BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF019L07

Length=701
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06201.1|  unnamed protein product                                218   3e-66   Coffea canephora [robusta coffee]
gb|KHN19831.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG         213   8e-66   Glycine soja [wild soybean]
ref|XP_002517315.1|  2,4-dienoyl-CoA reductase, putative                216   2e-65   Ricinus communis
ref|XP_010055797.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       214   7e-65   Eucalyptus grandis [rose gum]
ref|XP_003518977.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    214   1e-64   Glycine max [soybeans]
ref|XP_006482063.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    211   8e-64   Citrus sinensis [apfelsine]
ref|XP_004294537.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    211   9e-64   Fragaria vesca subsp. vesca
gb|ABK93994.1|  unknown                                                 211   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_002323240.1|  short-chain dehydrogenase/reductase family p...    211   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_009588398.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       211   2e-63   Nicotiana tomentosiformis
gb|KDO53625.1|  hypothetical protein CISIN_1g023885mg                   209   4e-63   Citrus sinensis [apfelsine]
gb|KDP23890.1|  hypothetical protein JCGZ_26632                         209   6e-63   Jatropha curcas
ref|XP_006430534.1|  hypothetical protein CICLE_v10012432mg             209   6e-63   Citrus clementina [clementine]
ref|XP_011000407.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    208   2e-62   Populus euphratica
ref|XP_007028287.1|  2,4-dienoyl-CoA reductase isoform 2                206   8e-62   
emb|CAN64848.1|  hypothetical protein VITISV_036158                     206   1e-61   Vitis vinifera
pir||S39508  alcohol dehydrogenase homolog, ripening-related - to...    204   2e-61
ref|XP_007145484.1|  hypothetical protein PHAVU_007G242900g             206   2e-61   Phaseolus vulgaris [French bean]
gb|KDO53626.1|  hypothetical protein CISIN_1g031340mg                   201   2e-61   Citrus sinensis [apfelsine]
ref|XP_007202394.1|  hypothetical protein PRUPE_ppa009414mg             206   2e-61   Prunus persica
ref|XP_010653621.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    205   3e-61   Vitis vinifera
ref|XP_009383217.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    205   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004249319.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       204   7e-61   Solanum lycopersicum
ref|XP_010913911.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    204   8e-61   Elaeis guineensis
ref|XP_006430531.1|  hypothetical protein CICLE_v10012408mg             204   1e-60   Citrus clementina [clementine]
ref|XP_009371362.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    204   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_010943529.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    204   2e-60   Elaeis guineensis
ref|XP_010112844.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG    203   2e-60   Morus notabilis
gb|ACS12983.1|  2,4-dienoyl-CoA reductase                               204   2e-60   Jatropha curcas
ref|XP_010673042.1|  PREDICTED: L-xylulose reductase-like               203   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011079077.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       202   3e-60   Sesamum indicum [beniseed]
ref|XP_006482062.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    202   3e-60   Citrus sinensis [apfelsine]
gb|KDO53624.1|  hypothetical protein CISIN_1g023555mg                   202   3e-60   Citrus sinensis [apfelsine]
ref|XP_006430535.1|  hypothetical protein CICLE_v10012421mg             202   3e-60   Citrus clementina [clementine]
gb|EYU18609.1|  hypothetical protein MIMGU_mgv1a011131mg                202   6e-60   Erythranthe guttata [common monkey flower]
gb|KHN24253.1|  3-oxoacyl-[acyl-carrier-protein] reductase 1            199   6e-60   Glycine soja [wild soybean]
ref|XP_004515513.1|  PREDICTED: glucose 1-dehydrogenase-like            202   6e-60   Cicer arietinum [garbanzo]
gb|AFK48641.1|  unknown                                                 201   7e-60   Medicago truncatula
ref|XP_006482064.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    202   7e-60   
gb|KJB54601.1|  hypothetical protein B456_009G041000                    201   8e-60   Gossypium raimondii
ref|XP_008808086.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    200   3e-59   Phoenix dactylifera
ref|XP_006339259.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    200   4e-59   Solanum tuberosum [potatoes]
