  serine incorporator 2                            76.6    9e-13   
gb|EKC27359.1|  DNA/RNA-binding protein KIN17                         75.1    9e-13   
ref|XP_007013230.1|  Serinc-domain containing serine and sphingol...  76.6    9e-13   
ref|XP_007573353.1|  PREDICTED: serine incorporator 1-like            77.0    9e-13   
ref|NP_001231077.1|  serine incorporator 2 precursor                  77.0    9e-13   
ref|XP_007013228.1|  Serinc-domain containing serine and sphingol...  76.6    9e-13   
ref|XP_006680018.1|  hypothetical protein BATDEDRAFT_37095            76.6    9e-13   
gb|KFV77205.1|  Serine incorporator 1                                 76.6    1e-12   
gb|KFK39759.1|  serinc-domain containing serine and sphingolipid ...  76.6    1e-12   
gb|AAH07375.2|  SERINC2 protein                                       72.8    1e-12   
ref|XP_003738027.1|  PREDICTED: probable serine incorporator-like...  76.6    1e-12   
emb|CAN80335.1|  hypothetical protein VITISV_009414                   76.3    1e-12   
ref|XP_010166344.1|  PREDICTED: serine incorporator 1                 76.3    1e-12   
gb|KFZ58338.1|  Serine incorporator 1                                 76.6    1e-12   
ref|XP_002114508.1|  expressed hypothetical protein                   76.3    1e-12   
ref|XP_007952319.1|  PREDICTED: serine incorporator 2                 76.6    1e-12   
ref|XP_008778515.1|  PREDICTED: serine incorporator 1-like            74.3    1e-12   
ref|NP_001037624.1|  membrane protein TMS1 precursor                  76.6    1e-12   
ref|XP_004314553.1|  PREDICTED: serine incorporator 1                 75.9    1e-12   
emb|CDY37743.1|  BnaA04g19250D                                        77.0    1e-12   
ref|XP_004741007.1|  PREDICTED: serine incorporator 2                 76.6    1e-12   
gb|ERG80713.1|  serine incorporator 3                                 76.6    1e-12   
ref|XP_004312132.1|  PREDICTED: serine incorporator 2 isoform 3       76.6    1e-12   
ref|XP_004422332.1|  PREDICTED: serine incorporator 1                 76.6    1e-12   
ref|XP_004612673.1|  PREDICTED: serine incorporator 3                 77.0    1e-12   
ref|XP_011356111.1|  PREDICTED: serine incorporator 2 isoform X2      76.3    1e-12   
ref|XP_009907826.1|  PREDICTED: serine incorporator 1                 76.6    1e-12   
ref|XP_005959570.1|  PREDICTED: serine incorporator 2 isoform X2      76.6    1e-12   
ref|XP_005959571.1|  PREDICTED: serine incorporator 2 isoform X3      76.6    1e-12   
ref|XP_004312133.1|  PREDICTED: serine incorporator 2 isoform 4       76.3    1e-12   
ref|XP_008579104.1|  PREDICTED: serine incorporator 2                 76.6    1e-12   
ref|XP_004266597.1|  PREDICTED: serine incorporator 2 isoform 3       76.3    1e-12   
ref|XP_007897489.1|  PREDICTED: serine incorporator 1                 76.3    1e-12   
ref|XP_004312131.1|  PREDICTED: serine incorporator 2 isoform 2       76.3    1e-12   
ref|XP_002455066.1|  hypothetical protein SORBIDRAFT_03g003750        76.3    1e-12   
ref|XP_004312130.1|  PREDICTED: serine incorporator 2 isoform 1       76.3    1e-12   
ref|XP_005676785.1|  PREDICTED: serine incorporator 2 isoform X2      76.3    1e-12   
ref|XP_008319400.1|  PREDICTED: serine incorporator 1-like            76.3    1e-12   
ref|XP_008064965.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_007454962.1|  PREDICTED: serine incorporator 1                 76.3    1e-12   
ref|XP_004005091.1|  PREDICTED: serine incorporator 2 isoform 2       76.3    1e-12   
ref|XP_005676787.1|  PREDICTED: serine incorporator 2 isoform X4      75.9    1e-12   
ref|XP_004263915.1|  PREDICTED: serine incorporator 1                 76.3    1e-12   
gb|KJB06649.1|  hypothetical protein B456_001G003900                  75.9    1e-12   
ref|XP_003228070.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_007534228.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_005959569.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    1e-12   
ref|XP_005906241.1|  PREDICTED: serine incorporator 2 isoform X2      76.3    1e-12   
ref|XP_010915041.1|  PREDICTED: probable serine incorporator          75.9    1e-12   
ref|XP_004266595.1|  PREDICTED: serine incorporator 2 isoform 1       76.3    1e-12   
ref|XP_005959572.1|  PREDICTED: serine incorporator 2 isoform X4      75.9    1e-12   
ref|XP_004266596.1|  PREDICTED: serine incorporator 2 isoform 2       76.3    1e-12   
gb|KFM12545.1|  Serine incorporator 2                                 76.3    1e-12   
ref|XP_003638965.2|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_004005092.1|  PREDICTED: serine incorporator 2 isoform 3       76.3    1e-12   
ref|XP_007152808.1|  hypothetical protein PHAVU_004G161400g           75.9    1e-12   
ref|XP_004266598.1|  PREDICTED: serine incorporator 2 isoform 4       75.9    2e-12   
gb|AAQ88795.1|  GSVL396                                               76.3    2e-12   
ref|XP_010264006.1|  PREDICTED: probable serine incorporator isof...  75.9    2e-12   
ref|XP_005906240.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    2e-12   
gb|ELR48720.1|  Serine incorporator 2                                 76.3    2e-12   
ref|XP_004642983.1|  PREDICTED: serine incorporator 2                 76.3    2e-12   
ref|XP_010974399.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    2e-12   
ref|XP_009284929.1|  PREDICTED: serine incorporator 2                 75.9    2e-12   
ref|XP_005911789.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...  75.9    2e-12   
ref|XP_007145428.1|  hypothetical protein PHAVU_007G238300g           75.9    2e-12   
ref|XP_005906242.1|  PREDICTED: serine incorporator 2 isoform X3      75.9    2e-12   
ref|XP_004005090.1|  PREDICTED: serine incorporator 2 isoform 1       75.9    2e-12   
ref|XP_006196964.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    2e-12   
ref|XP_007128527.1|  PREDICTED: serine incorporator 2                 75.9    2e-12   
gb|ACG46077.1|  TMS membrane protein/tumor differentially express...  75.9    2e-12   
ref|XP_010910312.1|  PREDICTED: serine incorporator 1-like            72.4    2e-12   
ref|XP_001836185.1|  membrane protein                                 75.9    2e-12   
ref|XP_010666477.1|  PREDICTED: probable serine incorporator isof...  75.1    2e-12   
ref|XP_010950491.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    2e-12   
gb|AAS66282.1|  LRRGT00191                                            77.0    2e-12   
ref|XP_007145427.1|  hypothetical protein PHAVU_007G238300g           75.9    2e-12   
ref|XP_006767104.1|  PREDICTED: serine incorporator 2 isoform X2      75.9    2e-12   
ref|XP_006767103.1|  PREDICTED: serine incorporator 2 isoform X1      75.9    2e-12   
ref|XP_010835380.1|  PREDICTED: serine incorporator 2                 75.9    2e-12   
ref|XP_008667561.1|  PREDICTED: hypothetical protein isoform X1       75.5    2e-12   
ref|XP_010767646.1|  PREDICTED: serine incorporator 1-like            72.8    2e-12   
ref|XP_011134962.1|  PREDICTED: probable serine incorporator isof...  75.9    2e-12   
ref|XP_003977493.1|  PREDICTED: serine incorporator 1-like isoform 1  75.9    2e-12   
ref|XP_006924375.1|  PREDICTED: serine incorporator 2                 75.9    2e-12   
ref|NP_001011399.1|  serine incorporator 1 precursor                  75.9    2e-12   
ref|XP_010950492.1|  PREDICTED: serine incorporator 2 isoform X2      75.5    2e-12   
ref|XP_002155155.2|  PREDICTED: probable serine incorporator-like     74.3    2e-12   
gb|KJB06650.1|  hypothetical protein B456_001G003900                  75.5    2e-12   
ref|XP_005875118.1|  PREDICTED: serine incorporator 2 isoform X1      75.9    2e-12   
ref|XP_006176241.1|  PREDICTED: serine incorporator 2 isoform X1      75.9    2e-12   
ref|XP_006767105.1|  PREDICTED: serine incorporator 2 isoform X3      75.5    2e-12   
ref|XP_010666475.1|  PREDICTED: probable serine incorporator isof...  75.5    2e-12   
ref|XP_011304466.1|  PREDICTED: probable serine incorporator isof...  75.9    2e-12   
ref|XP_006102950.1|  PREDICTED: serine incorporator 2                 75.5    2e-12   
ref|XP_005875119.1|  PREDICTED: serine incorporator 2 isoform X2      75.5    2e-12   
ref|XP_003937635.1|  PREDICTED: serine incorporator 2                 75.9    2e-12   
ref|XP_006196965.1|  PREDICTED: serine incorporator 2 isoform X2      75.5    2e-12   
gb|EPQ13210.1|  Serine incorporator 2                                 75.5    2e-12   
ref|XP_007190839.1|  PREDICTED: serine incorporator 1                 75.9    2e-12   
ref|XP_004425924.1|  PREDICTED: serine incorporator 2 isoform 1       75.9    2e-12   
ref|XP_004406452.1|  PREDICTED: serine incorporator 2                 75.5    2e-12   
ref|XP_002885648.1|  TMS membrane family protein                      75.5    2e-12   
gb|ACG28988.1|  TMS membrane protein/tumor differentially express...  75.5    2e-12   
gb|EPY87330.1|  Tumor differentially expressed 2-like protein         75.5    2e-12   
gb|ELK02034.1|  Serine incorporator 2                                 75.5    2e-12   
gb|KIJ14234.1|  hypothetical protein PAXINDRAFT_163421                75.9    2e-12   
ref|XP_005395079.1|  PREDICTED: serine incorporator 2 isoform X1      75.5    2e-12   
ref|XP_006176242.1|  PREDICTED: serine incorporator 2 isoform X2      75.1    3e-12   
ref|XP_009390129.1|  PREDICTED: probable serine incorporator          75.5    3e-12   
ref|XP_006132696.1|  PREDICTED: serine incorporator 1                 75.1    3e-12   
gb|AAH46718.1|  TDE2 protein                                          75.5    3e-12   
ref|XP_011062433.1|  PREDICTED: probable serine incorporator isof...  75.5    3e-12   
ref|XP_011304467.1|  PREDICTED: probable serine incorporator isof...  75.5    3e-12   
ref|XP_007114993.1|  PREDICTED: serine incorporator 1                 75.5    3e-12   
gb|EHJ66123.1|  membrane protein TMS1                                 75.1    3e-12   
ref|XP_011062431.1|  PREDICTED: probable serine incorporator isof...  75.5    3e-12   
ref|XP_011062435.1|  PREDICTED: probable serine incorporator isof...  75.5    3e-12   
ref|XP_011062434.1|  PREDICTED: probable serine incorporator isof...  75.5    3e-12   
gb|AAH17085.2|  SERINC2 protein                                       72.4    3e-12   
gb|KIK77929.1|  hypothetical protein PAXRUDRAFT_834805                75.5    3e-12   
ref|XP_010230536.1|  PREDICTED: probable serine incorporator          75.1    3e-12   
ref|XP_004346817.1|  hypothetical protein CAOG_05132                  75.1    3e-12   
gb|EOB02909.1|  Serine incorporator 1                                 75.1    3e-12   
gb|KFW95730.1|  Serine incorporator 1                                 74.3    3e-12   
ref|XP_006158214.1|  PREDICTED: serine incorporator 2                 75.5    3e-12   
ref|XP_008342071.1|  PREDICTED: probable serine incorporator          75.1    3e-12   
gb|ELR60415.1|  Serine incorporator 1                                 75.1    3e-12   
ref|XP_005395080.1|  PREDICTED: serine incorporator 2 isoform X2      75.1    3e-12   
ref|XP_007867639.1|  TMS membrane protein/tumor differentially ex...  75.5    3e-12   
emb|CCA66643.1|  related to TMS1 protein                              75.5    3e-12   
ref|XP_011449551.1|  PREDICTED: serine incorporator 1-like isofor...  75.1    3e-12   
ref|XP_007034497.1|  Serinc-domain containing serine and sphingol...  75.5    3e-12   
ref|XP_006879047.1|  PREDICTED: serine incorporator 1                 75.1    3e-12   
ref|XP_006418745.1|  hypothetical protein EUTSA_v10002545mg           75.1    3e-12   
ref|XP_011449548.1|  PREDICTED: serine incorporator 1-like isofor...  75.1    3e-12   
ref|XP_008419538.1|  PREDICTED: serine incorporator 1-like            75.1    3e-12   



>gb|KDO36650.1| hypothetical protein CISIN_1g028965mg [Citrus sinensis]
Length=201

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -2

Query  685  SIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaV  506
            +I PASVISLYC YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVLSVVYSAV
Sbjct  29   AILPASVISLYCMYLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAV  88

Query  505  RAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSA  326
            RAGSSTTLLSPPSSPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFSLASMYSA
Sbjct  89   RAGSSTTLLSPPSSPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYSA  148

Query  325  MLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MLLTGWSTSVGESGKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  149  MLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  201



>ref|XP_009354238.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009354239.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370970.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370971.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVLSVV
Sbjct  237  AVNGSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPP SPRAG GKPLLPLDK DEHEE EKSK V+YSYSFFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPGSPRAGAGKPLLPLDKVDEHEEKEKSKPVSYSYSFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TA L++WSL+APILFP+R+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRMVTGWATAGLYIWSLLAPILFPEREF  413



>ref|XP_011073234.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073235.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073236.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 164/178 (92%), Gaps = 1/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST +L LGLLTTVLSVV
Sbjct  237  SVSGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSSLALGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEH EE EKSK VTYSYSFFH+IFSLA
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGSGKPLLPLDKADEHHEEAEKSKPVTYSYSFFHLIFSLA  356

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++T W TAALF+WSLVAPI+FPDR+F
Sbjct  357  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITSWATAALFIWSLVAPIIFPDREF  414



>ref|XP_007215456.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16655.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=397

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVLSVV
Sbjct  221  AVNGSILPASVISMYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVV  280

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEHEE EK+K V+YSYSFFHIIFSLAS
Sbjct  281  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKADEHEEKEKAKPVSYSYSFFHIIFSLAS  340

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGW+TSVGESGKLVDVGW SVWVR+VT W TA LF+WSL+APILFP+R+F
Sbjct  341  MYSAMLLTGWTTSVGESGKLVDVGWPSVWVRIVTSWATAGLFIWSLLAPILFPEREF  397



>ref|XP_008228861.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228862.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228863.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228864.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=413

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVLSVV
Sbjct  237  AVNGSILPASVISMYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEHEE EK+K V+YSYSFFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKADEHEEKEKAKPVSYSYSFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGW+TSVGESGKLVDVGW SVWVR+VT W TA LF+WSL+APILFP+R+F
Sbjct  357  MYSAMLLTGWTTSVGESGKLVDVGWPSVWVRIVTSWATAGLFIWSLLAPILFPEREF  413



>ref|XP_007215457.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 ref|XP_007215458.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16656.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16657.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=413

 Score =   241 bits (616),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVLSVV
Sbjct  237  AVNGSILPASVISMYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEHEE EK+K V+YSYSFFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKADEHEEKEKAKPVSYSYSFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGW+TSVGESGKLVDVGW SVWVR+VT W TA LF+WSL+APILFP+R+F
Sbjct  357  MYSAMLLTGWTTSVGESGKLVDVGWPSVWVRIVTSWATAGLFIWSLLAPILFPEREF  413



>ref|XP_006493450.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
Length=413

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVLSVV
Sbjct  237  AVGGSILPASVISLYCMYLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  413



>ref|XP_006427689.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
 gb|ESR40929.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
Length=413

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYC YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVLSVV
Sbjct  237  AVGGSVLPASVISLYCMYLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  413



>gb|KHG09631.1| Serine incorporator 3 [Gossypium arboreum]
Length=413

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVLSVV
Sbjct  237  AVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLP+DKADEHEE EK+K V+YSY+FFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYIWSLVAPILFPEREF  413



>gb|KJB67006.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67007.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67008.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67009.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67010.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67011.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67013.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=412

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V  SI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGT+T+GLLTT+LSVV
Sbjct  237  AVGSSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTVTVGLLTTILSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAGGGKPLLPLDKADE EE EK+KAVTYSY+FFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGGGKPLLPLDKADE-EEKEKNKAVTYSYAFFHIIFSLAS  355

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVW+R++T WVTAAL++WSL+APILFPDRDF
Sbjct  356  MYSAMLLTGWSTSVGESGKLVDVGWPSVWIRILTAWVTAALYMWSLLAPILFPDRDF  412



>ref|XP_008381162.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVLSVV
Sbjct  237  SVSGSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPR+G GKPLLPLDK DEHEE EKSK V+YSYSFFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRSGAGKPLLPLDKVDEHEEKEKSKPVSYSYSFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWS SVGESGKLVDVGW SVWVR+VT W TA L++WSL+APILFP+R+F
Sbjct  357  MYSAMLLTGWSASVGESGKLVDVGWPSVWVRMVTSWATAGLYIWSLLAPILFPEREF  413



>ref|XP_008342757.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVLSVV
Sbjct  237  AVSGSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPP SPRAG GKPLLPLDK DEH+E EKSK V+YSYSFFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPGSPRAGAGKPLLPLDKVDEHKEKEKSKPVSYSYSFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L++WSL+APILFP+R+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRMVTSWATAGLYIWSLLAPILFPEREF  413



>gb|KJB68287.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVLSVV
Sbjct  235  AVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVLSVV  294

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLP+DKADEHEE EK+K V+YSY+FFHIIFSLAS
Sbjct  295  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFSLAS  354

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  355  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLVAPILFPEREF  411



>gb|KJB68285.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68288.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68289.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=413

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVLSVV
Sbjct  237  AVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLP+DKADEHEE EK+K V+YSY+FFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLVAPILFPEREF  413



>ref|XP_004158797.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
 gb|KGN45209.1| hypothetical protein Csa_7G431410 [Cucumis sativus]
Length=411

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGTL+LGLLTTVLSVV
Sbjct  237  AVGGSVLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTLSLGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPL+KADEHEE EKSK VTYSYSFFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAG--KPLLPLEKADEHEEKEKSKPVTYSYSFFHIIFSLAS  354

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGW+TSVG SG+LVDVGWASVWVRVVTGW TAALF+WSL+AP+LFPDRDF
Sbjct  355  MYSAMLLTGWTTSVGGSGRLVDVGWASVWVRVVTGWATAALFIWSLIAPVLFPDRDF  411



>ref|XP_009365247.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009365248.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVLSVV
Sbjct  237  SVSGSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPP+SPR+G GKPLLPLDK DEHEE EKSK V+YSY+FFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPNSPRSGAGKPLLPLDKVDEHEEKEKSKPVSYSYAFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWS SVGESGKLVDVGW SVWVR+VT W TA L++WSL+APILFP+R+F
Sbjct  357  MYSAMLLTGWSASVGESGKLVDVGWPSVWVRMVTSWATAGLYIWSLLAPILFPEREF  413



>ref|XP_007024820.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 ref|XP_007024821.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27442.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27443.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
Length=413

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLT GLLTTVLSVV
Sbjct  237  AVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTFGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GK LLPLDKADE EE +K+K VTYSY+FFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKSLLPLDKADEQEEKDKNKPVTYSYAFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L+LWSL+APILFP+R+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYLWSLIAPILFPEREF  413



>ref|XP_009615680.1| PREDICTED: serine incorporator 3 isoform X2 [Nicotiana tomentosiformis]
Length=413

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV+GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTVLSVV
Sbjct  237  SVRGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPEREF  413



>ref|XP_009759114.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009759115.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTVLSVV
Sbjct  237  SVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  413



>ref|XP_010318692.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
Length=413

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+GTL LGLLTTVLSVV
Sbjct  237  SVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGTLALGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E+SK V+YSYSFFH+IFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGSGKPLLPLDKVDEEEEKERSKPVSYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  413



>ref|XP_011466994.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466995.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466996.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466997.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
Length=414

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YCTYLCYSALASEPRDYECN+LHKHSK+VSTGTLTLGLLTTVLSVV
Sbjct  238  TVGGSILPASVISVYCTYLCYSALASEPRDYECNSLHKHSKAVSTGTLTLGLLTTVLSVV  297

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK +E EE EK+K+V+YSY+FFHIIFSLAS
Sbjct  298  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKPEEREENEKAKSVSYSYAFFHIIFSLAS  357

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKL+DVGW SVWVRV+T W TA L++WSL+APILFP+R+F
Sbjct  358  MYSAMLLTGWSTSVGESGKLIDVGWPSVWVRVMTSWATAGLYIWSLLAPILFPEREF  414



>ref|XP_009615679.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTVLSVV
Sbjct  237  SVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPEREF  413



>gb|KJB68286.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVLSVV
Sbjct  237  AVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG  KPLLP+DKADEHEE EK+K V+YSY+FFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAG--KPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFSLAS  354

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  355  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLVAPILFPEREF  411



>ref|XP_006341429.1| PREDICTED: probable serine incorporator-like isoform X1 [Solanum 
tuberosum]
Length=413

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+GTL LGLLTTVLSVV
Sbjct  237  SVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGTLALGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E+SK V+YSYSFFH+IFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERSKPVSYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGE+G LVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  357  MYSAMLLTGWSTSVGENGNLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  413



>gb|AFK43836.1| unknown [Medicago truncatula]
Length=190

 Score =   222 bits (565),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 3/177 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS YC YLCYSALASEPRDYECN LHKHSK+VSTG+LTLGL+TTVLSVV
Sbjct  17   AVNGSVLPASVISFYCMYLCYSALASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVLSVV  76

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSS T+LSPPSSPRAG  KPLLPLD  DE E  EK+K VTYSY+FFH+IFSLAS
Sbjct  77   YSAVRAGSSATVLSPPSSPRAG--KPLLPLDAKDE-ESNEKAKPVTYSYAFFHLIFSLAS  133

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  134  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  190



>ref|XP_004135884.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
Length=422

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 163/183 (89%), Gaps = 8/183 (4%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltl------gllt  536
            +V GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGTL+L        LT
Sbjct  242  AVGGSVLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTLSLGLLTTVLSLT  301

Query  535  tvlsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHI  356
            TVLSVVYSAVRAGSSTTLLSPPSSP AG  KPLLPL+KADEHEE EKSK VTYSYSFFHI
Sbjct  302  TVLSVVYSAVRAGSSTTLLSPPSSPYAG--KPLLPLEKADEHEEKEKSKPVTYSYSFFHI  359

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IFSLASMYSAMLLTGW+TSVG SG+LVDVGWASVWVRVVTGW TAALF+WSL+AP+LFPD
Sbjct  360  IFSLASMYSAMLLTGWTTSVGGSGRLVDVGWASVWVRVVTGWATAALFIWSLIAPVLFPD  419

Query  175  RDF  167
            RDF
Sbjct  420  RDF  422



>gb|KDO36651.1| hypothetical protein CISIN_1g028965mg [Citrus sinensis]
Length=161

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -2

Query  646  YLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGssttllspps  467
            YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVLSVVYSAVRAGSSTTLLSPPS
Sbjct  2    YLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAVRAGSSTTLLSPPS  61

Query  466  sPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGES  287
            SPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGES
Sbjct  62   SPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGES  121

Query  286  GKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            GKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  122  GKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  161