gb|KHG26617.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG         199   4e-59   Gossypium arboreum [tree cotton]
ref|XP_008805478.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    199   4e-59   Phoenix dactylifera
gb|AAN32641.1|AF416732_1  putative short-chain type alcohol dehyd...    200   4e-59   Solanum tuberosum [potatoes]
ref|XP_003518969.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    199   4e-59   Glycine max [soybeans]
gb|KEH30026.1|  enoyl-(acyl carrier) reductase                          197   6e-59   Medicago truncatula
ref|XP_009417296.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    199   7e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001274762.1|  putative short-chain type alcohol dehydrogenase    199   9e-59   Solanum tuberosum [potatoes]
gb|KEH30024.1|  enoyl-(acyl carrier) reductase                          198   1e-58   Medicago truncatula
ref|XP_004249318.1|  PREDICTED: D-erythrulose reductase-like            199   1e-58   Solanum lycopersicum
gb|EYU20812.1|  hypothetical protein MIMGU_mgv1a011359mg                198   1e-58   Erythranthe guttata [common monkey flower]
ref|XP_011075453.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    198   2e-58   Sesamum indicum [beniseed]
ref|XP_008386836.1|  PREDICTED: probable L-xylulose reductase           197   4e-58   
ref|XP_007145483.1|  hypothetical protein PHAVU_007G242800g             196   9e-58   Phaseolus vulgaris [French bean]
ref|XP_008455729.1|  PREDICTED: uncharacterized oxidoreductase C9...    196   1e-57   Cucumis melo [Oriental melon]
ref|XP_010257447.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    195   3e-57   Nelumbo nucifera [Indian lotus]
ref|XP_008340560.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    194   5e-57   
ref|XP_009394521.1|  PREDICTED: hydroxysteroid dehydrogenase-like...    201   6e-57   
ref|XP_004144326.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    194   7e-57   Cucumis sativus [cucumbers]
ref|XP_008787372.1|  PREDICTED: LOW QUALITY PROTEIN: estradiol 17...    190   2e-56   Phoenix dactylifera
ref|XP_009769812.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       187   3e-56   Nicotiana sylvestris
ref|XP_011075452.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    193   3e-56   Sesamum indicum [beniseed]
ref|XP_002282735.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    192   4e-56   Vitis vinifera
ref|XP_004170137.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...    192   4e-56   
gb|EPS63859.1|  hypothetical protein M569_10924                         191   7e-56   Genlisea aurea
ref|XP_010530038.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    191   7e-56   Tarenaya hassleriana [spider flower]
ref|XP_010530193.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    191   7e-56   Tarenaya hassleriana [spider flower]
ref|XP_010530115.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    191   7e-56   Tarenaya hassleriana [spider flower]
ref|XP_010529958.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    191   8e-56   Tarenaya hassleriana [spider flower]
ref|XP_008339342.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    191   8e-56   
ref|XP_010529885.1|  PREDICTED: carbonyl reductase [NADPH] 2-like...    191   9e-56   
ref|XP_010473483.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    190   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_004170138.1|  PREDICTED: uncharacterized oxidoreductase Rv...    187   2e-55   
ref|XP_009631508.1|  PREDICTED: probable L-xylulose reductase           189   2e-55   Nicotiana tomentosiformis
ref|XP_008443382.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    189   3e-55   Cucumis melo [Oriental melon]
ref|XP_009390649.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    189   5e-55   
ref|XP_004172090.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    188   8e-55   
ref|XP_008340561.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    188   1e-54   
ref|XP_010516096.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    187   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010516097.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    187   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004136692.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    187   3e-54   Cucumis sativus [cucumbers]
ref|XP_006301634.1|  hypothetical protein CARUB_v10022077mg             186   4e-54   
ref|XP_010427295.1|  PREDICTED: probable L-xylulose reductase iso...    186   5e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010427297.1|  PREDICTED: probable L-xylulose reductase iso...    186   5e-54   
ref|XP_010431696.1|  PREDICTED: estradiol 17-beta-dehydrogenase 8...    184   6e-54   Camelina sativa [gold-of-pleasure]
gb|KGN54692.1|  hypothetical protein Csa_4G427280                       186   6e-54   Cucumis sativus [cucumbers]
ref|XP_004144361.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    186   6e-54   
emb|CDP20582.1|  unnamed protein product                                186   7e-54   Coffea canephora [robusta coffee]
ref|XP_006365803.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    186   7e-54   Solanum tuberosum [potatoes]
ref|XP_006291426.1|  hypothetical protein CARUB_v10017563mg             187   1e-53   
ref|XP_006291425.1|  hypothetical protein CARUB_v10017563mg             187   1e-53   
ref|XP_010418256.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    185   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009596119.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    186   2e-53   Nicotiana tomentosiformis
ref|NP_567019.1|  Rossmann-fold NAD(P)-binding domain-containing ...    184   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974441.1|  Rossmann-fold NAD(P)-binding domain-containing ...    184   2e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAB75763.1|  oxidoreductase-like protein                            184   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KFK40341.1|  hypothetical protein AALP_AA3G361500                    184   5e-53   Arabis alpina [alpine rockcress]
ref|XP_004157996.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    184   5e-53   
ref|XP_002876294.1|  short-chain dehydrogenase/reductase family p...    184   5e-53   
emb|CDY48725.1|  BnaA09g10000D                                          184   6e-53   Brassica napus [oilseed rape]
ref|XP_004144362.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    184   7e-53   
ref|XP_009607267.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    183   7e-53   Nicotiana tomentosiformis
ref|XP_010504384.1|  PREDICTED: probable L-xylulose reductase iso...    183   7e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010504386.1|  PREDICTED: probable L-xylulose reductase iso...    183   7e-53   Camelina sativa [gold-of-pleasure]
emb|CDP06198.1|  unnamed protein product                                183   8e-53   Coffea canephora [robusta coffee]
ref|XP_009112627.1|  PREDICTED: probable L-xylulose reductase           183   1e-52   Brassica rapa
ref|XP_009391879.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    182   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002884088.1|  short-chain dehydrogenase/reductase family p...    182   2e-52   
emb|CDY03343.1|  BnaC09g10050D                                          182   2e-52   
ref|XP_006403473.1|  hypothetical protein EUTSA_v10010610mg             182   2e-52   Eutrema salsugineum [saltwater cress]
gb|KFK34763.1|  hypothetical protein AALP_AA5G190600                    182   2e-52   Arabis alpina [alpine rockcress]
gb|KFK34764.1|  hypothetical protein AALP_AA5G190600                    182   2e-52   Arabis alpina [alpine rockcress]
emb|CDP06199.1|  unnamed protein product                                182   3e-52   Coffea canephora [robusta coffee]
ref|XP_009778773.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    182   3e-52   Nicotiana sylvestris
ref|XP_006361353.1|  PREDICTED: probable L-xylulose reductase-like      181   5e-52   
ref|XP_011079072.1|  PREDICTED: estradiol 17-beta-dehydrogenase 8...    181   7e-52   Sesamum indicum [beniseed]
ref|XP_004249129.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    180   1e-51   Solanum lycopersicum
ref|XP_009773767.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    180   1e-51   Nicotiana sylvestris
gb|KEH41456.1|  NAD(P)-binding rossmann-fold protein                    179   2e-51   Medicago truncatula
ref|XP_010112832.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG    185   2e-51   
ref|XP_009593495.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    179   2e-51   Nicotiana tomentosiformis
ref|XP_010265875.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    179   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_009371244.1|  PREDICTED: LOW QUALITY PROTEIN: estradiol 17...    180   3e-51   
ref|NP_176449.2|  putative ketoacyl-ACP reductase                       179   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031220.1|  putative ketoacyl-ACP reductase                    179   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009763303.1|  PREDICTED: probable L-xylulose reductase iso...    178   4e-51   Nicotiana sylvestris