>ref|XP_009759116.1| PREDICTED: probable serine incorporator isoform X2 [Nicotiana 
sylvestris]
Length=411

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 164/177 (93%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTVLSVV
Sbjct  237  SVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPLDK DE EE E++K VTYSYSFFH+IFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLAS  354

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  355  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  411



>gb|EYU21792.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21793.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21794.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=416

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 164/180 (91%), Gaps = 3/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST +L LGLLTTVLSVV
Sbjct  237  SVSGSLLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSSLGLGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHIIFS  347
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEH E E+    +AVTYSYSFFH+IFS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGSGKPLLPLDKADEHHEEEEKSKSRAVTYSYSFFHLIFS  356

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR++T W TAALF+WSLVAPILFPDR+F
Sbjct  357  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRIITSWATAALFIWSLVAPILFPDREF  416



>ref|XP_002270610.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 ref|XP_010655133.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 emb|CBI25248.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASV+SLYC YLCYS L+SEPRDYECN LHKHSK+VSTGTLTLGLLTT+LSV+
Sbjct  237  AVGGSILPASVVSLYCMYLCYSGLSSEPRDYECNGLHKHSKAVSTGTLTLGLLTTILSVI  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPL+K D  EE  ++K VTYSY+FFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLEKTDVPEEKHEAKPVTYSYTFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  357  MYSAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  413



>ref|XP_011020548.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=415

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYC YLCYS LASEPR+YECN LH+HSK+VSTGTL++GLLTTVLSVV
Sbjct  237  AVNGSVLPASVISLYCMYLCYSGLASEPREYECNGLHRHSKAVSTGTLSIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKS-KAVTYSYSFFHIIFSL  344
            YSAVRAGSST LLSPPSSPRAG  KPLLPLD KA+E EE EK+ K VTYSYSFFHIIFSL
Sbjct  297  YSAVRAGSSTALLSPPSSPRAGADKPLLPLDNKANEQEEKEKARKPVTYSYSFFHIIFSL  356

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLLTGWSTS+GESGKLVDVGW SVWVR++TGW TA L+ WSLVAPILFPDR+F
Sbjct  357  ASMYSAMLLTGWSTSIGESGKLVDVGWPSVWVRILTGWATAGLYTWSLVAPILFPDREF  415



>ref|XP_009615681.1| PREDICTED: probable serine incorporator isoform X3 [Nicotiana 
tomentosiformis]
Length=411

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTVLSVV
Sbjct  237  SVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPLDK DE EE E++K VTYSYSFFH+IFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLAS  354

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+F
Sbjct  355  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPEREF  411



>ref|XP_011082649.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI P+SVISLYC YLCYS LASEPRDYECN LH+HSK+VST +L +GLLTTVLSVV
Sbjct  237  SVSGSILPSSVISLYCMYLCYSGLASEPRDYECNGLHRHSKAVSTSSLAIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADE  E ++    VTYSYSFFH+IFSLA
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGSGKPLLPLDKADEEHEEKEKSKPVTYSYSFFHLIFSLA  356

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WSLVAPI+FPDR+F
Sbjct  357  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSLVAPIIFPDREF  414



>gb|EMS53525.1| putative serine incorporator [Triticum urartu]
Length=316

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK++STG+LTLGL TT+LSVVY
Sbjct  141  VNGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAMSTGSLTLGLCTTILSVVY  200

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            SAVRAGSS T+LS P SPRAG  KPLLP  KADE E  +  K VTYSYSFFH+IFSLASM
Sbjct  201  SAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEETKDVPKPVTYSYSFFHLIFSLASM  260

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  261  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPLLFPDREF  316



>ref|XP_006341430.1| PREDICTED: probable serine incorporator-like isoform X2 [Solanum 
tuberosum]
Length=411

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 163/177 (92%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+GTL LGLLTTVLSVV
Sbjct  237  SVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGTLALGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPLDK DE EE E+SK V+YSYSFFH+IFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERSKPVSYSYSFFHLIFSLAS  354

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGE+G LVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  355  MYSAMLLTGWSTSVGENGNLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  411



>gb|ABR25551.1| serine incorporator 3 [Oryza sativa Indica Group]
Length=220

 Score =   218 bits (554),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            + GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+LSVVY
Sbjct  44   INGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVY  103

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIFSLAS  338
            SAVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IFSLAS
Sbjct  104  SAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIFSLAS  163

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  164  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDREF  220



>ref|XP_007140603.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
 gb|ESW12597.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
Length=410

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 3/177 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGT+T+GL+TTVLSVV
Sbjct  237  AVNGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTVTMGLVTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSS  +LSPPSSPRAG  KPLLPLD A E E+ EK+K VTYSY+FFH+IFSLAS
Sbjct  297  YSAVRAGSSAAVLSPPSSPRAG--KPLLPLD-AREEEDKEKAKPVTYSYAFFHLIFSLAS  353

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  354  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTSWATALLYLWSLVAPIMFPEREF  410



>ref|XP_009399576.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PAS+ISLYCTYLCYS L+SEPRDYECN LH HSK VSTG+LTLGLLTTVLSVVY
Sbjct  238  VNGSLLPASIISLYCTYLCYSGLSSEPRDYECNGLHNHSKVVSTGSLTLGLLTTVLSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM--EKSKAVTYSYSFFHIIFSLA  341
            SAVRAGSST+L SPPSSPRAG  KPLLP DK DE E+   +++K V+YSY+FFH+IFSLA
Sbjct  298  SAVRAGSSTSLFSPPSSPRAGSEKPLLPFDKLDEQEDKKNDEAKPVSYSYTFFHLIFSLA  357

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKL+DVGW SVWVR+VTGW TAALF+WSLVAP++FPDR+F
Sbjct  358  SMYSAMLLTGWSTSVGESGKLIDVGWPSVWVRIVTGWATAALFMWSLVAPLIFPDREF  415



>gb|KDP41926.1| hypothetical protein JCGZ_26944 [Jatropha curcas]
Length=413

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 4/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YC YLCYS LASEPRDYECN LHKHSK+VSTGTLT+GL TTVLSVV
Sbjct  237  AVNGSILPASVISVYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTLTVGLFTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKA--DEHEEMEKSKAVTYSYSFFHIIFSL  344
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPL+ +  + HEE +K K VTYSY+FFHIIFSL
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAG--KPLLPLENSTGEHHEEKDKVKPVTYSYAFFHIIFSL  354

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRV+TGW TA L+LWSLVAPI+FPDR+F
Sbjct  355  ASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVITGWATAGLYLWSLVAPIMFPDREF  413



>ref|XP_008461193.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Cucumis melo]
Length=416

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 133/180 (74%), Gaps = 3/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            ++ GS+ PASVISLYC YLCYS LASEPRDYECN LHKHS  +S GT  + + +      
Sbjct  237  AIGGSVLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSVEISCGTSXISISSKEGDFF  296

Query  517  ysaVRAGssttllsppssPRAG---GGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    S                 GKPLLPL+K+DEHEE EKSK VTYSYSFFHIIFS
Sbjct  297  SLHFVCSVSYIEFIRCHILDFSIKWAGKPLLPLEKSDEHEEKEKSKPVTYSYSFFHIIFS  356

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW+TSVG SGKLVDVGWASVWVR+VTGW TAALF+WSL+AP+LFPDRDF
Sbjct  357  LASMYSAMLLTGWTTSVGGSGKLVDVGWASVWVRIVTGWATAALFIWSLIAPVLFPDRDF  416



>ref|XP_010268463.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=414

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 160/178 (90%), Gaps = 1/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYCTYLC+S LASEPRDYECN  H+H+K+VSTGTLTLGL TTVLSVV
Sbjct  237  AVGGSILPASVISLYCTYLCFSGLASEPRDYECNGFHRHTKAVSTGTLTLGLFTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDK-ADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLL  P SPR G  KPLLP++K ADE E+ ++++ VTYSY+FFH+IFSLA
Sbjct  297  YSAVRAGSSTTLLLEPDSPRGGADKPLLPMNKTADEDEKKDEARPVTYSYAFFHVIFSLA  356

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESG LVDVGW SVWVR+VTGWVTAAL++WSLVAP+LFP+R+F
Sbjct  357  SMYSAMLLTGWSTSVGESGNLVDVGWPSVWVRIVTGWVTAALYIWSLVAPLLFPEREF  414



>ref|XP_004492298.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=410

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 160/177 (90%), Gaps = 3/177 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGL+TTVLSVV
Sbjct  237  SVNGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLVTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSS T+LSPPSSPRAG  KPLLPLD   E E  EK+K VTYSY+FFH+IFSLAS
Sbjct  297  YSAVRAGSSATVLSPPSSPRAG--KPLLPLD-VKEEESNEKAKPVTYSYAFFHLIFSLAS  353

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  354  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  410



>gb|EMT13726.1| Putative serine incorporator [Aegilops tauschii]
Length=414

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK++STG+LTLGL TT+LSVVY
Sbjct  239  VNGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAMSTGSLTLGLCTTILSVVY  298

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            SAVRAGSS T+LS P SPRAG  KPLLP  KADE E  +  K VTYSYSFFH+IFSLASM
Sbjct  299  SAVRAGSSATVLSAPDSPRAGSDKPLLPFSKADEEETKDVPKPVTYSYSFFHLIFSLASM  358

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            YSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  359  YSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPLLFPDREF  414



>gb|EYU21795.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=414

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 163/180 (91%), Gaps = 5/180 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST +L LGLLTTVLSVV
Sbjct  237  SVSGSLLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSSLGLGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHIIFS  347
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPLDKADEH E E+    +AVTYSYSFFH+IFS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAG--KPLLPLDKADEHHEEEEKSKSRAVTYSYSFFHLIFS  354

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR++T W TAALF+WSLVAPILFPDR+F
Sbjct  355  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRIITSWATAALFIWSLVAPILFPDREF  414



>ref|XP_010687311.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687312.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDY+CN LHKHS++VST +LTLGLLTTVLSVV
Sbjct  237  AVNGSILPASVISLYCMYLCYSGLASEPRDYQCNGLHKHSQAVSTTSLTLGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG G+PLLPLDK  E EE EK+K V+YSYSFFHIIFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGRPLLPLDKVAEEEEKEKAKPVSYSYSFFHIIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGW+TSVGESGKLVDVGW+SVWVR+VTGW TAAL++WSLVAP LFPDR+F
Sbjct  357  MYSAMLLTGWTTSVGESGKLVDVGWSSVWVRIVTGWATAALYIWSLVAPSLFPDREF  413



>gb|AFK46909.1| unknown [Lotus japonicus]
Length=353

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 158/177 (89%), Gaps = 3/177 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI P+SVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGLLTT LSVV
Sbjct  180  AVNGSILPSSVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLLTTTLSVV  239

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSS T+LSPPSSPRAG  KPLLPLD  +E E+ EK K VTYSYSFFH+IFSLAS
Sbjct  240  YSAVRAGSSATVLSPPSSPRAG--KPLLPLD-GNEEEKNEKGKPVTYSYSFFHLIFSLAS  296

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MY AMLLTGWS SVGESGKLVDVGW SVWVR+VT W TA LFLWSLVAPI+FP+R+F
Sbjct  297  MYFAMLLTGWSPSVGESGKLVDVGWPSVWVRIVTCWATAILFLWSLVAPIMFPEREF  353



>gb|KEH22798.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=410

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 3/177 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS YC YLCYSALASEPRDYECN LHKHSK+VSTG+LTLGL+TTVLSVV
Sbjct  237  AVNGSVLPASVISFYCMYLCYSALASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSS T+LSPPSSPRAG  KPLLPLD  DE E  EK+K VTYSY+FFH+IFSLAS
Sbjct  297  YSAVRAGSSATVLSPPSSPRAG--KPLLPLDAKDE-ESNEKAKPVTYSYAFFHLIFSLAS  353

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  354  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  410



>gb|KEH22799.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=427

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 3/177 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS YC YLCYSALASEPRDYECN LHKHSK+VSTG+LTLGL+TTVLSVV
Sbjct  254  AVNGSVLPASVISFYCMYLCYSALASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVLSVV  313

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSS T+LSPPSSPRAG  KPLLPLD  DE E  EK+K VTYSY+FFH+IFSLAS
Sbjct  314  YSAVRAGSSATVLSPPSSPRAG--KPLLPLDAKDE-ESNEKAKPVTYSYAFFHLIFSLAS  370

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  371  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  427



>ref|XP_010107188.1| putative serine incorporator [Morus notabilis]
 gb|EXC14084.1| putative serine incorporator [Morus notabilis]
Length=413

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PAS+ISLYCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVLSVV
Sbjct  237  TVSGSILPASIISLYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK +EHEE EK+K VTYSYSFFH+IFSLAS
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVEEHEEKEKAKPVTYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  357  MYSAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  413



>ref|XP_003570284.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=414

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            + GS+ PASVI+LYCTYLCYSAL+SEPRDY+CN LH HSK++STG+LTLGL+TT+LSVVY
Sbjct  238  INGSLLPASVIALYCTYLCYSALSSEPRDYKCNGLHNHSKAMSTGSLTLGLITTILSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHE-EMEKSKAVTYSYSFFHIIFSLAS  338
            SAVRAGSS T+LS P SPRAG  KPLLP  KADE E + +  K VTYSYSFFH+IFSLAS
Sbjct  298  SAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEEAKKDVPKPVTYSYSFFHLIFSLAS  357

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAPILFPDR+F
Sbjct  358  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRMATQWATAGLFVWSLVAPILFPDREF  414



>emb|CDO98258.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST TLT+GLLTTVLSVV
Sbjct  237  SVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSTLTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSP        GKPLLPLDKAD+ EE EK+K VTYSYSFFH+IFSLAS
Sbjct  297  YSAVRAGSSTTLLSPSPPSSPRAGKPLLPLDKADKEEEKEKAKPVTYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGWASVWVR+VTGW TAALFLWSLVAPILFPDR+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRIVTGWATAALFLWSLVAPILFPDREF  413



>ref|XP_006649122.1| PREDICTED: probable serine incorporator-like, partial [Oryza 
brachyantha]
Length=384

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            + GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+LSVVY
Sbjct  208  INGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVY  267

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIFSLAS  338
            SAVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IFSLAS
Sbjct  268  SAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIFSLAS  327

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  328  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDREF  384



>gb|EAZ24909.1| hypothetical protein OsJ_08689 [Oryza sativa Japonica Group]
Length=414

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            + GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+LSVVY
Sbjct  238  INGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIFSLAS  338
            SAVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IFSLAS
Sbjct  298  SAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIFSLAS  357

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  358  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDREF  414



>ref|NP_001048364.1| Os02g0792900 [Oryza sativa Japonica Group]
 dbj|BAD19186.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAD19654.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAF10278.1| Os02g0792900 [Oryza sativa Japonica Group]
 gb|EAY87831.1| hypothetical protein OsI_09251 [Oryza sativa Indica Group]
 dbj|BAG96913.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97616.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 154/177 (87%), Gaps = 1/177 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            + GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+LSVVY
Sbjct  238  INGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTILSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIFSLAS  338
            SAVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IFSLAS
Sbjct  298  SAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIFSLAS  357

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  358  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDREF  414



>ref|XP_008790112.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
 ref|XP_008778863.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
Length=415

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASV+SLYC YLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVY
Sbjct  238  VNGSLLPASVLSLYCAYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHIIFSLA  341
            SAVRAGSST++LSPPSSPRAG  KPLLP DK ++ E+ +K  +K V+YSYSFF++IFSLA
Sbjct  298  SAVRAGSSTSVLSPPSSPRAGSEKPLLPFDKVEQQEDRKKDEAKPVSYSYSFFYLIFSLA  357

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TAAL++WSL+APILFPDR+F
Sbjct  358  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTEWATAALYIWSLIAPILFPDREF  415



>ref|XP_008794380.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=415

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 2/178 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVISLYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVY
Sbjct  238  VNGSLLPASVISLYCTYLCYSGLSSEPRDYECNGLHGHSKAVSTGSLTLGLLTTVLSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHIIFSLA  341
            SAVRAGSSTTLLSPPSSPRA   +PLLP DK ++ E+ +K  +K V+YSYSFFH+IFSLA
Sbjct  298  SAVRAGSSTTLLSPPSSPRASSERPLLPFDKVEQQEDRKKDEAKPVSYSYSFFHLIFSLA  357

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAAL++WSL+APILFPDR+F
Sbjct  358  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALYIWSLIAPILFPDREF  415



>ref|XP_009383181.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVISLYCTYLCYS ++SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVY
Sbjct  238  VNGSLLPASVISLYCTYLCYSGISSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHIIFSLA  341
            SAVRAGSSTTL+SPPSSPRAG  KPLLP DK +E E+ +K  +K V+YSY+FFH+IFSLA
Sbjct  298  SAVRAGSSTTLISPPSSPRAGSEKPLLPFDKLEEQEDKKKDEAKPVSYSYAFFHLIFSLA  357

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVG SGKLVDVGW SVWVR++TGW TA+LF+WSL+AP++FP+R F
Sbjct  358  SMYSAMLLTGWSTSVGGSGKLVDVGWPSVWVRIITGWATASLFIWSLIAPLIFPERVF  415



>gb|ABK96018.1| unknown [Populus trichocarpa]
Length=414

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYC YLCYS L+SEPR+YECN LH+HSK+VST TLT+GLLTTVLSVV
Sbjct  237  AVNGSVLPASVISLYCMYLCYSGLSSEPREYECNGLHRHSKAVSTSTLTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPLD K  E EE EK+K VTYSYSFFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGADKPLLPLDNKPSEKEEKEKAKPVTYSYSFFHIIFSLA  356

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFPDR+F
Sbjct  357  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAGLYIWSLVAPILFPDREF  414



>ref|XP_010532058.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
 ref|XP_010532059.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
Length=414

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 160/178 (90%), Gaps = 1/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YC YLCYS LASEPRDYECN LHKH+K+VSTGT+T+GLLTTVLSVV
Sbjct  237  TVGGSILPASVISMYCMYLCYSGLASEPRDYECNGLHKHAKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPLD   E +E ++    VTYSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGSEKPLLPLDGKAEEKEDKEKSKPVTYSYAFFHIIFSLA  356

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSLVAPILFPDR+F
Sbjct  357  SMYSAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLVAPILFPDREF  414



>ref|XP_010914044.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=415

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASV+SLYC YLCYS L+SEPRDYECN LH HS++VSTG+LTLGLLTTVLSV+Y
Sbjct  238  VNGSLLPASVLSLYCAYLCYSGLSSEPRDYECNGLHNHSEAVSTGSLTLGLLTTVLSVIY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM--EKSKAVTYSYSFFHIIFSLA  341
            SAVRAGSSTT+LSPPSSPRAG  KPLLP D  ++ E+   +++K V+YSYSFF++IFSLA
Sbjct  298  SAVRAGSSTTVLSPPSSPRAGAEKPLLPFDTVEQQEDRKNDEAKPVSYSYSFFYLIFSLA  357

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMY+AMLLTGWSTSVGESGKLVDVGW+SVWVR+VT W TAAL++WSL+APILFPDR+F
Sbjct  358  SMYAAMLLTGWSTSVGESGKLVDVGWSSVWVRIVTQWATAALYIWSLIAPILFPDREF  415



>ref|XP_010929190.1| PREDICTED: probable serine incorporator isoform X1 [Elaeis guineensis]
Length=423

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 161/186 (87%), Gaps = 10/186 (5%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVISLYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVY
Sbjct  238  VNGSLLPASVISLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVY  297

Query  514  saVRAGssttllsppssPRA--------GGGKPLLPLDKADEHEEMEKSKA--VTYSYSF  365
            SAVRAGSST+LLSPPSSPRA        G  KPLLP DK ++ E+ +K +A  ++YSY F
Sbjct  298  SAVRAGSSTSLLSPPSSPRAISCVQPGVGSEKPLLPFDKVEQQEDRKKDEAKLISYSYPF  357

Query  364  FHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            FH+IFSLASMYSAMLLTGWSTS+GESGKLVDVGW SVWVR+VTGW TAAL++WSL+AP+L
Sbjct  358  FHLIFSLASMYSAMLLTGWSTSIGESGKLVDVGWPSVWVRIVTGWATAALYIWSLIAPML  417

Query  184  FPDRDF  167
            FPDR+F
Sbjct  418  FPDREF  423



>ref|XP_010929191.1| PREDICTED: probable serine incorporator isoform X2 [Elaeis guineensis]
Length=415

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVISLYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVY
Sbjct  238  VNGSLLPASVISLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLA  341
            SAVRAGSST+LLSPPSSPRA   KPLLP DK ++ E+ +K +A  ++YSY FFH+IFSLA
Sbjct  298  SAVRAGSSTSLLSPPSSPRASSEKPLLPFDKVEQQEDRKKDEAKLISYSYPFFHLIFSLA  357

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTS+GESGKLVDVGW SVWVR+VTGW TAAL++WSL+AP+LFPDR+F
Sbjct  358  SMYSAMLLTGWSTSIGESGKLVDVGWPSVWVRIVTGWATAALYIWSLIAPMLFPDREF  415



>ref|XP_002454688.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
 gb|EES07664.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
Length=413

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            + GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVY
Sbjct  238  INGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLAS  338
            SAVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IFSLAS
Sbjct  298  SAVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAPILFPDR+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPILFPDREF  413



>ref|XP_004954190.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=413

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTT+LSVVY
Sbjct  238  VNGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTILSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLAS  338
            SAVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IFSLAS
Sbjct  298  SAVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTS+GESGKLVDVGW SVWVR+ T W TA LF+WSLVAPILFPDR+F
Sbjct  357  MYSAMLLTGWSTSIGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPILFPDREF  413



>ref|XP_006307669.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
 gb|EOA40567.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
Length=412

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 159/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  TVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPP SPRA   KPLLPLD KADE EE E  K V+YSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPDSPRAE--KPLLPLDGKADEKEEKENKKPVSYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  355  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>ref|XP_011034606.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034607.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034608.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=414

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 159/178 (89%), Gaps = 1/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYC YLCYS L+SEPR+YECN LH+HSK+VST TLT+GLLTTVLSVV
Sbjct  237  AVNGSVLPASVISLYCMYLCYSGLSSEPREYECNGLHRHSKAVSTSTLTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSS TLLSPPSSPRAG  KPLLPLD K  E EE EK+K VTYSYSFFHIIFSLA
Sbjct  297  YSAVRAGSSNTLLSPPSSPRAGADKPLLPLDNKPSEKEEKEKAKPVTYSYSFFHIIFSLA  356

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWS SVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFPDR+F
Sbjct  357  SMYSAMLLTGWSASVGESGKLVDVGWPSVWVRILTGWATAGLYIWSLVAPILFPDREF  414



>ref|XP_002297693.2| TMS membrane family protein [Populus trichocarpa]
 gb|EEE82498.2| TMS membrane family protein [Populus trichocarpa]
Length=414

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 160/178 (90%), Gaps = 1/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYC YLCYS L+SEPR+YECN LH+HSK+VST TLT+GLLTTVLSVV
Sbjct  237  AVNGSVLPASVISLYCMYLCYSGLSSEPREYECNGLHRHSKAVSTSTLTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPPSSP AG  KPLLPLD K  E EE EK+K VTYSYSFFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPSSPHAGADKPLLPLDNKPSEKEEKEKAKPVTYSYSFFHIIFSLA  356

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFPDR+F
Sbjct  357  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAGLYIWSLVAPILFPDREF  414



>ref|XP_010459155.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 159/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  AVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPP SPRA   KPLLPLD KADE EE E  K V+YSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPDSPRAE--KPLLPLDGKADEKEEKECKKPVSYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  355  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>ref|XP_010497691.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497697.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497701.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497705.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 159/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  AVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPP SPRA   KPLLPLD KADE EE E  K V+YSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPDSPRAE--KPLLPLDGKADEKEEKECKKPVSYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSL+APILFPDR+F
Sbjct  355  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLIAPILFPDREF  412