ref|NP_974072.1|  putative ketoacyl-ACP reductase                       179   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185294.1|  putative ketoacyl-ACP reductase                    179   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565425.1|  Rossmann-fold NAD(P)-binding domain-containing ...    179   4e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDP21456.1|  unnamed protein product                                179   5e-51   Coffea canephora [robusta coffee]
ref|XP_009763295.1|  PREDICTED: probable L-xylulose reductase iso...    178   6e-51   Nicotiana sylvestris
ref|NP_190203.1|  NAD(P)-binding Rossmann-fold superfamily protein      178   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176527.4|  Rossmann-fold NAD(P)-binding domain-containing ...    177   1e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAF19703.1|AC008047_10  F2K11.24                                     177   1e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAD43618.1|AC005698_17  T3P18.17                                     178   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009631506.1|  PREDICTED: probable L-xylulose reductase iso...    177   1e-50   Nicotiana tomentosiformis
ref|XP_009631507.1|  PREDICTED: probable L-xylulose reductase iso...    177   1e-50   Nicotiana tomentosiformis
ref|NP_191091.2|  Rossmann-fold NAD(P)-binding domain-containing ...    177   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006361361.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    177   3e-50   
emb|CAB75765.1|  beta-ketoacyl-ACP reductase-like protein               177   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403474.1|  hypothetical protein EUTSA_v10010605mg             176   4e-50   Eutrema salsugineum [saltwater cress]
ref|XP_002886464.1|  predicted protein                                  176   4e-50   
ref|XP_004252844.1|  PREDICTED: probable L-xylulose reductase           175   7e-50   Solanum lycopersicum
ref|XP_009139179.1|  PREDICTED: probable L-xylulose reductase iso...    175   7e-50   Brassica rapa
ref|XP_009139180.1|  PREDICTED: probable L-xylulose reductase iso...    175   8e-50   Brassica rapa
emb|CDX76107.1|  BnaA04g03710D                                          175   8e-50   
ref|XP_009139176.1|  PREDICTED: probable L-xylulose reductase iso...    175   8e-50   Brassica rapa
ref|XP_009139177.1|  PREDICTED: probable L-xylulose reductase iso...    175   9e-50   Brassica rapa
emb|CDY65313.1|  BnaCnng46610D                                          175   9e-50   Brassica napus [oilseed rape]
ref|NP_001152499.1|  LOC100286139                                       174   2e-49   Zea mays [maize]
ref|XP_009139357.1|  PREDICTED: probable L-xylulose reductase           174   2e-49   
tpg|DAA47976.1|  TPA: 3-oxoacyl-reductase                               174   2e-49   
ref|XP_009594209.1|  PREDICTED: probable L-xylulose reductase           173   3e-49   Nicotiana tomentosiformis
ref|XP_006362944.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    173   6e-49   Solanum tuberosum [potatoes]
ref|XP_006365797.1|  PREDICTED: probable L-xylulose reductase-like      172   7e-49   Solanum tuberosum [potatoes]
ref|XP_006850022.1|  hypothetical protein AMTR_s00022p00187970          173   7e-49   Amborella trichopoda
ref|XP_008455802.1|  PREDICTED: probable L-xylulose reductase           173   8e-49   
ref|XP_004172089.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    174   8e-49   
gb|KGN54695.1|  hypothetical protein Csa_4G429290                       168   8e-49   Cucumis sativus [cucumbers]
ref|XP_011079074.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    173   1e-48   Sesamum indicum [beniseed]
ref|XP_004248275.1|  PREDICTED: carbonyl reductase [NADPH] 2-like       172   1e-48   Solanum lycopersicum
gb|EAZ43296.1|  hypothetical protein OsJ_27892                          172   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004973876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    172   2e-48   Setaria italica
ref|XP_010314314.1|  PREDICTED: probable L-xylulose reductase           172   2e-48   Solanum lycopersicum
ref|NP_001062206.1|  Os08g0510400                                       171   3e-48   
ref|XP_006660269.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    170   4e-48   Oryza brachyantha
ref|XP_004136691.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    172   4e-48   
emb|CDY29203.1|  BnaA06g25540D                                          170   9e-48   Brassica napus [oilseed rape]
emb|CDY07814.1|  BnaC03g48080D                                          169   1e-47   Brassica napus [oilseed rape]
ref|XP_009124575.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    170   1e-47   
ref|XP_003574753.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    169   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_009781380.1|  PREDICTED: L-xylulose reductase-like               169   2e-47   Nicotiana sylvestris
ref|XP_002444769.1|  hypothetical protein SORBIDRAFT_07g027700          169   2e-47   Sorghum bicolor [broomcorn]
gb|EMS63120.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG         166   2e-47   Triticum urartu
gb|EMS50889.1|  Gluconate 5-dehydrogenase                               167   3e-47   Triticum urartu
ref|XP_006362943.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    169   3e-47   Solanum tuberosum [potatoes]
emb|CDY07809.1|  BnaC03g48130D                                          164   3e-47   Brassica napus [oilseed rape]
ref|XP_011079076.1|  PREDICTED: L-rhamnose-1-dehydrogenase-like         169   3e-47   Sesamum indicum [beniseed]
emb|CDX73333.1|  BnaC05g27730D                                          168   4e-47   
ref|XP_009599584.1|  PREDICTED: probable L-xylulose reductase           168   4e-47   Nicotiana tomentosiformis
emb|CDY44938.1|  BnaA02g04430D                                          168   5e-47   Brassica napus [oilseed rape]
gb|EYU20810.1|  hypothetical protein MIMGU_mgv1a011271mg                167   9e-47   Erythranthe guttata [common monkey flower]
gb|EMT14873.1|  3-oxoacyl-(acyl-carrier-protein) reductase              167   1e-46   
emb|CDY29207.1|  BnaA06g25500D                                          162   2e-46   Brassica napus [oilseed rape]
ref|XP_009116226.1|  PREDICTED: probable L-xylulose reductase iso...    167   2e-46   Brassica rapa
ref|XP_009116225.1|  PREDICTED: probable L-xylulose reductase iso...    167   2e-46   Brassica rapa
dbj|BAK03236.1|  predicted protein                                      167   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004252379.1|  PREDICTED: probable L-xylulose reductase           166   3e-46   Solanum lycopersicum
ref|XP_009139356.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    165   3e-46   
gb|ABE65821.1|  short-chain dehydrogenase/reductase family protein      161   3e-46   Arabidopsis thaliana [mouse-ear cress]
gb|EMS67034.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG         165   4e-46   Triticum urartu
emb|CAN59905.1|  hypothetical protein VITISV_033145                     165   1e-45   Vitis vinifera
ref|XP_006366156.1|  PREDICTED: probable L-xylulose reductase-like      164   3e-45   
emb|CDY40209.1|  BnaA09g34910D                                          164   4e-45   Brassica napus [oilseed rape]
dbj|BAE99083.1|  putative reductase                                     157   1e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73391.1|  BnaC08g26120D                                          166   1e-44   
ref|XP_009150760.1|  PREDICTED: probable L-xylulose reductase iso...    161   2e-44   Brassica rapa
ref|XP_009150759.1|  PREDICTED: probable L-xylulose reductase iso...    161   2e-44   Brassica rapa
dbj|BAK02348.1|  predicted protein                                      159   1e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADE77298.1|  unknown                                                 159   2e-43   Picea sitchensis
ref|XP_009121071.1|  PREDICTED: probable L-xylulose reductase iso...    159   2e-43   Brassica rapa
ref|XP_009121072.1|  PREDICTED: probable L-xylulose reductase iso...    159   2e-43   Brassica rapa
ref|XP_008680945.1|  PREDICTED: LOC100286139 isoform X4                 159   2e-43   Zea mays [maize]
ref|XP_008680943.1|  PREDICTED: LOC100286139 isoform X3                 159   3e-43   Zea mays [maize]
ref|XP_008680941.1|  PREDICTED: LOC100286139 isoform X2                 159   4e-43   Zea mays [maize]
tpg|DAA47977.1|  TPA: hypothetical protein ZEAMMB73_585385              158   6e-43   
ref|XP_006367949.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    155   2e-42   
ref|XP_008680935.1|  PREDICTED: LOC100286139 isoform X1                 158   2e-42   Zea mays [maize]
ref|XP_007028286.1|  2,4-dienoyl-CoA reductase, putative isoform 1      158   2e-42   
ref|XP_008240678.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    154   9e-42   Prunus mume [ume]
ref|XP_006367340.1|  PREDICTED: probable L-xylulose reductase-like      153   3e-41   Solanum tuberosum [potatoes]
ref|XP_001760079.1|  predicted protein                                  152   4e-41   
ref|XP_011075456.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    150   3e-40   
ref|XP_011079073.1|  PREDICTED: estradiol 17-beta-dehydrogenase 8...    150   3e-40   Sesamum indicum [beniseed]
ref|XP_011075454.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    150   3e-40   
ref|XP_010265876.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    142   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_006362945.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    145   3e-38   