>ref|XP_010063622.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
Length=414

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 158/178 (89%), Gaps = 1/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PA+VISLYC YLCYS LASEPRDYECN LH HSK+VSTGTLTLGL+TTVLSVV
Sbjct  237  AVNGSILPAAVISLYCMYLCYSGLASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK-AVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPPSSPRA  GKPLLPLD   E EE ++    VTYSYSFFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAAAGKPLLPLDNKAEEEEEKEKSKTVTYSYSFFHIIFSLA  356

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAM+LTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  357  SMYSAMILTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  414



>gb|ACL54492.1| unknown [Zea mays]
Length=413

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            + GS+ PASVI +YCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVY
Sbjct  238  INGSLLPASVIGMYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLAS  338
            SAVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IFSLAS
Sbjct  298  SAVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPVLFPDREF  413



>ref|NP_001130490.1| hypothetical protein precursor [Zea mays]
 gb|ACF78724.1| unknown [Zea mays]
 gb|ACN28943.1| unknown [Zea mays]
 gb|AFW73836.1| hypothetical protein ZEAMMB73_916907 [Zea mays]
Length=413

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            + GS+ PASVI +YCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVLSVVY
Sbjct  238  INGSLLPASVIGMYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVLSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLAS  338
            SAVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IFSLAS
Sbjct  298  SAVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIFSLAS  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  357  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPVLFPDREF  413



>ref|XP_006845424.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
 gb|ERN07099.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
Length=415

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 159/178 (89%), Gaps = 2/178 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YCTYLCYSAL+SEPRDYECN LH HSK+VSTGTLTLGLLTTVLSVVY
Sbjct  238  VNGSLLPASVISVYCTYLCYSALSSEPRDYECNGLHHHSKAVSTGTLTLGLLTTVLSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHIIFSLA  341
            SAVRAGSSTTLLSPPSSPRAG  KPLL  DK ++ E+ +K  +K V+YSYSFFH+IFSLA
Sbjct  298  SAVRAGSSTTLLSPPSSPRAGSEKPLLSFDKLEKQEDKKKHEAKPVSYSYSFFHLIFSLA  357

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWS+SVGESG+LVDVGW SVWVR++T W TA LF+WSL+AP LFP+R+F
Sbjct  358  SMYSAMLLTGWSSSVGESGQLVDVGWPSVWVRIITQWATAGLFVWSLIAPHLFPEREF  415



>gb|KCW70853.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=316

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PA+VISLYC YLCYS LASEPRDYECN LH HSK+VSTGTLTLGL+TTVLSVV
Sbjct  141  AVNGSILPAAVISLYCMYLCYSGLASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVLSVV  200

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK-AVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPLD   E EE ++    VTYSYSFFHIIFSLA
Sbjct  201  YSAVRAGSSTTLLSPPSSPRAG--KPLLPLDNKAEEEEEKEKSKTVTYSYSFFHIIFSLA  258

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAM+LTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  259  SMYSAMILTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  316



>ref|XP_010476724.1| PREDICTED: serine incorporator 3 [Camelina sativa]
Length=412

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  AVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPP SP A   KPLLPLD KADE EE E  K V+YSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPDSPPAE--KPLLPLDGKADEKEEKECKKPVSYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  355  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>emb|CDY52849.1| BnaA09g56410D [Brassica napus]
Length=400

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 160/178 (90%), Gaps = 2/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  224  AVGGSILPASVISVYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  283

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLS P SPRAG  KPLLPLD KA++ EE E+ K VTYSY+FFHIIFSLA
Sbjct  284  YSAVRAGSSTTLLSSPDSPRAGE-KPLLPLDGKAEDKEEKEQKKPVTYSYAFFHIIFSLA  342

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  343  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  400



>ref|XP_009117776.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
 ref|XP_009117777.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
Length=413

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 157/178 (88%), Gaps = 2/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  AVGGSILPASVISVYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLS P SPRAG  KPLLPLD   E +E ++ K  VTYSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSSPDSPRAGE-KPLLPLDGKAEDKEEKEQKKPVTYSYAFFHIIFSLA  355

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  356  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  413



>ref|XP_010246591.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=409

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSIFPAS ISL+CTYLCYS LASEPRDYECN LH+HSK+V TGT+ LGLLTTV+SVV
Sbjct  232  AVGGSIFPASAISLFCTYLCYSGLASEPRDYECNGLHQHSKTVPTGTIILGLLTTVVSVV  291

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLA  341
            YSAVRAGSST+L S  +  R G  K L+PL+K DE EE E  S+  TYSY+FFH+IFSLA
Sbjct  292  YSAVRAGSSTSLFSESTLSRVGEEKHLIPLNKTDEEEEEEDESRPATYSYAFFHVIFSLA  351

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGE GKLVDVGW SVWVR+VTGW TAA+++WSLVAP+LFPDR+F
Sbjct  352  SMYSAMLLTGWSTSVGEIGKLVDVGWPSVWVRIVTGWATAAVYIWSLVAPLLFPDREF  409



>emb|CDX81752.1| BnaC08g38490D [Brassica napus]
Length=412

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  AVGGSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLS P SPRA   KPLLPLD KA+E EE E+ K VTYSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSSPDSPRAE--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDRDF
Sbjct  355  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRDF  412



>ref|XP_009110458.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
 ref|XP_009110459.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
Length=412

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 160/178 (90%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  AVGGSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPP SPRAG  KPLLPLD KA+E EE E+ K VTYSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPDSPRAG--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WS+VAPILFPDR+F
Sbjct  355  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSVVAPILFPDREF  412



>emb|CDY70974.1| BnaAnng35710D [Brassica napus]
Length=412

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 160/178 (90%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  AVGGSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPP SPRAG  KPLLPLD KA+E EE E+ K VTYSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPDSPRAG--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WS+VAPILFPDR+F
Sbjct  355  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSVVAPILFPDREF  412



>ref|XP_010063623.1| PREDICTED: probable serine incorporator isoform X2 [Eucalyptus 
grandis]
 gb|KCW70852.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=412

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PA+VISLYC YLCYS LASEPRDYECN LH HSK+VSTGTLTLGL+TTVLSVV
Sbjct  237  AVNGSILPAAVISLYCMYLCYSGLASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK-AVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPLD   E EE ++    VTYSYSFFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAG--KPLLPLDNKAEEEEEKEKSKTVTYSYSFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAM+LTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  355  SMYSAMILTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  412



>ref|XP_003532291.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN07179.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 3/177 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGL TTVLSVV
Sbjct  237  AVNGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLATTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSS  +LSPPSSPRAG  KPLLPLD  ++ EE EK+K VTYSY+FFH+IFSLAS
Sbjct  297  YSAVRAGSSAAVLSPPSSPRAG--KPLLPLDAKED-EEKEKAKPVTYSYAFFHLIFSLAS  353

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR++T W TA L+LWSLVAPI+FP+R+F
Sbjct  354  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITSWATALLYLWSLVAPIMFPEREF  410



>ref|XP_003552131.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN15373.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 160/177 (90%), Gaps = 3/177 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGT+TLGL TTVLSVV
Sbjct  237  AVNGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTITLGLATTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSS  +LSPPSSPRAG  KPLLPLD  ++ EE EK+K VTYSY+FFH+IFSLAS
Sbjct  297  YSAVRAGSSAAVLSPPSSPRAG--KPLLPLDAKED-EEKEKAKPVTYSYAFFHLIFSLAS  353

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR++T W TA L+LWSL+API+FP+R+F
Sbjct  354  MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITSWATALLYLWSLIAPIMFPEREF  410



>ref|XP_002890152.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66411.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 159/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  AVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPP SPRA   KPLLP+D KA+E EE E  K V+YSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPDSPRAE--KPLLPIDGKAEEKEEKENKKPVSYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  355  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>ref|XP_002512768.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF49271.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=413

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 158/179 (88%), Gaps = 4/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS YC YLCYS LASEPR+YECN LHKHSK+VSTGTL++GLLTTVLSVV
Sbjct  237  AVSGSILPASVISAYCMYLCYSGLASEPREYECNGLHKHSKAVSTGTLSIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSL  344
            YSAVRAGSSTTLLSPPSSPRAG  KPLLPL+     E  EK KA  VTYSY+FFHIIFSL
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAG--KPLLPLENKIAEEHEEKEKAKPVTYSYAFFHIIFSL  354

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSL+APILFPDR+F
Sbjct  355  ASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLLAPILFPDREF  413



>ref|NP_173069.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 ref|NP_001185008.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAF18512.1|AC010924_25 Contains similarity to gb|AF181686 membrane protein TMS1d from 
Drosophila melanogaster. ESTs gb|R64994, gb|AI994832, gb|Z47674 
come from this gene [Arabidopsis thaliana]
 gb|AEE29416.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEE29417.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=412

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 158/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVISLYC YLCYS LASEPRDYECN LH HSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  TVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHNHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPP SPRA   KPLLP+D KA+E EE E  K V+YSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPDSPRAE--KPLLPIDGKAEEKEEKENKKPVSYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  355  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>ref|XP_006416842.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 ref|XP_006416843.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35195.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35196.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
Length=412

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 156/178 (88%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  AVGGSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPP SPRA   KPLLPLD   E +E +++K  V+YSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPDSPRAE--KPLLPLDGKAEEKEEKENKKPVSYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGWSTSVGESG LVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  355  SMYSAMLLTGWSTSVGESGNLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  412



>gb|ABR17762.1| unknown [Picea sitchensis]
 gb|ABR17907.1| unknown [Picea sitchensis]
Length=417

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 151/179 (84%), Gaps = 3/179 (2%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YCTYLCYS L+SEPRDYECN LH H K+VST TL LG++TTVLSVVY
Sbjct  238  VNGSLLPASVISVYCTYLCYSGLSSEPRDYECNGLHGHVKAVSTSTLLLGMITTVLSVVY  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADE-HEEMEK--SKAVTYSYSFFHIIFSL  344
            SAVRAGSST LLSPPSSPRAG GKPLL  D+ +E H+  +K   + VTYSYSFFH+IF+L
Sbjct  298  SAVRAGSSTALLSPPSSPRAGSGKPLLSFDEIEEGHKNTQKDEERPVTYSYSFFHVIFAL  357

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLLTGW++S  +  KL+ VGW +VWVR+ T W+TAAL++WSLVAP+LFPDR+F
Sbjct  358  ASMYSAMLLTGWTSSTADGEKLIGVGWHTVWVRICTEWITAALYIWSLVAPLLFPDREF  416



>emb|CDX83957.1| BnaC08g16880D [Brassica napus]
Length=821

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 159/177 (90%), Gaps = 3/177 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVLSVV
Sbjct  237  AVGGSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTTLLSPP SPRAG  KPLLPLD KA+E EE E+ K VTYSY+FFHIIFSLA
Sbjct  297  YSAVRAGSSTTLLSPPDSPRAG--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIFSLA  354

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSL+APILFPDR+
Sbjct  355  SMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLIAPILFPDRE  411



>ref|XP_006850791.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
 gb|ERN12372.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
Length=339

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 152/178 (85%), Gaps = 3/178 (2%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+FPASVIS+YC YLCY+ L+SEPRDYECN LHKHSK+VSTGTL +G++TTVLSVVY
Sbjct  162  VNGSLFPASVISMYCAYLCYTGLSSEPRDYECNGLHKHSKAVSTGTLIMGMITTVLSVVY  221

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLA  341
            SAVRAGSSTT LSPPSSP+AG  KPLL  D  DE E+ ++++A  V+YSY+FFH+IF+LA
Sbjct  222  SAVRAGSSTTFLSPPSSPKAGEKKPLLESDNLDEVEKNKQNEARPVSYSYTFFHLIFALA  281

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGW TS+ +S  L+DVGW SVWVR+ T WVTA L++WSLVAP++  DR+F
Sbjct  282  SMYSAMLLTGW-TSLSDSEDLIDVGWTSVWVRMCTEWVTAGLYVWSLVAPLILSDREF  338



>dbj|BAK02293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=186

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = -2

Query  706  FILSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            F++ V GS+ PASVIS+YC YLCY++L+SEP DY CN LH HSK VS   L LG+LTTVL
Sbjct  3    FLVQVNGSVMPASVISVYCAYLCYTSLSSEPYDYACNGLHMHSKQVSMSALVLGMLTTVL  62

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHE---EMEKSKAVTYSYSFFHI  356
            SVVYSAVRAGSSTT LSPPSSPR+G   PLL     +E +   E  ++  V+YSY+FFH+
Sbjct  63   SVVYSAVRAGSSTTFLSPPSSPRSGARNPLLGDANVEEGKGSSEGSEAHPVSYSYTFFHL  122

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLLTGW+++  +  +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPD
Sbjct  123  IFALASMYSAMLLTGWTSATSDRSELMDVGWTTVWVRICTEWSTAALYIWTLVAPLLFPD  182

Query  175  RDF  167
            RDF
Sbjct  183  RDF  185



>ref|XP_008673654.1| PREDICTED: uncharacterized protein LOC100191916 isoform X1 [Zea 
mays]
Length=339

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 147/179 (82%), Gaps = 3/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS   L LG+LTTVLSVV
Sbjct  161  QVHGSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSMSALILGMLTTVLSVV  220

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHIIFSL  344
            YSAVRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+IF+L
Sbjct  221  YSAVRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLIFAL  279

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLLTGW+++  ES +L+DVGW +VWVR+ T WVTA L++W+L+AP+LFPDRDF
Sbjct  280  ASMYSAMLLTGWTSAASESSELMDVGWTTVWVRICTEWVTAGLYIWTLIAPLLFPDRDF  338



>tpg|DAA49274.1| TPA: hypothetical protein ZEAMMB73_017777 [Zea mays]
Length=359

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 147/179 (82%), Gaps = 3/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS   L LG+LTTVLSVV
Sbjct  181  QVHGSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSMSALILGMLTTVLSVV  240

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHIIFSL  344
            YSAVRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+IF+L
Sbjct  241  YSAVRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLIFAL  299

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLLTGW+++  ES +L+DVGW +VWVR+ T WVTA L++W+L+AP+LFPDRDF
Sbjct  300  ASMYSAMLLTGWTSAASESSELMDVGWTTVWVRICTEWVTAGLYIWTLIAPLLFPDRDF  358



>gb|ABR16232.1| unknown [Picea sitchensis]
Length=407

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 145/180 (81%), Gaps = 3/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCY  L+SEPRDY CN LH H+ +VSTGTL LG+LTTVLSV+
Sbjct  228  QVSGSLLPASVISVYCAYLCYCGLSSEPRDYGCNGLHNHTAAVSTGTLILGMLTTVLSVI  287

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHIIFS  347
            YSAVRAGSSTT LSPP+SPR G  KPLL     +E ++ EK    + VTYSY+FFH+IF+
Sbjct  288  YSAVRAGSSTTFLSPPTSPRTGSEKPLLESKDVEEGQKDEKKDEGRPVTYSYTFFHLIFA  347

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW++S  +S +LVDVGW SVWVR+ T W+TA L++W+L+API FPDR+F
Sbjct  348  LASMYSAMLLTGWTSSTKDSEELVDVGWPSVWVRICTEWITAGLYVWTLLAPIFFPDREF  407



>ref|NP_001130812.1| uncharacterized protein LOC100191916 [Zea mays]
 gb|ACF79174.1| unknown [Zea mays]
 gb|ACF82535.1| unknown [Zea mays]
 gb|ACF85768.1| unknown [Zea mays]
 gb|ACG39558.1| serine incorporator 3 [Zea mays]
 tpg|DAA49275.1| TPA: Serine incorporator 3 isoform 1 [Zea mays]
 tpg|DAA49276.1| TPA: Serine incorporator 3 isoform 2 [Zea mays]
Length=415

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 147/179 (82%), Gaps = 3/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS   L LG+LTTVLSVV
Sbjct  237  QVHGSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSMSALILGMLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHIIFSL  344
            YSAVRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+IF+L
Sbjct  297  YSAVRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLIFAL  355

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLLTGW+++  ES +L+DVGW +VWVR+ T WVTA L++W+L+AP+LFPDRDF
Sbjct  356  ASMYSAMLLTGWTSAASESSELMDVGWTTVWVRICTEWVTAGLYIWTLIAPLLFPDRDF  414



>ref|XP_002466928.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
 gb|EER93926.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
Length=415

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 148/179 (83%), Gaps = 3/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS G L LG+LTTVLSVV
Sbjct  237  QVNGSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSLGALILGMLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHIIFSL  344
            YSAVRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+IF+L
Sbjct  297  YSAVRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLIFAL  355

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLLTGW+++  E  +L+DVGW +VWVR+ T WVTAAL++W+L+AP+LFPDRDF
Sbjct  356  ASMYSAMLLTGWTSAASERSELMDVGWTTVWVRICTEWVTAALYIWTLIAPLLFPDRDF  414



>ref|NP_001050476.1| Os03g0454100 [Oryza sativa Japonica Group]
 gb|AAO73245.1| putative membrane protein [Oryza sativa Japonica Group]
 gb|ABF97019.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12390.1| Os03g0454100 [Oryza sativa Japonica Group]
 dbj|BAG90227.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75563.1| hypothetical protein OsI_12232 [Oryza sativa Indica Group]
 gb|EEE59340.1| hypothetical protein OsJ_11423 [Oryza sativa Japonica Group]
Length=417

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 144/180 (80%), Gaps = 3/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCY++L+SEP DY CN LH+HSK VS   L LG+LTTVLSVV
Sbjct  237  QVNGSVMPASVISVYCAYLCYTSLSSEPDDYACNGLHRHSKQVSMSALILGMLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK---SKAVTYSYSFFHIIFS  347
            YSAVRAGSSTT LSPPSSPR+G   PLL  D  +  +   K   ++ V+YSY+FFH+IF+
Sbjct  297  YSAVRAGSSTTFLSPPSSPRSGIKNPLLGDDNVEAGKSNSKEIDARPVSYSYTFFHVIFA  356

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW+++  +S +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  357  LASMYSAMLLTGWTSAASDSSELMDVGWTTVWVRICTEWATAALYIWTLVAPLLFPDRDF  416



>ref|XP_004982576.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=415

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GSI PASVIS+YC YLCYS+L+SEP  YECN LH HSK VS   L LG+LTTVLSVV
Sbjct  237  QVNGSIMPASVISVYCAYLCYSSLSSEPDGYECNGLHMHSKQVSMSALILGMLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME-KSKAVTYSYSFFHIIFSLA  341
            YSAVRAGSSTT LSPPSSPR+G   PLL  ++  +  + + + + V+YSY+FFH+IF+LA
Sbjct  297  YSAVRAGSSTTFLSPPSSPRSGAKNPLLGDEETGKGVDKDTEPRPVSYSYTFFHLIFALA  356

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLLTGW+++  E  +L+DVGW +VWVR+ T WVTAAL++W+L+AP+LFPDRDF
Sbjct  357  SMYSAMLLTGWTSAASEKSELMDVGWTTVWVRICTEWVTAALYIWTLIAPLLFPDRDF  414



>ref|XP_008458551.1| PREDICTED: serine incorporator 3 [Cucumis melo]
Length=411

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 146/180 (81%), Gaps = 4/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+VS GTL LG+LTTVLSV+
Sbjct  232  AVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLHTKSKAVSVGTLVLGMLTTVLSVI  291

Query  517  ysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            YSA+RAGSSTT LSPPSSPRAGG KPLL    L+     +   + + V+YSY+FFH+IF+
Sbjct  292  YSALRAGSSTTFLSPPSSPRAGGSKPLLESEDLEDGKNKKTEGEGQPVSYSYTFFHLIFA  351

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW TS+ ES  L+DVGW SVWVR+ T WVTA L++WSLVAP+LFPDR+F
Sbjct  352  LASMYSAMLLSGW-TSLNESSDLIDVGWTSVWVRICTEWVTAGLYIWSLVAPLLFPDREF  410



>ref|XP_010546829.1| PREDICTED: serine incorporator 3 isoform X1 [Tarenaya hassleriana]
Length=410

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 144/179 (80%), Gaps = 4/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEPRDYECN LH  SK+V+T TL LG+LTTVLSV+
Sbjct  233  AVNGSLLPASVISVYCVYVCYTGLSSEPRDYECNGLHNKSKAVTTSTLILGMLTTVLSVI  292

Query  517  ysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSL  344
            YSAVRAGSSTT LSPPSSPRA G  PLL  P D   +  E E  + V+YSYSFFH+IF+L
Sbjct  293  YSAVRAGSSTTFLSPPSSPRAAGATPLLEDPEDGKKKSNETEP-RPVSYSYSFFHVIFAL  351

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMY+AMLL+GW+ S  ES  L+DVGW SVWVR+ TGWVTA L++W+LVAP + PDR+F
Sbjct  352  ASMYAAMLLSGWTDS-SESASLIDVGWTSVWVRICTGWVTAGLYIWTLVAPFVLPDREF  409



>ref|XP_006650244.1| PREDICTED: probable serine incorporator-like [Oryza brachyantha]
Length=417

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 142/180 (79%), Gaps = 3/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PAS+IS+YC YLCY++L+SEP DY CN LH+HSK VS   L LG+LTTVLSVV
Sbjct  237  QVNGSVMPASIISVYCAYLCYTSLSSEPDDYACNGLHRHSKQVSMSALILGMLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK---SKAVTYSYSFFHIIFS  347
            YSAVRAGSSTT LSPPSSPR+G   PLL  D  +      K   ++ V+YSY+FFH+IF+
Sbjct  297  YSAVRAGSSTTFLSPPSSPRSGTKNPLLGDDNVEAGNGNGKELDARPVSYSYTFFHLIFA  356

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW+++  +S +L+DVGW +VWVR+ T W TA L++W+LVAP+LFPDRDF
Sbjct  357  LASMYSAMLLTGWTSAASDSSELMDVGWTTVWVRICTEWATAGLYIWTLVAPLLFPDRDF  416



>ref|XP_010237604.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
 ref|XP_010237605.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=418

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 144/181 (80%), Gaps = 4/181 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCYS+L+SEP DY CN LH HSK VS G L LG+LTTVLSVV
Sbjct  237  QVNGSVMPASVISVYCAYLCYSSLSSEPDDYACNGLHMHSKQVSVGALILGMLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFHIIF  350
            YSAVRAGSSTT LSPPSSPR+G   PLL     +E +  + +    + V+YSY+FFH+IF
Sbjct  297  YSAVRAGSSTTFLSPPSSPRSGTKNPLLGDANVEEGKGEDTTGSEPRPVSYSYTFFHLIF  356

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLLTGW+++  ESG+L+DVGW +VWVR+   W TAAL++W+LVAP+LFPDRD
Sbjct  357  ALASMYSAMLLTGWTSAGSESGELMDVGWTTVWVRICMEWATAALYIWTLVAPLLFPDRD  416

Query  169  F  167
            F
Sbjct  417  F  417



>ref|XP_004150322.1| PREDICTED: serine incorporator 3-like [Cucumis sativus]
 gb|KGN47263.1| hypothetical protein Csa_6G238640 [Cucumis sativus]
Length=411

 Score =   176 bits (447),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 145/180 (81%), Gaps = 4/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+VS GTL LG+LTTVLSV+
Sbjct  232  AVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNDLHTKSKAVSVGTLVLGMLTTVLSVI  291

Query  517  ysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            YSA+RAGSSTT LSPPSSPRAGG KPLL    L+     +   + + V+YSY+FFH+IF+
Sbjct  292  YSALRAGSSTTFLSPPSSPRAGGSKPLLESEDLEDGKNKKTEGEGQPVSYSYTFFHLIFA  351