emb|CBI32789.3|  unnamed protein product                                140   1e-36   Vitis vinifera
ref|XP_003632638.2|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    139   1e-35   
emb|CBI32790.3|  unnamed protein product                                133   4e-35   Vitis vinifera
ref|XP_002963314.1|  hypothetical protein SELMODRAFT_80357              135   1e-34   
ref|XP_006408894.1|  hypothetical protein EUTSA_v10002227mg             135   2e-34   
ref|XP_002963719.1|  hypothetical protein SELMODRAFT_80710              132   9e-34   
ref|XP_002974604.1|  hypothetical protein SELMODRAFT_101607             132   2e-33   
ref|XP_009786105.1|  PREDICTED: D-erythrulose reductase-like            132   2e-33   Nicotiana sylvestris
ref|XP_006374241.1|  hypothetical protein POPTR_0015s05345g             126   6e-33   
ref|XP_004252861.2|  PREDICTED: omega-6 fatty acid desaturase, en...    132   4e-32   
ref|XP_010314672.1|  PREDICTED: omega-6 fatty acid desaturase, en...    132   5e-32   
gb|ABK21106.1|  unknown                                                 127   4e-31   Picea sitchensis
gb|EYU20809.1|  hypothetical protein MIMGU_mgv11b016674mg               124   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_002308881.1|  hypothetical protein POPTR_0006s03530g             117   2e-29   
ref|XP_009394522.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    120   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI32788.3|  unnamed protein product                                119   4e-28   Vitis vinifera
ref|XP_006299633.1|  hypothetical protein CARUB_v10015813mg             113   4e-27   
ref|XP_006850023.1|  hypothetical protein AMTR_s00022p00188500          106   2e-25   
emb|CDP06200.1|  unnamed protein product                              95.1    4e-21   Coffea canephora [robusta coffee]
dbj|BAF47118.1|  receptor like protein                                83.6    2e-16   Nicotiana tabacum [American tobacco]
ref|NP_001185300.1|  Rossmann-fold NAD(P)-binding domain-containi...  81.3    3e-15   
gb|KCZ60467.1|  hypothetical protein HY36_05665                       79.7    2e-14   Hyphomonas atlantica
ref|WP_035552356.1|  2-deoxy-D-gluconate 3-dehydrogenase              79.3    2e-14   Hyphomonas atlantica
ref|WP_028496717.1|  MULTISPECIES: oxidoreductase                     78.6    5e-14   
gb|KCZ63815.1|  hypothetical protein L53_04790                        78.2    5e-14   Hyphomonas sp. L-53-1-40
ref|WP_027836295.1|  2-deoxy-D-gluconate 3-dehydrogenase              78.2    6e-14   
ref|WP_034813394.1|  2-deoxy-D-gluconate 3-dehydrogenase              78.2    6e-14   Hyphomonas sp. L-53-1-40
ref|WP_017987774.1|  short-chain dehydrogenase                        77.8    6e-14   Amycolatopsis methanolica
ref|WP_027931640.1|  short-chain dehydrogenase                        77.8    7e-14   Amycolatopsis thermoflava
ref|WP_024713243.1|  3-oxoacyl-ACP reductase                          76.6    2e-13   
ref|WP_009282872.1|  short-chain dehydrogenase                        76.6    2e-13   Fibrisoma limi
ref|WP_016435613.1|  3-oxoacyl-[acyl-carrier-protein] reductase       76.3    2e-13   Streptomyces sp. HGB0020
ref|WP_003326264.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            75.9    3e-13   Bacillus subtilis group
ref|WP_033288401.1|  short-chain dehydrogenase                        75.9    4e-13   Amycolatopsis jejuensis
ref|WP_010790407.1|  3-oxoacyl-[acyl-carrier protein] reductase       75.5    4e-13   Bacillus atrophaeus
ref|WP_010153679.1|  2-deoxy-D-gluconate 3-dehydrogenase              75.9    4e-13   
ref|WP_039075018.1|  3-oxoacyl-ACP reductase                          75.5    4e-13   Bacillus
gb|KFF55020.1|  3-oxoacyl-ACP reductase                               75.5    4e-13   Bacillus subtilis subsp. stercoris
ref|WP_014665965.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            75.5    5e-13   Bacillus
ref|WP_030301098.1|  3-oxoacyl-ACP reductase                          75.5    5e-13   Streptomyces katrae
ref|WP_021481000.1|  3-oxoacyl-ACP reductase                          75.1    6e-13   Bacillus
ref|WP_015250878.1|  short-chain dehydrogenase                        75.1    6e-13   Bacillus subtilis
ref|WP_030722717.1|  3-oxoacyl-ACP reductase                          74.7    7e-13   Streptomyces sp. NRRL S-237
ref|WP_034129857.1|  hypothetical protein                             75.1    7e-13   
ref|WP_038429885.1|  3-oxoacyl-ACP reductase                          74.7    7e-13   Bacillus subtilis
ref|WP_014481373.1|  glucose-1-dehydrogenase                          74.7    7e-13   Bacillus subtilis
ref|WP_021479197.1|  hypothetical protein                             74.7    9e-13   Pseudogulbenkiania ferrooxidans