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW TS+ ES  L+DVGW SVWVR+ T WVT  L++WSLVAP+LFPDR+F
Sbjct  352  LASMYSAMLLSGW-TSLNESSDLIDVGWTSVWVRICTEWVTGGLYIWSLVAPLLFPDREF  410



>ref|XP_004169518.1| PREDICTED: LOW QUALITY PROTEIN: serine incorporator 3-like [Cucumis 
sativus]
Length=411

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 145/180 (81%), Gaps = 4/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+VS GTL LG+LTTVLSV+
Sbjct  232  AVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNDLHTKSKAVSVGTLVLGMLTTVLSVI  291

Query  517  ysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            YSA+RAGSSTT LSPPSSPRAGG KPLL    L+     +   + + V+YSY+FFH+IF+
Sbjct  292  YSALRAGSSTTFLSPPSSPRAGGSKPLLESEDLEDGKNKKTEGEGQPVSYSYTFFHLIFA  351

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW TS+ ES  L+DVGW SVWVR+ T WVT  L++WSLVAP+LFPDR+F
Sbjct  352  LASMYSAMLLSGW-TSLNESSDLIDVGWTSVWVRICTEWVTGGLYIWSLVAPLLFPDREF  410



>ref|XP_011090806.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=411

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 146/178 (82%), Gaps = 3/178 (2%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YC YLCY+ L+SEPRDY CN LH  SK+VST TL LG+LTTVLSV+Y
Sbjct  234  VNGSLLPASVISVYCAYLCYTGLSSEPRDYVCNGLHNKSKAVSTSTLVLGMLTTVLSVLY  293

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLA  341
            SA+RAGSSTT LSPPSSPRAG  KPLL  D+ +  +    ++A  V+YSY+FFH+IF+LA
Sbjct  294  SALRAGSSTTFLSPPSSPRAGDKKPLLESDELESGKGKNDAEARPVSYSYTFFHLIFALA  353

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLL+GW TS  E+ +L+D+GW SVWVR+ T WVTA L++WSL+AP+LFPDR+F
Sbjct  354  SMYSAMLLSGW-TSSSENPELIDIGWTSVWVRICTEWVTAGLYIWSLIAPLLFPDREF  410



>gb|EYU43840.1| hypothetical protein MIMGU_mgv1a006662mg [Erythranthe guttata]
Length=436

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 145/178 (81%), Gaps = 3/178 (2%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK VST TL LG+LTTVLSV+Y
Sbjct  259  VNGSLLPASVISMYCAYVCYTGLSSEPRDYVCNGLHNKSKVVSTSTLILGMLTTVLSVLY  318

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKAD--EHEEMEKSKAVTYSYSFFHIIFSLA  341
            SA+RAGSSTT LSPPSSPRAGG KPLL  D+ +  + +   ++K VTYSY FFH+IF+LA
Sbjct  319  SALRAGSSTTFLSPPSSPRAGGKKPLLEGDELESGKGKNETENKPVTYSYMFFHLIFALA  378

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLL+GW TS  E+ +L+DVGW SVWVR+ T WVTA L++WSL+AP++ PDR+F
Sbjct  379  SMYSAMLLSGW-TSDSENPQLIDVGWTSVWVRICTEWVTAGLYVWSLIAPLILPDREF  435



>dbj|BAJ86142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 142/180 (79%), Gaps = 3/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCY++L+SEP DY CN LH HSK VS   L LG+LTTVLSVV
Sbjct  237  QVNGSVMPASVISVYCAYLCYTSLSSEPYDYACNGLHMHSKQVSMSALVLGMLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHE---EMEKSKAVTYSYSFFHIIFS  347
            YSAVRAGSSTT LSPPSSPR+G   PLL     +E +   E  ++  V+YSY+FFH+IF+
Sbjct  297  YSAVRAGSSTTFLSPPSSPRSGARNPLLGDANVEEGKGSSEGSEAHPVSYSYTFFHLIFA  356

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW+++  +  +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  357  LASMYSAMLLTGWTSATSDRSELMDVGWTTVWVRICTEWSTAALYIWTLVAPLLFPDRDF  416



>ref|XP_008799134.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=416

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 148/180 (82%), Gaps = 3/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCYS L+SEPRDY CN LHKHSK VSTGTL LGLLTTV+SVV
Sbjct  237  QVNGSLLPASVISVYCAYLCYSGLSSEPRDYACNGLHKHSKQVSTGTLVLGLLTTVISVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            YSAVR GSST+ LSPPSSP++G  KPLL    L+   + ++  +++ V+YSY+FFH+IF+
Sbjct  297  YSAVRTGSSTSFLSPPSSPKSGSTKPLLEDGELESGKDDKKEGEARPVSYSYTFFHLIFA  356

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAM+LTGW++S  +S +L+DVGW SVWVR+ T W TAAL++W+LVAP++ PDR+F
Sbjct  357  LASMYSAMVLTGWTSSTSDSSELIDVGWTSVWVRICTEWATAALYIWTLVAPLILPDREF  416



>ref|XP_010546830.1| PREDICTED: serine incorporator 3 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 144/179 (80%), Gaps = 5/179 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEPRDYECN LH  SK+V+T TL LG+LTTVLSV+
Sbjct  233  AVNGSLLPASVISVYCVYVCYTGLSSEPRDYECNGLHNKSKAVTTSTLILGMLTTVLSVI  292

Query  517  ysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSL  344
            YSAVRAGSSTT LSPPSSPRAG   PLL  P D   +  E E  + V+YSYSFFH+IF+L
Sbjct  293  YSAVRAGSSTTFLSPPSSPRAGA-TPLLEDPEDGKKKSNETEP-RPVSYSYSFFHVIFAL  350

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMY+AMLL+GW+ S  ES  L+DVGW SVWVR+ TGWVTA L++W+LVAP + PDR+F
Sbjct  351  ASMYAAMLLSGWTDS-SESASLIDVGWTSVWVRICTGWVTAGLYIWTLVAPFVLPDREF  408



>ref|XP_004296950.1| PREDICTED: probable serine incorporator [Fragaria vesca subsp. 
vesca]
Length=409

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 146/180 (81%), Gaps = 6/180 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+Y  Y+CY+AL+SEPRDY CN LH HS +VS GTL LG+ TT+LSV+
Sbjct  233  TVNGSLLPASVISVYSAYVCYTALSSEPRDYACNGLH-HSSAVSVGTLLLGMATTILSVL  291

Query  517  ysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            YSA+RAGSSTT LSPPSSPRA   KPLL    L++  +  E E +K V+YSY+FFH+IF+
Sbjct  292  YSALRAGSSTTFLSPPSSPRAAEKKPLLEGKELEEGKDKNEKE-AKPVSYSYTFFHLIFA  350

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTAAL++WSLVAP+LFPDR+F
Sbjct  351  LASMYSAMLLSGWTNS-AESSDLIDVGWTSVWVRICTEWVTAALYVWSLVAPLLFPDREF  409



>ref|XP_009391591.1| PREDICTED: serine incorporator 3 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 146/181 (81%), Gaps = 5/181 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ P+SVIS+YC YLCYS L+SEPRDY CN LH H K VSTGTL LG+LTTVLSVV
Sbjct  237  QVNGSLLPSSVISIYCAYLCYSGLSSEPRDYACNGLHNHVKQVSTGTLVLGMLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKAD----EHEEMEKSKAVTYSYSFFHIIF  350
            YSAVRAGSSTT LSPPSSP++G   PLL    A+    E +E E ++ V+YSY+FFH+IF
Sbjct  297  YSAVRAGSSTTFLSPPSSPKSGSRSPLLEAGDAESGKPEKKENE-ARPVSYSYTFFHLIF  355

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLLTGWS S+ ES +L+DVGW SVWVR+ T W TAAL++W+LVAP++ PDR+
Sbjct  356  ALASMYSAMLLTGWSGSISESSELIDVGWTSVWVRICTEWATAALYIWTLVAPLILPDRE  415

Query  169  F  167
            F
Sbjct  416  F  416



>ref|XP_002280143.1| PREDICTED: serine incorporator 3 [Vitis vinifera]
 emb|CBI26177.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 144/184 (78%), Gaps = 15/184 (8%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVISLYC Y+CY+ L+SEPRDY CN LH  SK+VST TL LG+LTTVLSV+Y
Sbjct  234  VNGSLLPASVISLYCAYVCYTGLSSEPRDYACNGLHNKSKAVSTSTLILGMLTTVLSVLY  293

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--------VTYSYSFFH  359
            SAVRAGSSTT LSPPSSP++GG KPLL      E E+ E  K         V+YSY+FFH
Sbjct  294  SAVRAGSSTTFLSPPSSPKSGGKKPLL------ESEDTESGKEKKEEEAKPVSYSYTFFH  347

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMYSAMLL+GW TS  +S  ++DVGW SVWVR+ T WVTA L++WSL+APILFP
Sbjct  348  LIFALASMYSAMLLSGW-TSSNDSSDMIDVGWTSVWVRICTEWVTALLYVWSLLAPILFP  406

Query  178  DRDF  167
            DR+F
Sbjct  407  DREF  410



>ref|XP_010938752.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=416

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 148/180 (82%), Gaps = 3/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCYS L+SEPRDY CN LHKHSK VSTGTL LGLLTTV+SVV
Sbjct  237  QVNGSLLPASVISVYCAYLCYSGLSSEPRDYACNGLHKHSKQVSTGTLVLGLLTTVISVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            YSAVR GSST+ LSPPSSP++G  KPLL    ++   + ++  +++ VTYSY+FFH+IF+
Sbjct  297  YSAVRTGSSTSFLSPPSSPKSGSSKPLLEEGEVESGKDDKKESEARPVTYSYTFFHLIFA  356

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW++S  +S +L+DVGW SVWVR+ T W TAAL++W+L+AP++ PDR+F
Sbjct  357  LASMYSAMLLTGWTSSTSDSSELIDVGWTSVWVRICTEWATAALYIWTLIAPLVLPDREF  416



>ref|XP_006419802.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
 ref|XP_006489289.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
 gb|ESR33042.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
Length=414

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 145/180 (81%), Gaps = 4/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GS+ PASVIS+YC Y+CY+AL+SEP DY CN LH  SK+V+  TL LG+LTTVLSV+
Sbjct  235  SVNGSLLPASVISVYCAYVCYTALSSEPHDYVCNGLHNKSKAVTISTLVLGMLTTVLSVL  294

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHIIFS  347
            YSA+RAGSSTT LSPPSSP++ G KPLL  +  +E  E +K    + V+YSYSFFH+IF+
Sbjct  295  YSALRAGSSTTFLSPPSSPKSAGKKPLLEGEDVEEGTENKKDIEGRPVSYSYSFFHLIFA  354

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ + WVTA L++W+LVAP+LFPDR+F
Sbjct  355  LASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICSQWVTAGLYIWTLVAPLLFPDREF  413



>ref|XP_009365800.1| PREDICTED: probable serine incorporator isoform X2 [Pyrus x bretschneideri]
Length=409

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 144/179 (80%), Gaps = 6/179 (3%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+Y  Y+CY+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVLSV+Y
Sbjct  234  VNGSLLPASVISVYSAYVCYTALSSEPRGYACNGLH-HSKAVSLSTLLLGMATTVLSVLY  292

Query  514  saVRAGssttllsppssPRAGGGKPLL---PLDKADEHEEMEKSKAVTYSYSFFHIIFSL  344
            SA+RAGSST  LSPPSSPR     PLL    L++A E  + E +K V+YSY+FFH+IF+L
Sbjct  293  SALRAGSSTNFLSPPSSPRGAEKTPLLDGKELEEAKEKNDKE-AKPVSYSYTFFHLIFAL  351

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLL+GW++S+ ES  L+DVGW SVWVR+ T WVTAAL++WSL+APILFPDR+F
Sbjct  352  ASMYSAMLLSGWTSSL-ESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILFPDREF  409



>ref|XP_009365799.1| PREDICTED: probable serine incorporator isoform X1 [Pyrus x bretschneideri]
Length=411

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 6/180 (3%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+Y  Y+CY+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVLSV+Y
Sbjct  234  VNGSLLPASVISVYSAYVCYTALSSEPRGYACNGLH-HSKAVSLSTLLLGMATTVLSVLY  292

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFHIIFS  347
            SA+RAGSST  LSPPSSPR G  +    LD  +  E  EK+    K V+YSY+FFH+IF+
Sbjct  293  SALRAGSSTNFLSPPSSPRGGAAEKTPLLDGKELEEAKEKNDKEAKPVSYSYTFFHLIFA  352

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW++S+ ES  L+DVGW SVWVR+ T WVTAAL++WSL+APILFPDR+F
Sbjct  353  LASMYSAMLLSGWTSSL-ESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILFPDREF  411



>ref|XP_009342179.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=411

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 6/180 (3%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+Y  Y+CY+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVLSV+Y
Sbjct  234  VNGSLLPASVISVYSAYVCYTALSSEPRGYACNGLH-HSKAVSLSTLLLGMATTVLSVLY  292

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFHIIFS  347
            SA+RAGSST  LSPPSSPR G  +    LD  +  E  EK+    K V+YSY+FFH+IF+
Sbjct  293  SALRAGSSTNFLSPPSSPRGGAAERTPLLDGKELEEAKEKNDKEAKPVSYSYTFFHLIFA  352

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW++S+ ES  L+DVGW SVWVR+ T WVTAAL++WSL+APILFPDR+F
Sbjct  353  LASMYSAMLLSGWTSSL-ESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILFPDREF  411



>ref|XP_010693925.1| PREDICTED: serine incorporator 3 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 140/178 (79%), Gaps = 3/178 (2%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+V+T TL LG++TTVLSV+Y
Sbjct  233  VNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLHNKSKAVTTSTLVLGMITTVLSVLY  292

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHIIFSLA  341
            SA+RAGSS   LSPPSSPRAG  K LL  +  +   + + S  + V+YSY FFH+IF+LA
Sbjct  293  SALRAGSSKAFLSPPSSPRAGATKSLLSSEDTEAGRDKKDSEPRPVSYSYMFFHLIFALA  352

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLL+GW++S   S  L+D+GWASVWV++ T WVTA L++WSLVAP+L PDR+F
Sbjct  353  SMYSAMLLSGWTSSTDNS-DLIDIGWASVWVKICTEWVTAGLYVWSLVAPLLLPDREF  409



>emb|CDO98987.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 148/179 (83%), Gaps = 3/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEPR+Y CN LHK S++VST TL LGLLTT++SV+
Sbjct  233  AVNGSLLPASVISVYCAYVCYTGLSSEPRNYVCNGLHKASRAVSTSTLILGLLTTIISVL  292

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDK--ADEHEEMEKSKAVTYSYSFFHIIFSL  344
            YSA+RAGSSTT LSPPSSPR+GG KPLL  D+  A + ++  + + V+YSYSFF +IF+L
Sbjct  293  YSALRAGSSTTFLSPPSSPRSGGQKPLLESDELEAGKDKKDAEPRPVSYSYSFFLLIFAL  352

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSLVAP++FPDR+F
Sbjct  353  ASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRMCTEWVTAGLYVWSLVAPLIFPDREF  410



>gb|KDO74827.1| hypothetical protein CISIN_1g039061mg [Citrus sinensis]
Length=399

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 144/180 (80%), Gaps = 4/180 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            SV GS+ PASVIS+YC Y+CY+AL+SEP DY CN LH  SK+V+  TL LG+LTTVLSV+
Sbjct  220  SVNGSLLPASVISVYCAYVCYTALSSEPHDYVCNGLHNKSKAVTISTLVLGMLTTVLSVL  279

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHIIFS  347
            YSA+RAGSSTT LSPPSSP++ G K LL  +  +E  E +K    + V+YSYSFFH+IF+
Sbjct  280  YSALRAGSSTTFLSPPSSPKSAGKKLLLEGEDVEEGTENKKDIEGRPVSYSYSFFHLIFA  339

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ + WVTA L++W+LVAP+LFPDR+F
Sbjct  340  LASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICSQWVTAGLYIWTLVAPLLFPDREF  398



>emb|CDY05246.1| BnaC05g45570D [Brassica napus]
Length=408

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++      L T +  + 
Sbjct  233  AVNGSLLPASVISVYCAYICYTGLSSEPHDYVCNGLNRSKAVTASTLTLGMLTTVLSVLY  292

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
             +  RAGSSTT LSPPSSPRAGG + LL   +  +     +++ V+YSYSFFHIIF+LAS
Sbjct  293  SAL-RAGSSTTFLSPPSSPRAGGKEALLEDPEDGKKNGEAEARPVSYSYSFFHIIFALAS  351

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MY+AMLL+GW+ S  ES  L+DVGW SVWVR+ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  352  MYAAMLLSGWTDS-SESASLIDVGWTSVWVRICTGWVTAALYIWTLIAPLILPDREF  407



>ref|XP_006356686.1| PREDICTED: serine incorporator 3-like [Solanum tuberosum]
Length=409

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 144/176 (82%), Gaps = 1/176 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YC Y+CYS L+SEPRDY CN LH  SK+V+T TL LG+LTTVLSV+Y
Sbjct  234  VNGSLLPASVISVYCAYVCYSGLSSEPRDYVCNGLHNKSKAVTTSTLVLGMLTTVLSVLY  293

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            SA+RAGS+TT +SPPSSPR+G  K LL  ++ +  +   +++ V+YSY+FFH+IF+LASM
Sbjct  294  SALRAGSATTFMSPPSSPRSGEKKSLLASEELESGKGSPEARPVSYSYTFFHLIFALASM  353

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            YSAMLL+GW TS  ES +L+DVGW S+WVR+ T WVTA L++WSLVAP+ FPDR+F
Sbjct  354  YSAMLLSGW-TSSSESSELIDVGWTSLWVRICTEWVTAGLYVWSLVAPLFFPDREF  408



>ref|XP_006595390.1| PREDICTED: probable serine incorporator-like [Glycine max]
Length=375

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 130/178 (73%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PA+V+SLYC Y+CY+ L+SEP DYECN L+K     +   +   L T +  + 
Sbjct  199  QVNGSLLPAAVVSLYCAYVCYTGLSSEPHDYECNGLNKSRAVSTGTLVLGMLTTVLSVLY  258

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS-KAVTYSYSFFHIIFSLA  341
             +  RAGSSTT LSPPSSPR GG KPLL   +  + ++ EK  + V+YSYSFFH+IF+LA
Sbjct  259  SAL-RAGSSTTFLSPPSSPRLGGSKPLLEEAEEGKAKKEEKEARPVSYSYSFFHLIFALA  317

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSL+AP+LFPDR+F
Sbjct  318  SMYSAMLLSGW-TSTSESSDLIDVGWTSVWVRIGTEWVTAGLYIWSLLAPLLFPDREF  374



>emb|CDY24707.1| BnaA05g31060D [Brassica napus]
Length=408

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++  +   L T +  + 
Sbjct  233  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNRSKAVTASTLILGMLTTVLSVLY  292

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
             +  RAGSSTT LSPPSSPRAGG + LL   +  +     +++ V+YSYSFFHIIF+LAS
Sbjct  293  SAL-RAGSSTTFLSPPSSPRAGGKEALLEDPEDGKKNGEAEARPVSYSYSFFHIIFALAS  351

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  352  MYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAALYIWTLIAPLILPDREF  407



>gb|ACJ84561.1| unknown [Medicago truncatula]
 gb|AFK35204.1| unknown [Medicago truncatula]
 gb|KEH36756.1| TMS membrane protein/tumor differentially protein [Medicago truncatula]
Length=409

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 131/177 (74%), Gaps = 3/177 (2%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVISLYC Y+CY+ L+SEPR YECN L+K     +   +   L T +  +  
Sbjct  234  VNGSLLPASVISLYCAYVCYTGLSSEPRGYECNGLNKSRAVSTGTLVLGMLTTVLSVLYS  293

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLAS  338
            +  RAGSSTT LSPPSSP+AG  KPLL   +  + ++ EK ++ V+YSYSFFH+IF+LAS
Sbjct  294  AL-RAGSSTTFLSPPSSPKAGESKPLLEEVEEGKSKKEEKEARPVSYSYSFFHLIFALAS  352

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L+LWSL+AP+LFPDR+F
Sbjct  353  MYSAMLLSGW-TSTSESSDLIDVGWTSVWVRIGTEWVTAGLYLWSLLAPLLFPDREF  408



>gb|KHN37564.1| Putative serine incorporator [Glycine soja]
Length=407

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 130/178 (73%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PA+V+SLYC Y+CY+ L+SEP DYECN L+K     +   +   L T +  + 
Sbjct  231  QVNGSLLPAAVVSLYCAYVCYTGLSSEPHDYECNGLNKSRAVSTGTLVLGMLTTVLSVLY  290

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS-KAVTYSYSFFHIIFSLA  341
             +  RAGSSTT LSPPSSPR GG KPLL   +  + ++ EK  + V+YSYSFFH+IF+LA
Sbjct  291  SAL-RAGSSTTFLSPPSSPRLGGSKPLLEEAEEGKAKKEEKEARPVSYSYSFFHLIFALA  349

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSL+AP+LFPDR+F
Sbjct  350  SMYSAMLLSGW-TSTSESSDLIDVGWTSVWVRIGTEWVTAGLYIWSLLAPLLFPDREF  406



>ref|XP_010464184.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=409

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  + 
Sbjct  234  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLY  293

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
             +  RAGSSTT LSPPSSPR+GG + LL   +  +     +++ V+YSYSFFHIIF+LAS
Sbjct  294  SAL-RAGSSTTFLSPPSSPRSGGKEALLEDPEDGKKGSEAEARPVSYSYSFFHIIFALAS  352

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  353  MYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAALYIWTLIAPLILPDREF  408



>ref|XP_010486107.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 131/179 (73%), Gaps = 5/179 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  + 
Sbjct  234  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLY  293

Query  517  ysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSL  344
             +  RAGSSTT LSPPSSPRAGG + LL  P D   +  E E ++ V+YSYSFFHIIF+L
Sbjct  294  SAL-RAGSSTTFLSPPSSPRAGGREALLEDPEDGKKKGGEAE-ARPVSYSYSFFHIIFAL  351

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  352  ASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAVLYIWTLIAPLILPDREF  409



>gb|KJB28193.1| hypothetical protein B456_005G040500 [Gossypium raimondii]
Length=410

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 146/179 (82%), Gaps = 3/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  + +VS  TL LG+LTTVLSV+
Sbjct  232  AVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLHNKASAVSLSTLILGMLTTVLSVI  291

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHIIFSL  344
            YSA+RAGSSTT LSPPSSP+AG  KPLL  D  +E +E ++  ++ V+YSYSFFH+IF+L
Sbjct  292  YSALRAGSSTTFLSPPSSPKAGTKKPLLEGDDVEEGKETKEKEARPVSYSYSFFHLIFAL  351

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLL+GW TS  +S  LVDVGW SVWVR+ T WVTAAL++W+LVAP++ PDR+F
Sbjct  352  ASMYSAMLLSGW-TSSSDSSDLVDVGWTSVWVRICTEWVTAALYVWTLVAPLIIPDREF  409



>ref|XP_009129653.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=408

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++      L T +  + 
Sbjct  233  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNRSKAVTASTLTLGMLTTVLSVLY  292

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
             +  RAGSSTT LSPPSSPRAGG + LL   +  +     +++ V+YSYSFFHIIF+LAS
Sbjct  293  SAL-RAGSSTTFLSPPSSPRAGGKEALLEDPEDGKKNGEAEARPVSYSYSFFHIIFALAS  351

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGW TAAL++W+L+AP++ PDR+F
Sbjct  352  MYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWATAALYIWTLIAPLILPDREF  407



>ref|XP_009799680.1| PREDICTED: probable serine incorporator [Nicotiana sylvestris]
Length=408