ref|WP_033214243.1|  3-oxoacyl-ACP reductase                          74.3    9e-13   Streptomyces virginiae
ref|WP_013228886.1|  short-chain dehydrogenase                        74.3    1e-12   Amycolatopsis mediterranei
ref|WP_022695140.1|  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase    74.3    1e-12   Ponticaulis koreensis
ref|WP_013390701.1|  3-oxoacyl-ACP reductase                          73.9    2e-12   Bacillus atrophaeus
gb|AFW70954.1|  hypothetical protein ZEAMMB73_731402                  72.4    2e-12   
ref|XP_008450121.1|  PREDICTED: carbonyl reductase [NADPH] 2          73.6    2e-12   
ref|WP_007515326.1|  short-chain dehydrogenase                        73.6    2e-12   Frankia saprophytica
gb|AIL50168.1|  putative ketoreductase                                73.2    3e-12   Streptomyces aureus
emb|CDP15762.1|  unnamed protein product                              69.3    4e-12   Coffea canephora [robusta coffee]
ref|WP_014220449.1|  short-chain dehydrogenase                        72.8    4e-12   Niastella koreensis
ref|WP_028851508.1|  short-chain dehydrogenase                        72.8    4e-12   Thermocrispum municipale
ref|WP_020717882.1|  hypothetical protein                             72.8    5e-12   Acidobacteriaceae bacterium KBS 96
ref|WP_030023759.1|  3-oxoacyl-ACP reductase                          72.4    5e-12   
ref|XP_004169927.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[a...  72.8    5e-12   
ref|XP_004148011.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  72.8    5e-12   
ref|WP_002565056.1|  MULTISPECIES: short-chain dehydrogenase          72.4    5e-12   
ref|WP_002590458.1|  short-chain dehydrogenase/reductase SDR [        72.4    5e-12   
gb|KCZ51594.1|  hypothetical protein HY2_01180                        72.0    6e-12   
ref|WP_028525735.1|  short-chain dehydrogenase                        72.0    7e-12   
ref|WP_028656969.1|  short-chain dehydrogenase                        72.4    7e-12   
ref|XP_006650897.1|  PREDICTED: peroxisomal 2,4-dienoyl-CoA reduc...  72.4    7e-12   
ref|WP_023421046.1|  MULTISPECIES: short-chain dehydrogenase/redu...  72.4    7e-12   
ref|WP_034825363.1|  2-deoxy-D-gluconate 3-dehydrogenase              72.0    8e-12   
ref|WP_033949158.1|  oxidoreductase                                   72.4    8e-12   
ref|WP_010103725.1|  3-oxoacyl-ACP reductase                          71.6    9e-12   
ref|WP_034417939.1|  hypothetical protein                             72.0    9e-12   
ref|WP_003277030.1|  3-oxoacyl-ACP reductase                          71.2    9e-12   
emb|CEG22649.1|  Gluconate 5-dehydrogenase                            71.6    1e-11   
ref|WP_023415614.1|  short-chain dehydrogenase/reductase SDR          72.4    1e-11   
ref|WP_044306887.1|  3-oxoacyl-ACP reductase                          71.6    1e-11   
gb|AAY34344.1|  alcohol dehydrogenase-like                            67.4    1e-11   
ref|WP_013929933.1|  short-chain dehydrogenase                        71.6    1e-11   
ref|WP_033543136.1|  2-deoxy-D-gluconate 3-dehydrogenase              71.6    1e-11   
ref|WP_040125719.1|  oxidoreductase                                   71.2    1e-11   
gb|AFW66977.1|  alcohol dehydrogenase                                 71.6    1e-11   
ref|XP_009048133.1|  hypothetical protein LOTGIDRAFT_207716           71.6    1e-11   
ref|NP_001151403.1|  LOC100285036                                     71.6    1e-11   
ref|WP_024795409.1|  oxidoreductase                                   71.6    1e-11   
emb|CDY02920.1|  BnaC04g25660D                                        71.2    1e-11   
gb|KDP46262.1|  hypothetical protein JCGZ_10102                       71.6    1e-11   
ref|WP_035644452.1|  short-chain dehydrogenase                        71.2    1e-11   
ref|WP_037525479.1|  short-chain dehydrogenase                        71.2    1e-11   
ref|XP_010482176.1|  PREDICTED: L-xylulose reductase-like             71.6    1e-11   
ref|XP_002463516.1|  hypothetical protein SORBIDRAFT_01g001170        71.6    1e-11   
gb|EEK90608.1|  Short-chain dehydrogenase/reductase SDR               71.2    1e-11   
ref|WP_001208942.1|  3-oxoacyl-ACP reductase                          71.2    1e-11   
ref|WP_001208946.1|  3-oxoacyl-ACP reductase                          71.2    2e-11   
gb|EEK63229.1|  Short-chain dehydrogenase/reductase SDR               70.9    2e-11   
ref|WP_001208948.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            70.9    2e-11   
gb|EEM49057.1|  Short-chain dehydrogenase/reductase SDR               70.9    2e-11   
ref|WP_002195247.1|  3-oxoacyl-ACP reductase                          70.9    2e-11   
gb|KCZ57276.1|  hypothetical protein HY29_00700                       70.9    2e-11   