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 130/176 (74%), Gaps = 2/176 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN L+K     ++  +   L T +  +  
Sbjct  234  VNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLNKSKAVTTSTLVLGMLTTVLSVLYS  293

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            +  RAGSSTT LSPPSSPR+G  K LL  ++ +  +   +++ V+YSYSFFH+IF+LASM
Sbjct  294  AL-RAGSSTTFLSPPSSPRSGEKKSLLASEELESGKGSAEARPVSYSYSFFHLIFALASM  352

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            YSAMLL+GW TS  ES  L+DVGW S+WVR+ T WVTA L++WSLVAP+LFPDR+F
Sbjct  353  YSAMLLSGW-TSSSESSDLIDVGWTSLWVRICTEWVTAGLYIWSLVAPLLFPDREF  407



>ref|XP_006297798.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
 gb|EOA30696.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
Length=410

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 131/179 (73%), Gaps = 5/179 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  + 
Sbjct  234  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLY  293

Query  517  ysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSL  344
             +  RAGSSTT LSPPSSPR+GG + LL  P D   +  E E ++ V+YSYSFFHIIF+L
Sbjct  294  SAL-RAGSSTTFLSPPSSPRSGGREALLEDPEDGKKKGGEAE-ARPVSYSYSFFHIIFAL  351

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  352  ASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAGLYIWTLIAPLILPDREF  409



>ref|XP_010436570.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 131/179 (73%), Gaps = 5/179 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  + 
Sbjct  234  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLY  293

Query  517  ysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSL  344
             +  RAGSSTT LSPPSSPR+GG + LL  P D   +  E E ++ V+YSYSFFHIIF+L
Sbjct  294  SAL-RAGSSTTFLSPPSSPRSGGREALLEDPEDGKKKGGEAE-ARPVSYSYSFFHIIFAL  351

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  352  ASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAVLYIWTLIAPLILPDREF  409



>ref|XP_007147778.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
 gb|ESW19772.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
Length=409

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 129/178 (72%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASV+SLYC Y+CY+ L+SEPRDYECN L+K     ++  +   L T +  + 
Sbjct  233  TVNGSLLPASVMSLYCAYVCYTGLSSEPRDYECNGLNKSRAVSTSTLVLGMLTTVLSVLY  292

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS-KAVTYSYSFFHIIFSLA  341
             +  RAGSS T LSPPSSP+ G  KPLL   +  + ++ EK  + V+YSYSFFH+IF+LA
Sbjct  293  SAL-RAGSSKTFLSPPSSPKLGESKPLLEEAEEGKAKKEEKEARPVSYSYSFFHLIFALA  351

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSL AP+ FPDR+F
Sbjct  352  SMYSAMLLSGW-TSTYESSDLIDVGWTSVWVRIGTEWVTAVLYIWSLTAPLFFPDREF  408



>gb|AAF30310.1|AC018907_10 hypothetical protein [Arabidopsis thaliana]
Length=315

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 141/177 (80%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K SK+V+  TL LG+LTTVLSV+
Sbjct  140  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNK-SKAVNASTLILGMLTTVLSVL  198

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSA+RAGSSTT LSPPSSPR+G    LL   +  +     +++ V+YSYSFFHIIF+LAS
Sbjct  199  YSALRAGSSTTFLSPPSSPRSGVKDALLGDPEDGKKSGEAEARPVSYSYSFFHIIFALAS  258

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  259  MYAAMLLSGWTDS-SESATLIDVGWTSVWVKICTGWVTAGLYIWTLIAPLILPDREF  314



>ref|XP_010322266.1| PREDICTED: serine incorporator 3 [Solanum lycopersicum]
Length=411

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 144/178 (81%), Gaps = 3/178 (2%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YC Y+CYS L+SEPRDY CN LH  SK+V+T TL LG+LTTVLSV+Y
Sbjct  234  VNGSLLPASVISVYCAYVCYSGLSSEPRDYVCNGLHNKSKAVTTSTLVLGMLTTVLSVLY  293

Query  514  saVRAGssttllsppssPRA--GGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            SA+RAGS+TT +SPPSSPR+  G  K LL  ++ +  +   +++ V+YSY+FFH+IF+LA
Sbjct  294  SALRAGSATTFMSPPSSPRSVVGEKKSLLASEELESGKGSPEARPVSYSYTFFHLIFALA  353

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLL+GW TS  ES +L+DVGW S+WVR+ T WVTA L++WSLVAP+L PDR+F
Sbjct  354  SMYSAMLLSGW-TSSSESSELIDVGWTSLWVRICTEWVTAGLYVWSLVAPLLLPDREF  410



>ref|XP_001765634.1| predicted protein [Physcomitrella patens]
 gb|EDQ69473.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 133/180 (74%), Gaps = 5/180 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PA VI+ YCTYLCYSAL+SEPR+YECN LHKH  +VS GTL LG+LTT+LSVV
Sbjct  237  QVNGSLLPAGVIAAYCTYLCYSALSSEPRNYECNGLHKHVNAVSKGTLGLGMLTTLLSVV  296

Query  517  ysaVRAGssttllsppssPRAGG---GKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            YSAVRAGSSTT LSPP+SPR G         P+ +   H +  + + VTY YSFFH+IF+
Sbjct  297  YSAVRAGSSTTFLSPPNSPREGNLLFDDDDKPIRRGGRHSK--EPRPVTYVYSFFHLIFA  354

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW  +      ++DVGW S WVR  T  +TA L++WSLVAP LFPDRDF
Sbjct  355  LASMYSAMLLTGWGNANMAEKDIIDVGWPSFWVRFSTEMITAGLYIWSLVAPQLFPDRDF  414



>ref|XP_002882452.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58711.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 129/179 (72%), Gaps = 5/179 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  + 
Sbjct  234  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLY  293

Query  517  ysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSL  344
             +  RAGSSTT LSPPSSPR+G    LL  P D   +  E E ++ V+YSYSFFHIIF+L
Sbjct  294  SAL-RAGSSTTFLSPPSSPRSGVKDSLLEDPEDGKKKSGEAE-ARPVSYSYSFFHIIFAL  351

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  352  ASMYAAMLLSGWTDS-SESATLIDVGWTSVWVKICTGWVTAVLYIWTLIAPLILPDREF  409



>ref|NP_187268.2| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAZ23918.1| At3g06170 [Arabidopsis thaliana]
 gb|AEE74356.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 127/177 (72%), Gaps = 2/177 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T +  + 
Sbjct  234  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLY  293

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
             +  RAGSSTT LSPPSSPR+G    LL   +  +     +++ V+YSYSFFHIIF+LAS
Sbjct  294  SAL-RAGSSTTFLSPPSSPRSGVKDALLGDPEDGKKSGEAEARPVSYSYSFFHIIFALAS  352

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  353  MYAAMLLSGWTDS-SESATLIDVGWTSVWVKICTGWVTAGLYIWTLIAPLILPDREF  408



>ref|XP_009623079.1| PREDICTED: probable serine incorporator [Nicotiana tomentosiformis]
Length=408

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 128/176 (73%), Gaps = 2/176 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN L+K     ++  +   L T +  +  
Sbjct  234  VNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLNKSKAVTTSTLVLGMLTTVLSVLYS  293

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            +  RAGSSTT LSPPSSPR+G  K LL  ++ +  +   + + V+YSYSFFH+IF+LASM
Sbjct  294  AL-RAGSSTTFLSPPSSPRSGEKKSLLASEELESGKGSTEPRPVSYSYSFFHLIFALASM  352

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            YSAMLL+GW TS  ES  L+DVGW S+WVR+ T  VTA L++WSLVAP+LFPDR+F
Sbjct  353  YSAMLLSGW-TSSSESSDLIDVGWTSLWVRICTELVTAGLYIWSLVAPLLFPDREF  407



>ref|XP_007034589.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
 gb|EOY05515.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
Length=410

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 146/179 (82%), Gaps = 3/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+C++ L+SEPRDY CN LH  S +VST TL LG+LTTVLSV+
Sbjct  232  AVNGSLLPASVISIYCAYVCFTGLSSEPRDYVCNGLHNKSSAVSTSTLILGMLTTVLSVL  291

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSL  344
            YSA+RAGSSTT LSPPSSP++GG KPLL  +  +E +E ++ +A  V+YSYSFFH+IF+L
Sbjct  292  YSALRAGSSTTFLSPPSSPKSGGKKPLLEGEDVEEGKEKKEKEARPVSYSYSFFHLIFAL  351

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLL+GW TS  ES  LVDVGW SVWVR+ T WVTAAL++W+LVAP +  DR+F
Sbjct  352  ASMYSAMLLSGW-TSSSESSVLVDVGWTSVWVRICTEWVTAALYVWTLVAPTILHDREF  409



>emb|CAN71158.1| hypothetical protein VITISV_036762 [Vitis vinifera]
Length=309

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 137/181 (76%), Gaps = 18/181 (10%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVISLYC Y+CY+ L+SEPRDY CN LH  SK+VST TL LG+LTTVLSV+Y
Sbjct  141  VNGSLLPASVISLYCAYVCYTGLSSEPRDYACNGLHNKSKAVSTSTLILGMLTTVLSVLY  200

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEE-----MEKSKAVTYSYSFFHIIF  350
            SAVRAGSSTT L            P  P  K+++ E       E++K V+YSY+FFH+IF
Sbjct  201  SAVRAGSSTTFL----------SPPSSP--KSEDTESGKEKKEEEAKPVSYSYTFFHLIF  248

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLL+GW++S  +S  ++DVGW SVWVR+ T WVTA L++WSL+APILFPDR+
Sbjct  249  ALASMYSAMLLSGWTSS-NDSSDMIDVGWTSVWVRICTEWVTALLYVWSLLAPILFPDRE  307

Query  169  F  167
            F
Sbjct  308  F  308



>gb|AFK47365.1| unknown [Lotus japonicus]
Length=234

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 140/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PA+VISLYC YLCY+ L+SEPR+YECN L+K  K+V+T TL LG++TTVLSV+Y
Sbjct  60   VNGSLLPAAVISLYCAYLCYTGLSSEPRNYECNGLNKS-KAVTTSTLVLGMVTTVLSVLY  118

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            SA+RAGSSTT LSPPS PR+G    L  +++    +E +++K V+YSYSFFH IF+LASM
Sbjct  119  SALRAGSSTTFLSPPSLPRSGSKPLLEEVEEGKTKKEEKEAKPVSYSYSFFHQIFALASM  178

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            YSAMLL+GW TS  +S  L+DVGW SVWVR+ T WVTA L+ W+L+AP+  PDR+F
Sbjct  179  YSAMLLSGW-TSTSDSSDLIDVGWTSVWVRIGTEWVTAGLYAWTLLAPVFLPDREF  233



>ref|XP_010255869.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=416

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 151/181 (83%), Gaps = 5/181 (3%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YC YLCY+ L+SEPRDY CN LHK+SK+VSTGTL LG+LTTVLSV+Y
Sbjct  235  VNGSLLPASVISVYCAYLCYTGLSSEPRDYICNGLHKNSKAVSTGTLILGMLTTVLSVLY  294

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-----SKAVTYSYSFFHIIF  350
            SAVRAGSSTT LSPPSSP++GG +PLL  D+ +  +E ++     ++ V+Y+Y+FFH+IF
Sbjct  295  SAVRAGSSTTFLSPPSSPKSGGKQPLLESDELEAGKEKKEKKETEAQPVSYNYTFFHLIF  354

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLLTGW++S   S  L+DVGW SVWVR+ T WVTAAL++W+LVA ++FPDR+
Sbjct  355  ALASMYSAMLLTGWTSSTSGSSDLIDVGWTSVWVRICTEWVTAALYVWTLVASLIFPDRE  414

Query  169  F  167
            F
Sbjct  415  F  415



>gb|EPS68630.1| hypothetical protein M569_06136 [Genlisea aurea]
Length=410

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 135/179 (75%), Gaps = 4/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASV+S+YC Y+CY+ L+SEPRDY CN L+K SK+V+  TL +G+LTTV SV+
Sbjct  233  QVNGSLLPASVVSIYCAYVCYTGLSSEPRDYVCNGLNK-SKAVTISTLVVGMLTTVFSVL  291

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSL  344
            YSA RAGSSTT LSPPSSPRA G   LL     D      +S+   V YSYSFFH+IF+L
Sbjct  292  YSAFRAGSSTTFLSPPSSPRAAGKLSLLLGGDGDVESGKGESEGEPVRYSYSFFHLIFAL  351

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            A+MYSAMLL+GW TS  E+  L+DVGW SVWVR+ T W TA L++WSLVAP+L PDRDF
Sbjct  352  ATMYSAMLLSGW-TSNSENPDLIDVGWTSVWVRIGTEWATAGLYVWSLVAPVLLPDRDF  409



>ref|XP_004486156.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=409

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 131/177 (74%), Gaps = 3/177 (2%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVISLYC Y+CY+ L+SEPR YECN L+K     +   +   L T +  +  
Sbjct  234  VNGSLLPASVISLYCAYVCYTGLSSEPRGYECNGLNKSRAVNTGTLILGMLTTVLSVLYS  293

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME-KSKAVTYSYSFFHIIFSLAS  338
            +  RAGSSTT LSPPSSP+AG  KPLL   +  + ++ E +++ V+YSYSFFH+IF+LA+
Sbjct  294  AL-RAGSSTTFLSPPSSPKAGESKPLLEEMEEGKTKKEEKQARPVSYSYSFFHLIFALAT  352

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L+LW+L+AP++FPDR+F
Sbjct  353  MYSAMLLSGW-TSSSESSDLIDVGWTSVWVRIGTEWVTAGLYLWTLLAPLMFPDREF  408



>ref|XP_008340909.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=409

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 143/178 (80%), Gaps = 4/178 (2%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+Y  Y+C++AL+SEPRDY CN LH HSK+VS  TL LG+ TTVLSV+Y
Sbjct  234  VNGSLLPASVISVYSAYVCFTALSSEPRDYACNGLH-HSKAVSVSTLLLGMATTVLSVLY  292

Query  514  saVRAGssttllsppssPRAGGGKPLLP--LDKADEHEEMEKSKAVTYSYSFFHIIFSLA  341
            SA+RAGSSTT LSPP+SPR     PLL     +  + +E +++K V+YSY+FFH+IF+LA
Sbjct  293  SALRAGSSTTFLSPPTSPRGAEKTPLLDGKKLEEGKEKEDKEAKPVSYSYTFFHLIFALA  352

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTAAL++WSL+AP+LFPDR+F
Sbjct  353  SMYSAMLLSGWTDS-SESSDLIDVGWTSVWVRICTEWVTAALYVWSLLAPLLFPDREF  409



>ref|XP_010103434.1| putative serine incorporator [Morus notabilis]
 gb|EXB95837.1| putative serine incorporator [Morus notabilis]
Length=409

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYC Y+CY+ L+SEP DY+CN L+K      +  +   L T +  + 
Sbjct  233  AVNGSLLPASVISLYCAYVCYTGLSSEPHDYKCNGLNKSKAVSLSTLILGMLTTVLSVLY  292

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIFSLA  341
             +  RAGSSTT LSPPSSP++G  KPLL  +  +  E+ EK ++ V+YSYSFFH+IF+LA
Sbjct  293  SAL-RAGSSTTFLSPPSSPKSGAKKPLLEEELEEGKEKKEKETRPVSYSYSFFHLIFALA  351

Query  340  SMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            SMY+AMLL+GW+ S  ES  L+D+GW +VWVR+ TGWVTAALF+WS+VAP+ FPDR+F
Sbjct  352  SMYAAMLLSGWTNS-SESSDLIDIGWTTVWVRICTGWVTAALFVWSIVAPLFFPDREF  408



>ref|XP_008223013.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=411

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 143/180 (79%), Gaps = 6/180 (3%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+Y  Y+ Y+AL+SEPRDY CN LH HSK+VS  TL LG++TTVLSV+Y
Sbjct  234  VNGSLLPASVISVYSAYVLYTALSSEPRDYACNGLH-HSKAVSVSTLLLGMVTTVLSVLY  292

Query  514  saVRAGssttllsppssPRAGGG--KPLLP--LDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SA+RAGSSTT LSPPSSPRAG    KPLL     +  +  + +++K V+YSY+FFH+IF+
Sbjct  293  SALRAGSSTTFLSPPSSPRAGAAEKKPLLDGKELEEGKETKEKEAKPVSYSYTFFHLIFA  352

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTA L++WSLVAP LFPDR+F
Sbjct  353  LASMYSAMLLSGWTNS-SESSDLIDVGWTSVWVRICTEWVTAGLYVWSLVAPFLFPDREF  411



>ref|XP_008390818.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=411

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 135/180 (75%), Gaps = 6/180 (3%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+Y  Y+CY+AL+SEP  Y CN LH HSK+VS  TL LG+  TVLSV+Y
Sbjct  234  VNGSLLPASVISVYSAYVCYTALSSEPHGYACNGLH-HSKAVSLSTLLLGMAMTVLSVLY  292

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFHIIFS  347
            SA+RAGSST  LSPPSSPR G  +     D  +  E  EK+    K V YSY+FFH+IF+
Sbjct  293  SALRAGSSTNFLSPPSSPRGGAAEKTPLFDGKELEEGKEKNDKEVKPVXYSYTFFHLIFA  352

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTAAL++WSL+APIL PDR+F
Sbjct  353  LASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILIPDREF  411



>ref|XP_011010290.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=417

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 140/181 (77%), Gaps = 5/181 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN LH  SK+VST TL LG+LTTVLSV+
Sbjct  237  AVNGSLLPASVISIYCAYVCYTGLSSEPHDYACNGLHNKSKAVSTSTLVLGMLTTVLSVL  296

Query  517  ysaVRAGssttllsppssPRAGGGKP----LLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            YSAVRAGSSTT LSPPSSP+A  GK        L++  E ++  + + V+YSY+FFH+IF
Sbjct  297  YSAVRAGSSTTFLSPPSSPKASAGKKPLLEAEELEEGKEKKKEAEGQPVSYSYTFFHLIF  356

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLL+GW T   ES  L+DVGW SVWVR+ T W+T  L++W+L+AP+ FPDR+
Sbjct  357  ALASMYSAMLLSGW-TDTSESSSLIDVGWTSVWVRICTEWITGLLYIWTLLAPLFFPDRE  415

Query  169  F  167
            F
Sbjct  416  F  416



>ref|XP_006407969.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49422.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=313

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 142/179 (79%), Gaps = 8/179 (4%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++ SK+V+  TL LG+LTTVLSV+
Sbjct  140  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNR-SKAVTASTLILGMLTTVLSVL  198

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME--KSKAVTYSYSFFHIIFSL  344
            YSA+RAGSSTT LSPPSSPR+      L  D  D  ++    +++ V+YSYSFFHIIF+L
Sbjct  199  YSALRAGSSTTFLSPPSSPRSEA----LLEDPEDGKKKSGGGEARPVSYSYSFFHIIFAL  254

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  255  ASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKLCTGWVTAALYIWTLIAPLILPDREF  312



>gb|KDP40096.1| hypothetical protein JCGZ_02094 [Jatropha curcas]
Length=401

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 145/179 (81%), Gaps = 3/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN LHK +K+VST TL LG+LTTVLSV+
Sbjct  223  TVNGSLLPASVISVYCAYVCYTGLSSEPLDYACNGLHKSTKAVSTSTLVLGVLTTVLSVL  282

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSL  344
            YSAVRAGSSTT LSPPSSP+A   K  L  ++ +E +E ++ +A  V+YSY+FFH+IF+L
Sbjct  283  YSAVRAGSSTTFLSPPSSPKASDAKKPLLEEQLEEGKEKKEKEAKPVSYSYTFFHLIFAL  342

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLL+GW+ S  E+  L+DVGW SVWVR+ T WVTA L++W+LVAP++ PDR+F
Sbjct  343  ASMYSAMLLSGWTNS-SENSDLIDVGWISVWVRICTEWVTAGLYVWTLVAPVILPDREF  400



>ref|XP_002312742.1| TMS membrane family protein [Populus trichocarpa]
 gb|EEE90109.1| TMS membrane family protein [Populus trichocarpa]
Length=417

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 139/181 (77%), Gaps = 5/181 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN LH  SK+VST TL LG+LTT+LSV+
Sbjct  237  AVNGSLLPASVISIYCAYVCYTGLSSEPHDYACNGLHNKSKAVSTSTLVLGMLTTILSVL  296

Query  517  ysaVRAGssttllsppssPRAGGGKP----LLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            YSAVRAGSSTT LSPPSSP+A  GK        L++  E ++  + + V+YSY+FFH+IF
Sbjct  297  YSAVRAGSSTTFLSPPSSPKASAGKKPLLEAEELEEGKEKKKEAEGQPVSYSYTFFHLIF  356

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLL+GW T   ES  L+DVGW SVWVR+ T W+T  L+ W+L+AP+ FPDR+
Sbjct  357  ALASMYSAMLLSGW-TDTSESSSLIDVGWTSVWVRICTEWITGLLYTWTLLAPLFFPDRE  415

Query  169  F  167
            F
Sbjct  416  F  416



>ref|XP_006407970.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49423.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=406

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 129/179 (72%), Gaps = 8/179 (4%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++  +   L T +  + 
Sbjct  233  AVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNRSKAVTASTLILGMLTTVLSVLY  292

Query  517  ysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHIIFSL  344
             +  RAGSSTT LSPPSSPR+   + LL  P D   +    E ++ V+YSYSFFHIIF+L
Sbjct  293  SAL-RAGSSTTFLSPPSSPRS---EALLEDPEDGKKKSGGGE-ARPVSYSYSFFHIIFAL  347

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  348  ASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKLCTGWVTAALYIWTLIAPLILPDREF  405



>ref|XP_002516786.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF45400.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=414

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 142/179 (79%), Gaps = 3/179 (2%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVIS+YC Y+CY+ L+SEP DY CN LH  +K+VST TL LG+LTT+LSV+
Sbjct  236  TVNGSLLPASVISIYCAYVCYTGLSSEPHDYVCNGLHNKTKAVSTSTLILGMLTTILSVL  295

Query  517  ysaVRAGssttllsppssPRAGGGKP--LLPLDKADEHEEMEKSKAVTYSYSFFHIIFSL  344
            YSAVRAGSSTT LSPPSSP+A   K   L    +  + ++  +++ V+YSY+FFH+IF+L
Sbjct  296  YSAVRAGSSTTFLSPPSSPKASDAKKPLLEEQLEEGKEKKETEARPVSYSYTFFHLIFAL  355

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++W+L+AP+LFPDR+F
Sbjct  356  ASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICTEWVTAGLYVWTLLAPLLFPDREF  413



>ref|XP_007222705.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
 gb|EMJ23904.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
Length=411

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 140/181 (77%), Gaps = 6/181 (3%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+Y  Y+ Y+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVLSV+
Sbjct  233  QVNGSLLPASVISVYSAYVLYTALSSEPRGYACNGLH-HSKAVSVSTLLLGMATTVLSVL  291

Query  517  ysaVRAGssttllsppssPRAGGG--KPLLP--LDKADEHEEMEKSKAVTYSYSFFHIIF  350
            YSA+RAGSSTT LSPPSSPRAG    KPLL     +  +  + +++K V+YSY+FFH+IF
Sbjct  292  YSALRAGSSTTFLSPPSSPRAGAAEKKPLLDGKELEEGKETKEKEAKPVSYSYTFFHLIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTA L++WSLVAP L PDR+
Sbjct  352  ALASMYSAMLLSGWTDS-SESSDLIDVGWTSVWVRICTEWVTAGLYVWSLVAPFLLPDRE  410

Query  169  F  167
            F
Sbjct  411  F  411



>ref|XP_010024424.1| PREDICTED: serine incorporator 3 [Eucalyptus grandis]
 gb|KCW60868.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=416

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 141/185 (76%), Gaps = 9/185 (5%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASV+S+Y  Y+CY+AL+ EPR+Y CN LH  S +VST TL LG+LTTVLSV+
Sbjct  232  AVNGSLLPASVVSVYGAYVCYTALSCEPRNYVCNGLHNKSHAVSTSTLILGMLTTVLSVL  291

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM--------EKSKAVTYSYSFF  362
            YSA RAGSSTT LSPPSSP++G  KPLL  D  +E ++          + + VTYSYSFF
Sbjct  292  YSACRAGSSTTFLSPPSSPKSGAKKPLLDGDDVEEGKDKKDKKDKKEAEPQPVTYSYSFF  351

Query  361  HIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILF  182
            H+IF+LASMYSAMLL+   TS  +S  LVDVGW SVWVR+ T WVT+AL++W+LVAP++ 
Sbjct  352  HLIFALASMYSAMLLSD-WTSSSDSSDLVDVGWTSVWVRIATEWVTSALYIWTLVAPLIL  410

Query  181  PDRDF  167
            PDR+F
Sbjct  411  PDREF  415



>ref|XP_009117775.1| PREDICTED: wall-associated receptor kinase-like 5 isoform X1 
[Brassica rapa]
Length=796

 Score =   148 bits (373),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  385  VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLW  206
            VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+W
Sbjct  724  VTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIW  783

Query  205  SLVAPILFPDRDF  167
            SLVAPILFPDR+F
Sbjct  784  SLVAPILFPDREF  796



>ref|XP_002956760.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
 gb|EFJ42217.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
Length=415

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 117/184 (64%), Gaps = 21/184 (11%)
 Frame = -2

Query  700  LSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsv  521
            L+  GSIFP+S+I+LY  YLC+SAL SEPR+Y CN L     + S GTL LG++ T+ SV
Sbjct  246  LARGGSIFPSSMIALYAAYLCFSALQSEPREYACNGLGHRLTAASGGTLALGMVVTLASV  305

Query  520  vysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA------VTYSYSFFH  359
            VY+A RAGS                  L  L+ ++E E +  + A      VTY+YSFFH
Sbjct  306  VYAAFRAGS---------------NTALFTLEGSEEGEPLPSTAAATSLTPVTYNYSFFH  350

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMY AML+TGW T        +DVGWASVWV+    WVT  L++W+LVAP LFP
Sbjct  351  LIFALASMYIAMLMTGWGTVAQVRKDRIDVGWASVWVKPAAEWVTGLLYMWTLVAPALFP  410

Query  178  DRDF  167
            +RDF
Sbjct  411  ERDF  414



>ref|XP_005651318.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
 gb|EIE26774.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
Length=429

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 126/209 (60%), Gaps = 32/209 (15%)
 Frame = -2

Query  700  LSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsv  521
            L+  GS+FP+++ + YCTYLCYSAL SEP DY+CN L +   + S  TL  G+L T++SV
Sbjct  221  LAKNGSLFPSAIFTFYCTYLCYSALVSEPHDYQCNGLGQRLNAASATTLATGMLLTLVSV  280

Query  520  vysaVRAGssttllsppssPRAGG-GKPLLPLDK--------------------------  422
            VYSA+RAGS+T L    S   +    +PLL  DK                          
Sbjct  281  VYSALRAGSNTALFRLNSEEDSDPVEQPLLDDDKGRAYIAEEGTSAGLDGEVGMSRTART  340

Query  421  ADEHEEMEKS----KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  254
            ADE E  +++      VTY+Y+FFH IF++ASMY AML+TGW T   E   L+DVGW SV
Sbjct  341  ADEAERAKQTADEFTPVTYNYAFFHFIFAVASMYLAMLMTGWGTG-AEERDLIDVGWFSV  399

Query  253  WVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            WV+ VT W TAA + W LVAP LFPDR+F
Sbjct  400  WVKFVTQWATAATYCWMLVAPTLFPDREF  428



>gb|KJB67012.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=374

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 120/140 (86%), Gaps = 2/140 (1%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V  SI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGT+T+GLLTT+LSVV
Sbjct  237  AVGSSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTVTVGLLTTILSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTTLLSPPSSPRAGGGKPLLPLDKADE EE EK+KAVTYSY+FFHIIFSL S
Sbjct  297  YSAVRAGSSTTLLSPPSSPRAGGGKPLLPLDKADE-EEKEKNKAVTYSYAFFHIIFSLLS  355

Query  337  MYSAMLLTGWSTSVGESGKL  278
            +    LL  +S+  G S  L
Sbjct  356  ICGLSLLL-FSSQTGTSKSL  374



>ref|XP_002979274.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
 gb|EFJ19682.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
Length=376

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 118/177 (67%), Gaps = 38/177 (21%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVI++YCTY+CYSAL+SEPR+YECN LHKH   VSTGTL LG+LTT+LSVV
Sbjct  237  QVNGSLLPASVIAVYCTYICYSALSSEPRNYECNGLHKHENVVSTGTLVLGMLTTLLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTT LSPPSSPRAG                                      
Sbjct  297  YSAVRAGSSTTFLSPPSSPRAG-------------------------------------L  319

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGW  S  E    +DVGW SVWVR+ T W+TA L++WSLVAP+LFPDRDF
Sbjct  320  MYSAMLLTGWGNS-AEGKDTIDVGWPSVWVRICTQWLTAILYVWSLVAPLLFPDRDF  375



>gb|KIZ05916.1| putative serine incorporator [Monoraphidium neglectum]
Length=447

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 120/199 (60%), Gaps = 25/199 (13%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            S  GS+FP+++ SLY  YLCYSAL SEP+DY CN L     + S  TL +G+L T+LSVV
Sbjct  248  SRGGSLFPSAITSLYVMYLCYSALQSEPKDYACNGLAHRINAASGSTLVIGMLVTLLSVV  307

Query  517  ysaVRAGssttllspps----sPRAGGGKPLLPLDK--------------------ADEH  410
            YSA+RAGS++ L +             G+PLL  +                     AD  
Sbjct  308  YSALRAGSNSQLFTLADDNDDIAATSAGRPLLDAEAVGDSADGAAPAAVSASRAPGADAT  367

Query  409  EEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGW  230
              ++    V+Y+YSFFH+IF+LASMY AML+TGW  +V +    VDVGW SVWV+    W
Sbjct  368  AALDDYTPVSYNYSFFHLIFALASMYIAMLMTGWG-AVEQEKDRVDVGWTSVWVKTGAEW  426

Query  229  VTAALFLWSLVAPILFPDR  173
            VTA L+ W+LVAP+LFP+R
Sbjct  427  VTALLYSWTLVAPVLFPER  445



>ref|XP_002506090.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67348.1| predicted protein [Micromonas sp. RCC299]
Length=433

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 108/193 (56%), Gaps = 16/193 (8%)
 Frame = -2

Query  700  LSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsv  521
            ++ +GS+ P++V++ YC YLCYSALASEP +Y CN    ++       +   +LT     
Sbjct  241  IAKEGSLLPSAVVTSYCVYLCYSALASEPTEYRCNPRGAYAGDGKASEVASTVLTLASVA  300

Query  520  vysaVRAGssttllsppssPRAG----------GGKPLLPLDKADEHEEME-----KSKA  386
              +  RAGSS            G          GG        AD  +++       S  
Sbjct  301  YSAV-RAGSSDFFGGVNLGDGDGDYAALSGAEMGGGTDADAGDADSEDDVGGAASYPSGP  359

Query  385  VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLW  206
            V+YSYSFFH IF+LASM+ AML+TGW     +  + VDVGWASVWV++ + WVTA L+ W
Sbjct  360  VSYSYSFFHFIFALASMFLAMLMTGWGRDDYKGAERVDVGWASVWVKMCSVWVTAGLYTW  419

Query  205  SLVAPILFPDRDF  167
            SL+AP LFPDR+F
Sbjct  420  SLIAPALFPDREF  432



>gb|ABF97020.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=372

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 115/177 (65%), Gaps = 42/177 (24%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVIS+YC YLCY++L+SEP DY CN LH+HSK VS   L LG+LTTVLSVV
Sbjct  237  QVNGSVMPASVISVYCAYLCYTSLSSEPDDYACNGLHRHSKQVSMSALILGMLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTT LSPPSSPR                                        
Sbjct  297  YSAVRAGSSTTFLSPPSSPR----------------------------------------  316

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
              SAMLLTGW+++  +S +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  317  --SAMLLTGWTSAASDSSELMDVGWTTVWVRICTEWATAALYIWTLVAPLLFPDRDF  371



>ref|XP_001416509.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94802.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=393

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 106/177 (60%), Gaps = 2/177 (1%)
 Frame = -2

Query  691  KGSIFPASVISLYCTYLCYSALASEPRDYECN--ALHKHsksvstgtltlgllttvlsvv  518
            +G + P++ ++LYCTYLCYSAL SEP  Y C   +    ++ +      +    T++SVV
Sbjct  217  EGCLLPSAAVTLYCTYLCYSALTSEPSTYACRPRSFIDANEELKKPANLVTTAFTLVSVV  276

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            Y+A+RAG S               +  L     +E  E + S  V Y+YSFFH++F+LA+
Sbjct  277  YAAMRAGESNFWDMEVDESFQSELREALNDGDEEEASEGDASGPVKYNYSFFHLMFALAA  336

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MY++MLLTGW T   +  + +  GWASVWV+  + W T A++LW L+AP LFPDR+F
Sbjct  337  MYTSMLLTGWGTRHEDDTEAIGSGWASVWVKFFSVWATGAIYLWCLIAPALFPDREF  393



>ref|XP_002988580.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
 gb|EFJ10376.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
Length=371

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 114/177 (64%), Gaps = 43/177 (24%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
             V GS+ PASVI++YCTY+CYSAL+SEPR+YECN LHKH   VSTGTL LG+LTT+LSVV
Sbjct  237  QVNGSLLPASVIAVYCTYICYSALSSEPRNYECNGLHKHENVVSTGTLVLGMLTTLLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
            YSAVRAGSSTT LSPPSSPRA                                       
Sbjct  297  YSAVRAGSSTTFLSPPSSPRA---------------------------------------  317

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
               AMLLTGW  S  E    +DVGW SVWVR+ T W+TA L++WSLVAP+LFPDRDF
Sbjct  318  ---AMLLTGWGNS-AEGKDTIDVGWPSVWVRICTQWLTAILYVWSLVAPLLFPDRDF  370



>ref|XP_011397622.1| putative serine incorporator [Auxenochlorella protothecoides]
 gb|KFM24734.1| putative serine incorporator [Auxenochlorella protothecoides]
Length=435

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 112/184 (61%), Gaps = 10/184 (5%)
 Frame = -2

Query  688  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  509
            GS+FPA+ + LY +Y+ YSAL SEPRDY CN L     + S  TL  G+L T+LSVVYSA
Sbjct  251  GSLFPAAAVGLYVSYMGYSALQSEPRDYACNGLGARLGAASGATLAGGMLLTLLSVVYSA  310

Query  508  VRAGssttl-lsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIFSLASM  335
             RAGS+T       +     G +PLL  D       ++   A V Y Y+ F+ +F+LASM
Sbjct  311  FRAGSNTQTFAGAWAGGNGAGAEPLLAGDAELTSAGLDGEDAPVPYCYAQFYAVFALASM  370

Query  334  YSAMLLTGW--------STSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            Y AML+TGW        S +       VDVGW SVWV++VT WV AAL+ W+L+AP LFP
Sbjct  371  YIAMLMTGWGATGQPKASDAAAGCSDAVDVGWTSVWVKIVTQWVAAALYCWTLLAPSLFP  430

Query  178  DRDF  167
            DR F
Sbjct  431  DRVF  434



>gb|AEW08633.1| hypothetical protein CL976Contig1_02, partial [Pinus radiata]
 gb|AFG57497.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57498.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57499.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57500.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57501.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57502.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57503.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57504.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57505.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57506.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57507.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57508.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57509.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57510.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57511.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57512.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57513.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
Length=84

 Score =   112 bits (280),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  430  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  251
            +++  ++ + ++ + VTYSY+FFH+IF+LASMYSAMLLTGW++S  +  KL+ VGW +VW
Sbjct  1    IEEGQKNAQKDEERPVTYSYTFFHVIFALASMYSAMLLTGWTSSTPDGEKLIGVGWHTVW  60

Query  250  VRVVTGWVTAALFLWSLVAPILFP  179
            VR+ T W+TAAL++WSLVAP+LFP
Sbjct  61   VRICTEWITAALYIWSLVAPLLFP  84



>dbj|BAD94992.1| hypothetical protein [Arabidopsis thaliana]
Length=57

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  1    MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  57



>emb|CEG01070.1| TMS membrane protein/tumour differentially expressed protein 
[Ostreococcus tauri]
Length=422

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 108/181 (60%), Gaps = 3/181 (2%)
 Frame = -2

Query  700  LSVKGSIFPASVISLYCTYLCYSALASEPRDYEC--NALHKHsksvstgtltlgllttvl  527
            +S +G + P S ++LYC YLCYSAL+SEP  Y C   +    ++++      +  + T++
Sbjct  242  ISREGCLLPTSAVTLYCAYLCYSALSSEPSTYACRPQSFIDANEALRKPATLVQTVFTLV  301

Query  526  svvysaVRAGssttllsppssPRAGG-GKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            SVVY+A+RAG S            G  G  L   +  +  +E   S  V Y+YSFFH+IF
Sbjct  302  SVVYAAMRAGESNFWHMDVDEEFIGELGDVLNDEEDEEAEDESSPSGPVRYNYSFFHLIF  361

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LA+MY++MLLTGW T   +  + +  GWASVWV+  + W T  ++ W LVAP LFP+R+
Sbjct  362  ALAAMYTSMLLTGWGTRRPDDSEAIGSGWASVWVKYFSVWATGTIYAWCLVAPALFPERE  421

Query  169  F  167
            F
Sbjct  422  F  422



>ref|XP_003075128.1| OJ1249_F12.26 gene product (ISS), partial [Ostreococcus tauri]
Length=423

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 108/181 (60%), Gaps = 3/181 (2%)
 Frame = -2

Query  700  LSVKGSIFPASVISLYCTYLCYSALASEPRDYEC--NALHKHsksvstgtltlgllttvl  527
            +S +G + P S ++LYC YLCYSAL+SEP  Y C   +    ++++      +  + T++
Sbjct  243  ISREGCLLPTSAVTLYCAYLCYSALSSEPSTYACRPQSFIDANEALRKPATLVQTVFTLV  302

Query  526  svvysaVRAGssttllsppssPRAGG-GKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            SVVY+A+RAG S            G  G  L   +  +  +E   S  V Y+YSFFH+IF
Sbjct  303  SVVYAAMRAGESNFWHMDVDEEFIGELGDVLNDEEDEEAEDESSPSGPVRYNYSFFHLIF  362

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LA+MY++MLLTGW T   +  + +  GWASVWV+  + W T  ++ W LVAP LFP+R+
Sbjct  363  ALAAMYTSMLLTGWGTRRPDDSEAIGSGWASVWVKYFSVWATGTIYAWCLVAPALFPERE  422

Query  169  F  167
            F
Sbjct  423  F  423



>emb|CAN80334.1| hypothetical protein VITISV_009413 [Vitis vinifera]
Length=57

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  1    MYSAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  57



>ref|XP_004302121.1| PREDICTED: serine incorporator 3-like [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGLLTTVLSVV
Sbjct  141  TVGGSILPASVISVYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLLTTVLSVV  200

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA  386
            YSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK +E EE EK+K+
Sbjct  201  YSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKPEEREENEKAKS  244



>gb|ACG35592.1| hypothetical protein [Zea mays]
Length=57

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  1    MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPVLFPDREF  57



>gb|EFA77480.1| TMS membrane protein [Polysphondylium pallidum PN500]
Length=419

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 98/181 (54%), Gaps = 19/181 (10%)
 Frame = -2

Query  682  IFPASVISLYCTYLCYSALASEPR-DYECNALHKHsksvstgtltlgllttvlsvvysaV  506
            +F + V+ LY  YL +SA+ SEP  D   N+  + + ++  G++   +            
Sbjct  246  LFQSGVVMLYSAYLVFSAIMSEPSMDNNSNSGKQKTWTIIIGSMFTIISVC---------  296

Query  505  RAGssttllsppssPRAGGGKPLLPL-----DKADEHEEMEKSKAVTYSYSFFHIIFSLA  341
             +    +  +      +GGG   LP      + AD+  E ++S  V Y+Y+FFHI F+L 
Sbjct  297  YSAFRASDSNEILGSSSGGGFDKLPTVASDDEAADDKMEDDESGGVAYNYTFFHITFALG  356

Query  340  SMYSAMLLTGWSTSVGESGK----LVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            +MY  MLLT W+T  G SG      VD G  SVWV++V+GW+   L+LW+LVAP+L P+R
Sbjct  357  AMYIGMLLTNWATISGTSGSNGDLNVDSGMVSVWVKIVSGWLVHLLYLWTLVAPVLMPNR  416

Query  172  D  170
            +
Sbjct  417  E  417



>emb|CEG74958.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=320

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  128  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  186

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  187  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  246

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  247  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  306

Query  190  ILFPDR  173
            +L PDR
Sbjct  307  VLMPDR  312



>emb|CEG74957.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=317

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  128  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  186

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  187  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  246

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  247  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  306

Query  190  ILFPDR  173
            +L PDR
Sbjct  307  VLMPDR  312



>emb|CEG74956.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=396

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 107/186 (58%), Gaps = 20/186 (11%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K S+   T ++ LG L T L++ YS  RA +
Sbjct  204  SSIVVIYCTYLVLSAVANEPNDKECNPLRK-SQGPQTTSIVLGALFTFLAIAYSTSRAAT  262

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  263  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  322

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  323  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  382

Query  190  ILFPDR  173
            +L PDR
Sbjct  383  VLMPDR  388



>emb|CEG67769.1| hypothetical protein RMATCC62417_04149 [Rhizopus microsporus]
Length=393

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 108/186 (58%), Gaps = 20/186 (11%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K S+   T ++ LG L T L++ YS  RA +
Sbjct  204  SSIVVIYCTYLVLSAVANEPNDKECNPLRK-SQGPQTTSIVLGALFTFLAIAYSTSRAAT  262

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                 +  SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  263  QGVEGATESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  322

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSL+AP
Sbjct  323  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYIWSLIAP  382

Query  190  ILFPDR  173
            +L PDR
Sbjct  383  VLMPDR  388



>emb|CEG74955.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=393

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 107/186 (58%), Gaps = 20/186 (11%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K S+   T ++ LG L T L++ YS  RA +
Sbjct  204  SSIVVIYCTYLVLSAVANEPNDKECNPLRK-SQGPQTTSIVLGALFTFLAIAYSTSRAAT  262

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  263  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  322

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  323  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  382

Query  190  ILFPDR  173
            +L PDR
Sbjct  383  VLMPDR  388



>emb|CEG74953.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=454

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  265  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  323

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  324  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  383

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  384  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  443

Query  190  ILFPDR  173
            +L PDR
Sbjct  444  VLMPDR  449



>emb|CEG74954.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=457

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  265  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  323

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  324  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  383

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  384  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  443

Query  190  ILFPDR  173
            +L PDR
Sbjct  444  VLMPDR  449



>emb|CEJ00743.1| hypothetical protein RMCBS344292_14792 [Rhizopus microsporus]
Length=453

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 100/182 (55%), Gaps = 16/182 (9%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRA--  500
            +S++ +YCTYL  SA+A+EP D ECN L +     +T  +   L T +     ++  A  
Sbjct  265  SSIVVIYCTYLVLSAVANEPNDKECNPLRRSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  324

Query  499  ---GssttllsppssPRAGGGKPLLPLDKADEHEEM---EKSKAVTYSYSFFHIIFSLAS  338
               G + +            G  L   D  D+ ++    E+  AV Y+YSFFH  F++A+
Sbjct  325  GVEGVTESSSREHLIAAVENGSALYKDDDQDDDDDEHDDERYGAV-YNYSFFHFTFAIAA  383

Query  337  MYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAPILFP  179
            MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSL+AP+L P
Sbjct  384  MYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYIWSLIAPVLMP  443

Query  178  DR  173
            DR
Sbjct  444  DR  445



>emb|CEJ03265.1| hypothetical protein RMCBS344292_17253 [Rhizopus microsporus]
Length=316

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 97/181 (54%), Gaps = 14/181 (8%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRA--  500
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++  A  
Sbjct  128  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  187

Query  499  ---GssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK--AVTYSYSFFHIIFSLASM  335
               G++ +            G  L   D  D+ ++    +     Y+YSFFH  F++A+M
Sbjct  188  GVEGATESSSREHLIAAVENGSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTFAIAAM  247

Query  334  YSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            Y AMLLT W+T + E        L+ +G  + +VWV+ V+GW+   L++WSL+AP+L PD
Sbjct  248  YVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKAVSGWICYGLYIWSLIAPVLMPD  307

Query  175  R  173
            R
Sbjct  308  R  308



>ref|XP_002982341.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
 gb|EFJ16586.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
Length=382

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 84/176 (48%), Gaps = 16/176 (9%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V   +  + +ISLY  +LC+SA+ SEPR   CN   + +      T+    +  V  V  
Sbjct  222  VSAGLMTSGLISLYIVFLCWSAIMSEPRSEVCNTRPRQTGKADLLTVLSFFMGLVAIVFA  281

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            +                       P +P +   + E  E  K V YSY FFH +F++ SM
Sbjct  282  TFSTGA---------------DSNPFVPANPTPDPENQEI-KRVPYSYGFFHFVFAVGSM  325

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            Y AML  GW+         +DVGWASVWV++   W+ A +++W++V+ ++   R F
Sbjct  326  YFAMLFVGWNLHQTMLKWSIDVGWASVWVKITNEWLAAGVYIWTMVSSVVSNIRQF  381



>ref|XP_001770496.1| predicted protein [Physcomitrella patens]
 gb|EDQ64665.1| predicted protein [Physcomitrella patens]
Length=387

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 83/176 (47%), Gaps = 19/176 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V   +  + V+SLY  +LC+SA+ SEP    CN   + +      T+             
Sbjct  229  VNAGLLTSGVMSLYLIFLCWSAIMSEPLSASCNTRERQTGKADWLTII------------  276

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
                +     L    ++   G         K DE ++     ++ YSY FFH +F+L +M
Sbjct  277  ----SFLIAFLAIVFATYTTGIDSEAFSFKKKDESKD---DGSLPYSYGFFHFVFALGAM  329

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            Y AML  GW+         +D+GWASVWV++V  W+ A ++ W+++ P +  +RDF
Sbjct  330  YLAMLFVGWNLHQTMHKWSIDIGWASVWVKIVNQWLAAIIYGWTMIGPFVLKNRDF  385



>ref|XP_004366977.1| TMS membrane protein [Dictyostelium fasciculatum]
 gb|EGG19994.1| TMS membrane protein [Dictyostelium fasciculatum]
Length=420

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 89/174 (51%), Gaps = 8/174 (5%)
 Frame = -2

Query  682  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  503
            +  + V+ LY TYL YSA+ SEP    C+ +        T  +        +       R
Sbjct  248  LLQSGVVMLYSTYLVYSAIMSEPAS-TCSTMANQDPKNYTVIMGAIFTIISVCYSAF--R  304

Query  502  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLASMYS  329
            A  ST LL    SP+          D  D  ++ME  +   V YSY+FFHI F+  +MY 
Sbjct  305  ASDSTELLGKSDSPQYSSLNAFSD-DDDDVPQQMEDDEKHEVAYSYTFFHITFAFGAMYI  363

Query  328  AMLLTGWSTSVGESGKLVDV--GWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
             MLLT WST  G S   ++V  G  SVWV++V+GW+   L+LW+LV P LFP+R
Sbjct  364  GMLLTNWSTIGGLSSASINVDSGLVSVWVKIVSGWLVHLLYLWTLVGPALFPNR  417



>gb|EXX70672.1| Tms1p [Rhizophagus irregularis DAOM 197198w]
Length=240

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = -2

Query  445  KPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWST-SVGESGKL  278
            K +LP   LD+  ++   ++   V Y+Y+FFH IF++A+MY AMLLT W+T ++  + KL
Sbjct  138  KEILPPSALDEEADYPMDDEDYDVNYNYTFFHFIFAIAAMYVAMLLTDWNTFTMTGNEKL  197

Query  277  VDVGWAS--VWVRVVTGWVTAALFLWSLVAPILFPDR  173
            V +G +   VWV+V++GWV   L+ WSLVAP LFP+R
Sbjct  198  VVIGRSHTIVWVKVISGWVCFLLYYWSLVAPALFPER  234



>ref|XP_002304839.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
 gb|EEE79818.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
Length=364

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V GS+ PASVISLYC YLCYS LASEPR+YECN LH+HSK+VSTGTL++GLLTTVLSVV
Sbjct  237  AVNGSVLPASVISLYCMYLCYSGLASEPREYECNGLHRHSKAVSTGTLSIGLLTTVLSVV  296

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK  395
            YSAVRAGSST LLSPPSSPRAG  KPLLPL     +++  +
Sbjct  297  YSAVRAGSSTALLSPPSSPRAGADKPLLPLTTRQTNKKKRR  337



>ref|XP_003062471.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53290.1| predicted protein [Micromonas pusilla CCMP1545]
Length=442

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -2

Query  394  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL-VDVGWASVWVRVVTGWVTAA  218
            S  V+Y+Y+FFH IF+LAS Y AML+TGW     E G   VDVGWASV+V+  + WVT  
Sbjct  365  SGPVSYNYAFFHFIFALASAYLAMLMTGWGDRAFEDGGAPVDVGWASVYVKYASLWVTGL  424

Query  217  LFLWSLVAPILFPDRD  170
            L+ WSLVAP + PDRD
Sbjct  425  LYTWSLVAPAVMPDRD  440


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  703  ILSVKGSIFPASVISLYCTYLCYSALASEPRDYECN  596
            ++++ GS+ P++V++ YCTYL YSALASEP +YECN
Sbjct  237  VVTLDGSLLPSAVVTSYCTYLLYSALASEPSEYECN  272



>ref|XP_001625531.1| predicted protein [Nematostella vectensis]
 gb|EDO33431.1| predicted protein [Nematostella vectensis]
Length=446

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -2

Query  415  EHEEM--EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRV  242
            +H+++  ++S +V+Y+YSFFH  F LAS+Y  M LT W +  G     +   WA+VWV++
Sbjct  359  KHQKVYDDESTSVSYNYSFFHFTFFLASLYIMMTLTNWYSPQGSDFSKLTSNWATVWVKI  418

Query  241  VTGWVTAALFLWSLVAPILFPDRDF  167
             T WV  AL+ W+L+AP+L PDRDF
Sbjct  419  STSWVCLALYAWTLLAPVLMPDRDF  443



>gb|KDD71727.1| hypothetical protein H632_c4498p0 [Helicosporidium sp. ATCC 50920]
Length=169

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (58%), Gaps = 8/104 (8%)
 Frame = -2

Query  457  AGGGKPLLPLDKADEHEEMEKSKA-------VTYSYSFFHIIFSLASMYSAMLLTGWSTS  299
            +G  +PL  + +A+  E      A       + YSY+ F+ + +LAS Y +ML+TGW   
Sbjct  66   SGAPRPLRAMSRAEAAEPGSYGAASAAPRAPIPYSYAQFYAVLALASAYVSMLMTGWGAG  125

Query  298  VGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            +   G LVDVGW SV+V+  T W    L+LW L AP LFPDRDF
Sbjct  126  MMAPG-LVDVGWTSVYVKCATQWGAGVLYLWMLFAPALFPDRDF  168



>ref|XP_002965853.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
 ref|XP_002983103.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ15912.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ33273.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
Length=365

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 81/176 (46%), Gaps = 19/176 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V   +  + +ISLY  +LC+SA+ SEP    CN   + +      T+             
Sbjct  208  VNAGLLTSGLISLYLVFLCWSAIMSEPASELCNTRSRQTGKADWLTVL------------  255

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
                +          ++   G     L L  +   EE      + YSY FFH +F++ +M
Sbjct  256  ----SFLIAFFAIILATFSTGIDSKSLALPHS---EEETSENDIPYSYGFFHFVFAMGAM  308

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            Y AML  GW+         +DVGWASVWV+V+  W+ AA+++W++V   +   RDF
Sbjct  309  YFAMLFVGWNLHQTMHRWSIDVGWASVWVKVINEWLAAAVYIWTMVCVFVLKGRDF  364



>ref|XP_009493459.1| hypothetical protein H696_01290 [Fonticula alba]
 gb|KCV71881.1| hypothetical protein H696_01290 [Fonticula alba]
Length=116

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -2

Query  427  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVG--WASV  254
            D AD     +++++  YSYS FH IF+LA++Y +MLL+ W  ++  SG  + +G  W  +
Sbjct  27   DDADAEHTGDEAESCQYSYSTFHFIFALAALYMSMLLSDWG-AINLSGAPIFIGHEWLGI  85

Query  253  WVRVVTGWVTAALFLWSLVAPILFPDR  173
            W+R+VT W+   LF W+LVAPI  PDR
Sbjct  86   WIRIVTSWIGYGLFSWTLVAPIFLPDR  112



>ref|XP_009336936.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Pyrus x bretschneideri]
Length=272

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  415  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  236
              +E E    V Y Y FFH +F++ +MY AMLL GW+T        +DVGWA+ WVR+V 
Sbjct  186  RKDETESKDDVPYGYGFFHFVFAMGAMYFAMLLIGWNTHQSMRRFTIDVGWANTWVRIVN  245

Query  235  GWVTAALFLWSLVAPILFPDRD  170
             W+   ++LW LVAPI++  R 
Sbjct  246  EWIAVCVYLWMLVAPIVWESRQ  267



>ref|XP_002157067.2| PREDICTED: probable serine incorporator-like, partial [Hydra 
vulgaris]
Length=423

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 9/97 (9%)
 Frame = -2

Query  430  LDKADEHEEMEK---------SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL  278
            +   DE+EE EK            V Y+YS+FH  F LAS+Y  M+LT W +      K 
Sbjct  326  IASGDENEESEKIGQNVYDNEKVQVAYNYSYFHFTFMLASLYIMMMLTNWYSPENSDSKT  385

Query  277  VDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            +   W++VW++VV+ W   A+F+W+L+AP+L+PDR+F
Sbjct  386  LISSWSTVWIKVVSCWACFAIFMWTLLAPVLWPDRNF  422



>gb|ESA19644.1| hypothetical protein GLOINDRAFT_19362 [Rhizophagus irregularis 
DAOM 181602]
Length=485

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = -2

Query  445  KPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWST-SVGESGKL  278
            K +LP   LD+  ++   ++   V Y+Y+FFH IF++A+MY AMLLT W+T ++  + KL
Sbjct  383  KEILPPSALDEEADYPMDDEDYDVNYNYTFFHFIFAIAAMYVAMLLTDWNTFTMTGNEKL  442

Query  277  VDVGWAS--VWVRVVTGWVTAALFLWSLVAPILFPDR  173
            V +G +   VWV+V++GWV   L+ WSLVAP LFP+R
Sbjct  443  VVIGRSHTIVWVKVISGWVCFLLYYWSLVAPALFPER  479



>ref|XP_008242601.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=389

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -2

Query  415  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  236
              +E E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  303  RKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTIDVGWASTWVRIVN  362

Query  235  GWVTAALFLWSLVAPILFPDRD  170
             W+   ++LW LVAPI++  R 
Sbjct  363  EWIAVCVYLWMLVAPIIWKSRQ  384



>ref|XP_007202140.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
 gb|EMJ03339.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
Length=389

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -2

Query  415  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  236
              +E E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  303  RKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTIDVGWASTWVRIVN  362

Query  235  GWVTAALFLWSLVAPILFPDRD  170
             W+   ++LW LVAPI++  R 
Sbjct  363  EWIAVCVYLWMLVAPIIWKSRQ  384



>ref|XP_009352478.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  415  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  236
             ++E E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  312  RNDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTLDVGWASTWVRIVN  371

Query  235  GWVTAALFLWSLVAPILFPDRD  170
             W+   ++LW LVAPI++  R 
Sbjct  372  EWIAVCVYLWMLVAPIIWKSRQ  393



>ref|NP_741561.1| Protein Y57E12AL.1, isoform a [Caenorhabditis elegans]
 emb|CCD69746.1| Y57E12AL.1, isoform a [Caenorhabditis elegans]
Length=459

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 8/95 (8%)
 Frame = -2

Query  430  LDKADEHEEMEKSK-------AVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVD  272
            L+ AD+ E     +        V YSYSFFH +F+LAS+Y  M LT W     +   L +
Sbjct  366  LNGADDAESQNSKRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKPSNDLSHL-N  424

Query  271  VGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
               ASVWV++V+ WV  AL+ W+LVAPI++PDR+F
Sbjct  425  SNMASVWVKIVSSWVCVALYCWTLVAPIIYPDREF  459



>ref|NP_741562.1| Protein Y57E12AL.1, isoform b [Caenorhabditis elegans]
 emb|CCD69747.1| Y57E12AL.1, isoform b [Caenorhabditis elegans]
Length=389

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (58%), Gaps = 9/104 (9%)
 Frame = -2

Query  454  GGGKPLLPLDKADEHEEMEKSK--------AVTYSYSFFHIIFSLASMYSAMLLTGWSTS  299
            GGG       +  +  E + SK         V YSYSFFH +F+LAS+Y  M LT W   
Sbjct  287  GGGNTSDEAIQLTDDAESQNSKRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKP  346

Query  298  VGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
              +   L +   ASVWV++V+ WV  AL+ W+LVAPI++PDR+F
Sbjct  347  SNDLSHL-NSNMASVWVKIVSSWVCVALYCWTLVAPIIYPDREF  389



>gb|KIH42470.1| TMS membrane protein/tumor differentially expressed protein, 
partial [Ancylostoma duodenale]
Length=91

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = -2

Query  400  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  221
             +++ V YSYSFFH +F LAS+Y  M LT W     +   L +   ASVWV++V+ W+  
Sbjct  15   NETEGVAYSYSFFHFMFGLASLYVMMTLTSWYNPDNDLTHL-NSNMASVWVKIVSSWLCV  73

Query  220  ALFLWSLVAPILFPDRDF  167
            AL+ W+LVAP LFPDR+F
Sbjct  74   ALYGWTLVAPALFPDREF  91



>ref|XP_010469509.1| PREDICTED: probable serine incorporator isoform X4 [Camelina 
sativa]
Length=311

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 19/170 (11%)
 Frame = -2

Query  682  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  503
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +             
Sbjct  147  LLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI-------------  193

Query  502  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  323
            A  +  + +  +   +   +     D+A E E+      + YSY FFH++FSL +MY AM
Sbjct  194  AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVFSLGAMYFAM  247

Query  322  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            L   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  248  LFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  297



>ref|XP_004336528.1| serine incorporator 3, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14515.1| serine incorporator 3, putative [Acanthamoeba castellanii str. 
Neff]
Length=429

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 95/199 (48%), Gaps = 30/199 (15%)
 Frame = -2

Query  682  IFPASVISLYCTYLCYSALASEPRD--YECNALHKHsksvstgtltlgllttvlsvvysa  509
            +  + V++LYCTYL YSA++SEP    ++CN       SVS+           +      
Sbjct  231  LLQSGVVTLYCTYLVYSAVSSEPNSGSFQCNPFDNMGGSVSSVLTGAAFTIVAVCWSTIR  290

Query  508  VRAGss------ttllsppssPRAGGGKPLLPLDKADEH-----------------EEME  398
            +    +      +   +  S   A  G  LLP +  DE+                 E+ E
Sbjct  291  MSTKGNDLLEGGSGATTDSSIQAAEEGDKLLP-ELNDENIPGSDSHHDDDHHEGKVEDDE  349

Query  397  KSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGK---LVDVGWASVWVRVVTGWV  227
            K + V Y+YSFFHI F L  MY  M++T W    G S      VD G+ +VWV++ T W+
Sbjct  350  KDE-VAYNYSFFHITFMLGVMYVYMIMTDWQIVSGASHSDDFKVDHGFTAVWVKLSTSWL  408

Query  226  TAALFLWSLVAPILFPDRD  170
             A L++W+L+API+ P RD
Sbjct  409  AALLYIWTLIAPIVLPGRD  427



>ref|XP_010440599.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=101

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 4/88 (5%)
 Frame = -2

Query  436  LPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  257
                K + HEE     A+ Y Y FFH +F+  +MY AMLL GW+         +DVGW S
Sbjct  15   FQFRKEENHEE----DAIPYGYGFFHFVFATGAMYFAMLLVGWNIHHSMKKWTIDVGWTS  70

Query  256  VWVRVVTGWVTAALFLWSLVAPILFPDR  173
             WVR+V  W+   +++W LVAP++   R
Sbjct  71   TWVRIVNEWLAVGVYIWMLVAPMVLKSR  98



>gb|ESA13270.1| hypothetical protein GLOINDRAFT_347023 [Rhizophagus irregularis 
DAOM 181602]
Length=320

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 88/170 (52%), Gaps = 22/170 (13%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            AS++++YCTY+  SA+A+EP D  CN L +   + +T  +                    
Sbjct  166  ASMVTIYCTYIILSAIANEPDDNMCNPLTRSRGTRTTTIVL----------------GTI  209

Query  493  sttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLT  314
             T L    S+ RA      L  D     +E      V Y+Y  FH IF++ASMY AMLLT
Sbjct  210  LTFLAIAYSTSRAATQTSALDDDDDGHDDE---KNGVAYNYGAFHFIFAVASMYVAMLLT  266

Query  313  GWST-SVGESGKLVDVGWA--SVWVRVVTGWVTAALFLWSLVAPILFPDR  173
             W+  +   S +LV +G +  +VWV+VV+ W+   L+ W+L+ P+L P+R
Sbjct  267  NWNNINTTGSEELVIIGQSIVAVWVKVVSSWICLLLYTWTLIGPVLMPER  316



>ref|XP_004287083.1| PREDICTED: probable serine incorporator isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011458173.1| PREDICTED: probable serine incorporator isoform X1 [Fragaria 
vesca subsp. vesca]
Length=406

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  415  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  236
            + +E E    V Y Y FFH +F+  +MY AMLL GW+T+       +DVGW S WVR+V 
Sbjct  319  KKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTNHSMKKWTIDVGWTSTWVRIVN  378

Query  235  GWVTAALFLWSLVAPILFPDRD  170
             W+   ++LW LVAPI++  R 
Sbjct  379  EWIAVCVYLWMLVAPIIWKSRQ  400



>ref|NP_189089.3| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAL36053.1| AT3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AAQ89613.1| At3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AEE76900.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 75/172 (44%), Gaps = 17/172 (10%)
 Frame = -2

Query  688  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  509
            G + PA ++ LY  ++C+ A+ SEP    CN                          +  
Sbjct  248  GYLTPA-LMGLYVVFICWCAIRSEPVGESCN----------------RKAAASNRTDWLT  290

Query  508  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYS  329
            + +     L    ++   G         K +  +E E    V Y Y FFH +F+  +MY 
Sbjct  291  IISFVVALLAMVIATFSTGIDSQCFQFKKDENDQEEEAEDDVPYGYGFFHFVFATGAMYF  350

Query  328  AMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            AMLL GW+T        +DVGW S WVRVV  W+   +++W LVAP++   R
Sbjct  351  AMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAVCVYIWMLVAPLILKSR  402



>dbj|GAM29010.1| hypothetical protein SAMD00019534_121860, partial [Acytostelium 
subglobosum LB1]
Length=339

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 4/84 (5%)
 Frame = -2

Query  415  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVG--ESGKL-VDVGWASVWVR  245
            E ++ EK   V Y+YSFFHI F+L +MY  MLLT WST  G   +G L VD G  SVWV+
Sbjct  254  EMDDDEK-DGVAYNYSFFHITFALGAMYIGMLLTNWSTISGLDNNGNLNVDSGMVSVWVK  312

Query  244  VVTGWVTAALFLWSLVAPILFPDR  173
            +V+ W    L+ W+LV P LFP+R
Sbjct  313  IVSCWCVHILYFWTLVGPTLFPNR  336



>ref|XP_011458210.1| PREDICTED: probable serine incorporator isoform X2 [Fragaria 
vesca subsp. vesca]
Length=403

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  415  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  236
            + +E E    V Y Y FFH +F+  +MY AMLL GW+T+       +DVGW S WVR+V 
Sbjct  316  KKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTNHSMKKWTIDVGWTSTWVRIVN  375

Query  235  GWVTAALFLWSLVAPILFPDRD  170
             W+   ++LW LVAPI++  R 
Sbjct  376  EWIAVCVYLWMLVAPIIWKSRQ  397



>ref|XP_008224089.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=428

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 84/171 (49%), Gaps = 20/171 (12%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V   +  + +++ Y  +LC+SA+ SEP + ECN   K        +  LG L  + S+V
Sbjct  257  TVNRGLLSSGIMASYIVFLCWSAIRSEPANEECNR-QKQGNVNGDWSTILGFLIAICSIV  315

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
             +    G  +                        + +E+++   + Y Y FFH+ FSL +
Sbjct  316  MATFSTGIDSESFQF-------------------QKDEVQEDDDIPYKYGFFHLTFSLGA  356

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            MY AML   W+ +       +DVGW S WV++V  W  A++FLW+L++P+L
Sbjct  357  MYFAMLFISWNLNNSAKKWSIDVGWTSTWVKIVNEWFAASIFLWTLISPVL  407



>ref|XP_009336915.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009336916.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 76/176 (43%), Gaps = 20/176 (11%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V   I    ++ LY  ++C+ A+ SEP    CN     S      T+   ++  +  V+
Sbjct  238  NVNAGILTPGLMGLYIVFICWFAIRSEPAGTSCNKKADDSTKTDWLTIISFVIAVLAMVI  297

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
             +                   G         K    +E E    V Y Y FFH +F+  +
Sbjct  298  ATF----------------STGIDSKCFQFRK----DETESEDDVPYGYGFFHFVFATGA  337

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            MY  MLL GW+T        +DVGWAS WVR+V  W+   ++LW LVAPI+   R 
Sbjct  338  MYFGMLLIGWNTHQSMRRFTIDVGWASTWVRIVNEWIAVCVYLWMLVAPIILESRQ  393



>ref|NP_850202.4| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEC08798.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=422

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 81/170 (48%), Gaps = 21/170 (12%)
 Frame = -2

Query  682  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  503
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++S +  T  L                 
Sbjct  260  LLSSGIMASYIVFLCWSAIRSEPSHTKCNAHTQNSHTDWTTIL-----------------  302

Query  502  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  323
            +          ++   G         K +  EE +    + YSY FFH++FSL +MY AM
Sbjct  303  SFLIAIGAIVMATFSTGIDSESFRFRKDEAKEEDD----IPYSYGFFHLVFSLGAMYFAM  358

Query  322  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            L   W+ S       +DVGW S WV++V  W  AA++LW L+API+   R
Sbjct  359  LFISWNLSHSTEKWSIDVGWTSTWVKIVNEWFAAAIYLWKLIAPIVRQHR  408



>gb|EJW79555.1| serine incorporator 2 [Wuchereria bancrofti]
Length=414

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 89/196 (45%), Gaps = 23/196 (12%)
 Frame = -2

Query  691  KGSIFPASVISLYCTYLCYSALASEPRDYECN-----ALHKHsksvstgtltlgllttvl  527
            +  +  +S I+LY  Y+ +SAL + P D ECN         H+           +    L
Sbjct  220  RSGLLQSSFITLYVMYITWSALINNP-DKECNPSLINVFTNHTTRYGQDVYGTPIPAESL  278

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM----------------EK  395
              +          +  +  S  +  GG     +D AD   +                 ++
Sbjct  279  VSLLIWFICILYASFRTSSSFNKIAGGSSQGTVDDADNGSQQYIITSEDNLESGRVWDDE  338

Query  394  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAAL  215
            S AV+YSYSFFH +F LAS+Y  M LT W     +   L +   A+VWV++V+ W+  A+
Sbjct  339  SDAVSYSYSFFHFVFGLASLYVMMTLTCWYKPDSDLRHL-NSNMAAVWVKIVSSWLCLAI  397

Query  214  FLWSLVAPILFPDRDF  167
            + W+L AP LFPDRDF
Sbjct  398  YAWTLAAPALFPDRDF  413



>ref|XP_010049913.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049914.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049915.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049916.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049917.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049918.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049919.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049921.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 gb|KCW82744.1| hypothetical protein EUGRSUZ_C04122 [Eucalyptus grandis]
Length=402

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 76/176 (43%), Gaps = 20/176 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V G      ++ LY  ++C+ A+ SEP    CN                          +
Sbjct  243  VNGGFLTPGLMGLYIVFICWCAIRSEPAGDRCNR----------------KAEASNHTDW  286

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
              + +     L    ++   G         K D   E +    V Y Y FFH++F+  +M
Sbjct  287  LTIISFVIALLAMVIATFSTGIDSQCFQFRKNDSKSEDD----VPYGYGFFHLVFATGAM  342

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            Y AMLL GW+T        +DVGW S WVRVV  W+   ++LW LVAP+L+  R+F
Sbjct  343  YFAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAVCVYLWMLVAPMLWKCREF  398



>gb|KDP32305.1| hypothetical protein JCGZ_13230 [Jatropha curcas]
Length=400

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 75/175 (43%), Gaps = 20/175 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V G I    ++ LY  +LC+ A+ SEP    CN                          +
Sbjct  241  VNGGILTPGLMGLYVVFLCWCAIRSEPAGESCN----------------RKAEASKRTDW  284

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
              + +     L    ++   G         K+++  E +    V Y Y FFH +F+  +M
Sbjct  285  LTIISFVVALLAIVIATFSTGIDSQCFQFRKSEKEAEDD----VPYGYGFFHFVFATGAM  340

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            Y AMLL GW+T        +DVGW S WVRVV  W+   ++LW LVAPI+   R 
Sbjct  341  YFAMLLIGWNTHHAMQKWTIDVGWTSAWVRVVNEWLAVCVYLWMLVAPIILKWRQ  395



>gb|EGT39434.1| hypothetical protein CAEBREN_08033 [Caenorhabditis brenneri]
Length=460

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = -2

Query  421  ADEHEEM-------EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW  263
            AD+ E          + + V YSYSFFH +F+LAS+Y  M LT W     +   L +   
Sbjct  370  ADDEESQSSRRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKPDNDLSHL-NSNM  428

Query  262  ASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASVWV++V+ WV  AL+ W+L+AP++FPDRDF
Sbjct  429  ASVWVKIVSSWVCVALYCWTLLAPVVFPDRDF  460



>ref|XP_004301051.1| PREDICTED: probable serine incorporator [Fragaria vesca subsp. 
vesca]
Length=419

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 81/170 (48%), Gaps = 20/170 (12%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V   +  + +++ Y  +LC+SA+ SEP + ECN   K        T  LG L  + ++V 
Sbjct  249  VNRGLLSSGIMASYIVFLCWSAIRSEPANEECNP-QKQENVNGDWTTILGFLIAICAIVM  307

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            +    G  +                         H E++    + Y Y FFH++FSL  M
Sbjct  308  ATFSTGVDSQSFQF-------------------RHSEVQHEDDIPYKYGFFHLVFSLGGM  348

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            Y AML   W+ +       +DVGWAS WV++V  W  A++++W+L +P+L
Sbjct  349  YFAMLFISWNLNNSAKKWSIDVGWASTWVKIVNEWFAASIYIWTLFSPVL  398



>gb|EXX52304.1| Tms1p [Rhizophagus irregularis DAOM 197198w]
Length=435

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 101/174 (58%), Gaps = 10/174 (6%)
 Frame = -2

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            AS++++YCTY+  SA+A+EP D  CN L +   + +T  +   +LT +     ++  A  
Sbjct  266  ASMVTIYCTYIILSAIANEPDDNMCNPLTRSRGTRTTTIVLGTILTFLAIAYSTSRAATQ  325

Query  493  sttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLT  314
            S  L++  +        P   LD  D+  + EK+  V Y+Y  FH IF++ASMY AMLLT
Sbjct  326  SKILIAKYNFLI----MPASALDDDDDGHDDEKN-GVAYNYGAFHFIFAVASMYVAMLLT  380

Query  313  GWST-SVGESGKLVDVGWA--SVWVRVVTGWVTAALFLWSLVAPILFPDR--DF  167
             W+  +   S +LV +G +  +VWV+VV+ W+   L+ W+L+ P+L P+R  DF
Sbjct  381  NWNNINTTGSEELVIIGQSIVAVWVKVVSSWICLLLYTWTLIGPVLMPERFEDF  434



>ref|XP_010542976.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
Length=420

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 19/170 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V   +  + +++LY  +LC+SA+ SEP D +CNA  ++  +  T  L+  +         
Sbjct  247  VNRGLLSSGIMALYVVFLCWSAIRSEPPDVKCNAHTQNGHTDWTTVLSFLI---------  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
                A  +    +  +   +   +     D+A E ++      + Y+Y FFH++FSL +M
Sbjct  298  ----AIGTIVYATFSTGIDSESFQFQFRKDEAKEEDD------IPYNYGFFHLVFSLGAM  347

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            Y AML   W+         +DVGW S WV++V  W  +A+++W L+API+
Sbjct  348  YFAMLFVSWNLEHSARKWSLDVGWTSTWVKIVNEWFASAIYIWKLIAPIV  397



>ref|XP_004665239.1| PREDICTED: serine incorporator 2 [Jaculus jaculus]
Length=452

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = -2

Query  400  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  221
             +   VTYSYSFFH    LAS++  M LT W  S GESGKL+   W SVWV++   W   
Sbjct  376  NEQDGVTYSYSFFHFCLVLASLHIMMTLTNW-YSPGESGKLIS-KWTSVWVKICASWAGL  433

Query  220  ALFLWSLVAPILFPDRDF  167
             L+LW+LVAP+L P+RDF
Sbjct  434  LLYLWTLVAPLLLPNRDF  451



>ref|XP_003136987.1| hypothetical protein LOAG_01400 [Loa loa]
 gb|EFO27079.1| hypothetical protein LOAG_01400 [Loa loa]
Length=456

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 90/197 (46%), Gaps = 24/197 (12%)
 Frame = -2

Query  691  KGSIFPASVISLYCTYLCYSALASEPRDYECN-----ALHKHsksvstgtltlgllttvl  527
            +  +  +S I+LY  Y+ +SAL + P D ECN         H+           L    +
Sbjct  261  RSGLLQSSFITLYVMYVTWSALINNP-DKECNPSLINIFTNHTTPYGQDIYGTPLPAESM  319

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM-----------------E  398
              +          +  +  S  +  GG P   +D AD   +                  +
Sbjct  320  ISLLIWFVCILYASFRTSSSFNKIAGGSPHGVVDDADNGSQQHIITPIEDNLERGRIWDD  379

Query  397  KSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAA  218
            +S AV+YSYSFFH +F LAS+Y  M LT W     +   L +   A+VWV++V+ W+  A
Sbjct  380  ESDAVSYSYSFFHFVFGLASLYVMMTLTCWYKPDSDLRHL-NSNMAAVWVKIVSSWLCLA  438

Query  217  LFLWSLVAPILFPDRDF  167
            ++ W+L AP +FPDRDF
Sbjct  439  IYAWTLAAPAIFPDRDF  455



>ref|XP_010469508.1| PREDICTED: probable serine incorporator isoform X3 [Camelina 
sativa]
Length=423

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 86/175 (49%), Gaps = 19/175 (11%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            S    +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +        
Sbjct  254  SKNKGLLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI--------  305

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
                 A  +  + +  +   +   +     D+A E E+      + YSY FFH++FSL +
Sbjct  306  -----AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVFSLGA  354

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            MY AML   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  355  MYFAMLFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  409



>ref|XP_010469504.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
 ref|XP_010469505.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
 ref|XP_010469506.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
Length=425

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 19/170 (11%)
 Frame = -2

Query  682  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  503
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +             
Sbjct  261  LLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI-------------  307

Query  502  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  323
            A  +  + +  +   +   +     D+A E E+      + YSY FFH++FSL +MY AM
Sbjct  308  AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVFSLGAMYFAM  361

Query  322  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            L   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  362  LFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  411



>emb|CDX93013.1| BnaA03g37350D [Brassica napus]
Length=411

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  427  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWV  248
            D   + E  EK   V Y Y FFH +F+  +MY AMLL GW+T        +DVGW S WV
Sbjct  320  DANSQGEVEEKEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWV  379

Query  247  RVVTGWVTAALFLWSLVAPILFPDR  173
            R+V  W+   +++W LVAPI+   R
Sbjct  380  RIVNEWLAVCVYIWMLVAPIILKSR  404



>emb|CDY66714.1| BnaCnng52050D [Brassica napus]
Length=419

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 87/174 (50%), Gaps = 19/174 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            VK S+  + +++ Y  +LC+SA+ SEP   +CNA   H+++  T  +T+      +  + 
Sbjct  251  VKSSLMSSGIMASYIVFLCWSAIRSEPSHTKCNA---HTQNGHTDWITVLSFLIAIGAIV  307

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
             A  +    +        +          D+A E ++      + YSY FFH++FSL +M
Sbjct  308  MATFSTGIDSESFSFQFRK----------DEAKEEDD------IPYSYGFFHLVFSLGAM  351

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            Y AML   W+         +DVGW S WV++V  W  A ++LW L+API+   R
Sbjct  352  YFAMLFISWNLEHSARKWSMDVGWTSTWVKIVNEWFAAGIYLWKLIAPIVRQPR  405



>ref|XP_010469507.1| PREDICTED: probable serine incorporator isoform X2 [Camelina 
sativa]
Length=423

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 19/170 (11%)
 Frame = -2

Query  682  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  503
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +             
Sbjct  259  LLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI-------------  305

Query  502  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  323
            A  +  + +  +   +   +     D+A E E+      + YSY FFH++FSL +MY AM
Sbjct  306  AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVFSLGAMYFAM  359

Query  322  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            L   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  360  LFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  409



>ref|XP_001901605.1| TDE2 protein [Brugia malayi]
 emb|CDP98608.1| Protein Bm6897, isoform d [Brugia malayi]
Length=455

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 89/196 (45%), Gaps = 23/196 (12%)
 Frame = -2

Query  691  KGSIFPASVISLYCTYLCYSALASEPRDYECN-----ALHKHsksvstgtltlgllttvl  527
            +  +  +S I+LY  Y+ +SAL + P D ECN         H+           +    L
Sbjct  261  RSGLLQSSFITLYVMYITWSALINNP-DKECNPSLINIFSNHTTRYGQDVYGTPIPAESL  319

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM----------------EK  395
              +          +  +  S  +  GG     +D AD   +                 ++
Sbjct  320  VSLLIWFICILYASFRTSSSFNKIAGGSSQGTVDDADNGSQQYIITSEDNLENGRVWDDE  379

Query  394  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAAL  215
            S AV+YSYSFFH +F LAS+Y  M LT W     +   L +   A+VWV++V+ W+  A+
Sbjct  380  SDAVSYSYSFFHFVFGLASLYVMMTLTCWYKPDSDLRHL-NSNMAAVWVKIVSSWLCLAI  438

Query  214  FLWSLVAPILFPDRDF  167
            + W+L AP LFPDRDF
Sbjct  439  YAWTLAAPALFPDRDF  454



>ref|XP_007226418.1| hypothetical protein PRUPE_ppa023345mg [Prunus persica]
 gb|EMJ27617.1| hypothetical protein PRUPE_ppa023345mg [Prunus persica]
Length=417

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 83/170 (49%), Gaps = 20/170 (12%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V   +  + +++ Y  +LC+SA+ SEP + ECN   K        +  LG L  + S+V 
Sbjct  247  VNRGLLSSGIMASYIVFLCWSAIRSEPANEECNR-QKQGNGNGDWSTILGFLIAICSIVM  305

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            +    G  +                        + +E+++   + Y Y FFH+ FSL +M
Sbjct  306  ATFSTGIDSQSFQF-------------------QKDEVKEDDDIPYKYGFFHLTFSLGAM  346

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            Y AML   W+ +       +DVGW S WV++V  W  A++FLW+L++P+L
Sbjct  347  YFAMLFISWNLNNSAKKWSIDVGWTSTWVKIVNEWFAASIFLWTLISPVL  396



>gb|EGT35951.1| hypothetical protein CAEBREN_13181 [Caenorhabditis brenneri]
Length=445

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 5/86 (6%)
 Frame = -2

Query  424  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  245
            KA ++EE    +AV YSYSFFH +F LAS+Y  M LT W     +   L +   ASVW++
Sbjct  365  KAFDNEE----EAVAYSYSFFHFMFGLASLYVMMTLTSWYHPDSDLAHL-NSNMASVWIK  419

Query  244  VVTGWVTAALFLWSLVAPILFPDRDF  167
            +++ W+ A L+ W+LVAPI+FPDR+F
Sbjct  420  ILSSWICAGLYSWTLVAPIVFPDREF  445



>ref|XP_010656350.1| PREDICTED: probable serine incorporator isoform X2 [Vitis vinifera]
Length=353

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 77/175 (44%), Gaps = 20/175 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V  S     ++ LY  +LC+ A+ SEP +  CN                  + +     +
Sbjct  194  VDESFLTPGLMGLYVVFLCWCAIRSEPPEDRCNQ----------------KVESATKADW  237

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
              + +     L    ++   G         K D   E +    V Y Y FFH +F+  +M
Sbjct  238  LTIISFIVALLAMVIATFSTGIDSKCFQFRKDDTQAEDD----VPYGYGFFHFVFATGAM  293

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            Y +MLL GW+T        +DVGW S WVR+V  W+ A ++LW LVAPI++  R 
Sbjct  294  YFSMLLIGWNTHHSIRKWTIDVGWTSTWVRIVNEWLAACVYLWMLVAPIIWKSRQ  348



>gb|ETN74193.1| TMS membrane protein/tumor differentially expressed protein [Necator 
americanus]
Length=459

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 8/104 (8%)
 Frame = -2

Query  457  AGGGKPLLPLDKADEHEEM-------EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTS  299
            +G   P++P++  +E            +++ V YSYSFFH +F LAS+Y  M LT W   
Sbjct  357  SGSRDPIVPVNDDEESGSSSSRRVWDNETEGVAYSYSFFHFMFGLASLYVMMTLTSWYNP  416

Query  298  VGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
              +   L +   ASVWV++V+ W+  AL+ W+LVAP LFPDR+F
Sbjct  417  DNDLTHL-NSNMASVWVKIVSSWLCLALYGWTLVAPALFPDREF  459



>ref|XP_008337449.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=398

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 78/176 (44%), Gaps = 20/176 (11%)
 Frame = -2

Query  697  SVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvv  518
            +V   I    ++ LY  ++C+ A+ SEP    CN   + S      T+            
Sbjct  238  NVNAGILTPGLMGLYIVFICWFAIRSEPAGTSCNKKAEDSTKTDWLTII-----------  286

Query  517  ysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLAS  338
                 +     L    ++   G         K +   E +    V Y Y FFH +F+  +
Sbjct  287  -----SFVIAVLAMVIATFSTGIDSKCFQFRKDEPVSEDD----VPYGYGFFHFVFATGA  337

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            MY AMLL GW+T        +DVGWAS WVR+V  W+   ++LW LVAPI++ +R 
Sbjct  338  MYFAMLLIGWNTHQSMKKFTLDVGWASTWVRIVNEWIAVCVYLWILVAPIIWKNRQ  393



>ref|XP_006645562.1| PREDICTED: probable serine incorporator-like [Oryza brachyantha]
Length=430

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 86/186 (46%), Gaps = 18/186 (10%)
 Frame = -2

Query  706  FILSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
             I  VK       ++ +Y  +LC++A+ SEP    CN   + + S     +   ++  ++
Sbjct  262  LISKVKAGYLAPGLMGVYIVFLCWTAIRSEPHTEICNKKAEVATSADWVNIASFVIAVIV  321

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V  +                   G     L   KA+   E  +   V Y + FFH +F+
Sbjct  322  IVTATFA----------------TGIDSKCLQFKKAES--EQPEDDDVPYGFGFFHFVFA  363

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            + +MY AML  GW+ +       +DVGWAS WVRVV  W+ A +++W ++API++  R  
Sbjct  364  MGAMYFAMLFVGWNANQTMEKWTIDVGWASTWVRVVNEWLAAIVYIWMVIAPIVWKGRQV  423

Query  166  *AS*GC  149
             +S  C
Sbjct  424  GSSPEC  429



>gb|ESA09597.1| hypothetical protein GLOINDRAFT_80906 [Rhizophagus irregularis 
DAOM 181602]
Length=415

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = -2

Query  397  KSKAVTYSYSFFHIIFSLASMYSAMLLTGWS--TSVGESGKLVDVG--WASVWVRVVTGW  230
            +   V Y+Y+FFH+IF++ASMY AMLLT W+  T++    KLV +G  + +VWV+V++ W
Sbjct  332  EKNGVAYNYAFFHLIFAIASMYVAMLLTNWNNVTTINSDEKLVVIGQTYIAVWVKVISSW  391

Query  229  VTAALFLWSLVAPILFPDR  173
            +   L+ W+L+ P+L PDR
Sbjct  392  ICILLYSWTLIGPVLLPDR  410



>ref|XP_003620496.1| Serine incorporator [Medicago truncatula]
 gb|AES76714.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=402

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 79/175 (45%), Gaps = 19/175 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V G I    ++ LY  +LC+ A+ SEP   +C                +    TV    +
Sbjct  243  VNGGILSPGLMGLYVVFLCWCAIRSEPEGDQC----------------IRTSGTVTKTDW  286

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
              + +     L    ++   G       L K D+  E +    V Y Y FFH +F+  +M
Sbjct  287  QNIISFVIGILAIVIATFSTGIDSKCFQLRKGDKPAEEDD---VPYGYGFFHFVFATGAM  343

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            Y AMLL GW+T        +DVGW S WVR+V  W+   ++LW L+API++  R 
Sbjct  344  YFAMLLIGWNTHHSMRKWSLDVGWTSAWVRIVNEWLAVCVYLWMLIAPIIWKARQ  398



>ref|XP_002994401.1| hypothetical protein SELMODRAFT_449363 [Selaginella moellendorffii]
 gb|EFJ04535.1| hypothetical protein SELMODRAFT_449363 [Selaginella moellendorffii]
Length=386

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 81/176 (46%), Gaps = 20/176 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V   +  + ++S+Y  +LC+SA+ SEP    CN   + +      TL   ++     V+ 
Sbjct  230  VNAGLMTSGLMSVYLCFLCWSAIMSEPLSEACNTRPRQTGKSDWLTLLSFVIALAAIVMA  289

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            +                   G       L K    +  E    V Y Y FFH++F+L SM
Sbjct  290  AY----------------STGTDSQTFCLPK----KSFELDDEVPYGYGFFHLVFALGSM  329

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            Y AML  GW+         +DVGWASVWV++   W  AA+++W+++   +  +R+F
Sbjct  330  YFAMLFIGWNLHQTMHKYSIDVGWASVWVKIANEWAAAAIYIWTMIGRFVLRNREF  385



>ref|XP_002968524.1| hypothetical protein SELMODRAFT_89240 [Selaginella moellendorffii]
 ref|XP_002975960.1| hypothetical protein SELMODRAFT_104684 [Selaginella moellendorffii]
 gb|EFJ22865.1| hypothetical protein SELMODRAFT_104684 [Selaginella moellendorffii]
 gb|EFJ30778.1| hypothetical protein SELMODRAFT_89240 [Selaginella moellendorffii]
Length=394

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 81/176 (46%), Gaps = 20/176 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V   +  + ++S+Y  +LC+SA+ SEP    CN   + +      TL   ++     V+ 
Sbjct  238  VNAGLMTSGLMSVYLCFLCWSAIMSEPLSEACNTRPRQTGKSDWLTLLSFVIALAAIVMA  297

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
            +                   G       L K    +  E    V Y Y FFH++F+L SM
Sbjct  298  AY----------------STGTDSQTFCLPK----KSFELDDEVPYGYGFFHLVFALGSM  337

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            Y AML  GW+         +DVGWASVWV++   W  AA+++W+++   +  +R+F
Sbjct  338  YFAMLFIGWNLHQTMHKYSIDVGWASVWVKIANEWAAAAIYIWTMIGRFVLRNREF  393



>ref|XP_009408948.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408949.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=406

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 76/174 (44%), Gaps = 20/174 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            VK       ++ +Y  YLC+SA+ SEP+   CN                     V S  +
Sbjct  247  VKVGFLAPGLMGMYVVYLCWSAIRSEPQTEICNK----------------KTEVVTSADW  290

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
              + +     L    ++   G         K     E E    V Y Y FFH +F++ +M
Sbjct  291  LTIVSFVIAVLAIVIATFSTGIDSKCFQFKKT----EAESEDDVPYGYGFFHFVFAMGAM  346

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            Y AML  GW+         +DVGWAS WVR+V  WV   +++W LVAP+++  R
Sbjct  347  YFAMLFVGWNAQNTMQKWTIDVGWASTWVRIVNEWVATLVYIWMLVAPLVWKSR  400



>ref|XP_009141295.1| PREDICTED: probable serine incorporator isoform X1 [Brassica 
rapa]
Length=444

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 85/174 (49%), Gaps = 19/174 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            VK S+  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +         
Sbjct  276  VKSSLMSSGIMASYIVFLCWSAIRSEPSHTKCNAHTQNGHTDWITVLSFLI---------  326

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
                A  +  + +  +   +         D+A E ++      + YSY FFH++FSL +M
Sbjct  327  ----AIGAIVMATFSTGIDSESFSFQFRKDEAKEEDD------IPYSYGFFHLVFSLGAM  376

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            Y AML   W+         +DVGW S WV++V  W  A ++LW L+API+   R
Sbjct  377  YFAMLFISWNLEHSARKWSMDVGWTSTWVKIVNEWFAAGIYLWKLIAPIVRQPR  430



>ref|XP_010656344.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656345.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656346.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656347.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656348.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656349.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 emb|CBI28099.3| unnamed protein product [Vitis vinifera]
Length=397

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 77/175 (44%), Gaps = 20/175 (11%)
 Frame = -2

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V  S     ++ LY  +LC+ A+ SEP +  CN                  + +     +
Sbjct  238  VDESFLTPGLMGLYVVFLCWCAIRSEPPEDRCNQ----------------KVESATKADW  281

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASM  335
              + +     L    ++   G         K D   E +    V Y Y FFH +F+  +M
Sbjct  282  LTIISFIVALLAMVIATFSTGIDSKCFQFRKDDTQAEDD----VPYGYGFFHFVFATGAM  337

Query  334  YSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            Y +MLL GW+T        +DVGW S WVR+V  W+ A ++LW LVAPI++  R 
Sbjct  338  YFSMLLIGWNTHHSIRKWTIDVGWTSTWVRIVNEWLAACVYLWMLVAPIIWKSRQ  392



>ref|XP_006295917.1| hypothetical protein CARUB_v10025054mg [Capsella rubella]
 gb|EOA28815.1| hypothetical protein CARUB_v10025054mg [Capsella rubella]
Length=423

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 84/170 (49%), Gaps = 21/170 (12%)
 Frame = -2

Query  682  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  503
            +  + +++ Y  +LC+SA+ SEP   +CNA  ++S +     L+  +    + +   +  
Sbjct  261  LLSSGIMASYIVFLCWSAVRSEPSHTKCNAHTQNSHTDWITILSFLIAIGAIVMATFSTG  320

Query  502  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  323
              S +                     + DE +E E    + YSY FFH++FSL +MY AM
Sbjct  321  IDSESFKF------------------RRDEGKEEED---IPYSYGFFHLVFSLGAMYFAM  359

Query  322  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            L   W+ S       +DVGW S WV++V  W  AA++LW L+API+   R
Sbjct  360  LFISWNLSDSARKWSIDVGWTSTWVKIVNEWFAAAIYLWKLIAPIVRQPR  409



>ref|XP_011174068.1| PREDICTED: probable serine incorporator, partial [Solenopsis 
invicta]
Length=113

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -2

Query  400  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  221
             + + V Y++SFFH++F+LA++Y  M LT W      + + ++   AS+WV++++ W+  
Sbjct  35   NEEEKVAYNWSFFHLMFALATLYVMMTLTNWYKPNVSNLETLNANTASMWVKIISSWMCL  94

Query  220  ALFLWSLVAPILFPDRDF  167
             L++WSLVAP +FP+RDF
Sbjct  95   GLYVWSLVAPAIFPNRDF  112



>emb|CEP13524.1| hypothetical protein [Parasitella parasitica]
Length=487

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 8/77 (10%)
 Frame = -2

Query  379  YSYSFFHIIFSLASMYSAMLLTGWST-----SVG-ESGKLVDVG--WASVWVRVVTGWVT  224
            YSYSFFH +F++A+MY +M+LT W+T      VG + G LV +G  + +VWV++V+GW+ 
Sbjct  407  YSYSFFHFVFAIAAMYVSMVLTNWNTIQFKDGVGNDGGDLVRIGQSYTAVWVKIVSGWIC  466

Query  223  AALFLWSLVAPILFPDR  173
              +++WSLVAP+L PDR
Sbjct  467  HIIYIWSLVAPVLMPDR  483



>gb|EGT34050.1| hypothetical protein CAEBREN_24071 [Caenorhabditis brenneri]
Length=445

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 5/86 (6%)
 Frame = -2

Query  424  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  245
            KA ++EE    +AV YSYSFFH +F LAS+Y  M LT W     +   L +   ASVW++
Sbjct  365  KAFDNEE----EAVAYSYSFFHFMFGLASLYVMMTLTSWYHPDSDLAHL-NSNMASVWIK  419

Query  244  VVTGWVTAALFLWSLVAPILFPDRDF  167
            +++ W+ A L+ W+LVAP++FPDR+F
Sbjct  420  ILSSWICAGLYSWTLVAPVVFPDREF  445



>ref|XP_002602420.1| hypothetical protein BRAFLDRAFT_117027 [Branchiostoma floridae]
 gb|EEN58432.1| hypothetical protein BRAFLDRAFT_117027 [Branchiostoma floridae]
Length=483

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 1/88 (1%)
 Frame = -2

Query  427  DKADEHEEMEKSK-AVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  251
            D  D+   ++  K  V Y+YSFFH +F LASMY  M LT W +  G +   +     +VW
Sbjct  395  DLDDDAPTIDNEKDGVKYNYSFFHFMFMLASMYIMMTLTNWYSPDGSNFNNLQPNQPAVW  454

Query  250  VRVVTGWVTAALFLWSLVAPILFPDRDF  167
            V++V+ W+   L++W+LVAPI+ PDRDF
Sbjct  455  VKIVSSWLCILLYVWTLVAPIVLPDRDF  482



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425