ref|WP_001208949.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            70.9    2e-11   
ref|WP_001208950.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            70.9    2e-11   
gb|EEN04335.1|  Short-chain dehydrogenase/reductase SDR               70.9    2e-11   
gb|EEM84998.1|  Short-chain dehydrogenase/reductase SDR               70.9    2e-11   
gb|EEL30002.1|  Short-chain dehydrogenase/reductase SDR               70.9    2e-11   
ref|WP_016097877.1|  3-oxoacyl-[acyl-carrier protein] reductase       70.9    2e-11   
ref|WP_001208947.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            70.9    2e-11   
ref|WP_001208938.1|  3-oxoacyl-ACP reductase                          70.9    2e-11   
ref|WP_022792737.1|  3-ketoacyl-ACP reductase                         70.9    2e-11   
ref|WP_041364461.1|  oxidoreductase                                   70.9    2e-11   
ref|WP_040827638.1|  oxidoreductase                                   71.2    2e-11   
ref|WP_001208945.1|  3-oxoacyl-ACP reductase                          70.9    2e-11   
ref|WP_001208943.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            70.9    2e-11   
ref|WP_037617075.1|  3-oxoacyl-ACP reductase                          70.9    2e-11   
ref|WP_001208940.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            70.9    2e-11   
ref|WP_020121964.1|  hypothetical protein                             71.2    2e-11   
ref|XP_006298324.1|  hypothetical protein CARUB_v10014388mg           71.2    2e-11   
ref|WP_034789944.1|  2-deoxy-D-gluconate 3-dehydrogenase              70.9    2e-11   
ref|WP_020299952.1|  3-oxoacyl-[acyl-carrier protein] reductase       70.9    2e-11   
ref|XP_008643798.1|  PREDICTED: LOC100285036 isoform X1               71.6    2e-11   
dbj|BAF63484.1|  short-chain type alcohol dehydrogenase               66.6    2e-11   
ref|WP_024648293.1|  hypothetical protein                             70.5    2e-11   
ref|WP_011663136.1|  2-deoxy-D-gluconate 3-dehydrogenase              70.9    2e-11   
gb|EEK52013.1|  Short-chain dehydrogenase/reductase SDR               70.5    2e-11   
gb|EEM97591.1|  Short-chain dehydrogenase/reductase SDR               70.5    2e-11   
ref|WP_031176945.1|  oxidoreductase                                   70.9    2e-11   
gb|EGH44735.1|  3-oxoacyl-[acyl-carrier protein] reductase            70.5    2e-11   
gb|EXY87172.1|  short chain dehydrogenase family protein              70.1    2e-11   
gb|ELS63253.1|  hypothetical protein BSI_06440                        68.6    2e-11   
ref|WP_010640064.1|  MULTISPECIES: oxidoreductase                     70.9    2e-11   
ref|WP_001208941.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            70.5    2e-11   
ref|WP_030764937.1|  oxidoreductase                                   70.9    2e-11   
ref|WP_037841233.1|  oxidoreductase                                   70.9    2e-11   
ref|WP_030697454.1|  oxidoreductase                                   70.9    2e-11   
ref|WP_008406792.1|  oxidoreductase                                   70.9    2e-11   
ref|WP_030305800.1|  oxidoreductase                                   70.9    2e-11   
ref|WP_001208944.1|  3-oxoacyl-ACP reductase                          70.5    3e-11   
gb|EMT09769.1|  Carbonyl reductase (NADPH) 2                          69.7    3e-11   
ref|WP_017452392.1|  MULTISPECIES: oxidoreductase                     70.5    3e-11   
ref|WP_040491260.1|  hypothetical protein                             70.5    3e-11   
ref|WP_044530911.1|  oxidoreductase                                   70.5    3e-11   
ref|WP_011683895.1|  short-chain dehydrogenase/reductase SDR          70.5    3e-11   
ref|WP_032576906.1|  3-oxoacyl-ACP reductase                          70.1    3e-11   
ref|WP_033238527.1|  oxidoreductase                                   70.9    3e-11   
ref|XP_003743672.1|  PREDICTED: dehydrogenase/reductase SDR famil...  70.5    3e-11   
gb|KIW69537.1|  hypothetical protein PV04_05410                       70.5    3e-11   
ref|WP_008769456.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            70.1    3e-11   
ref|WP_020460471.1|  short-chain dehydrogenase/reductase SDR          70.5    3e-11   
ref|WP_001208939.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            70.1    3e-11   
ref|XP_004981042.1|  PREDICTED: L-xylulose reductase-like             70.5    3e-11   
gb|EEL70828.1|  Short-chain dehydrogenase/reductase SDR               70.1    3e-11   
ref|WP_038466551.1|  oxidoreductase                                   70.5    3e-11   
ref|WP_032532707.1|  3-oxoacyl-ACP reductase                          70.1    3e-11   
ref|XP_001949499.2|  PREDICTED: dehydrogenase/reductase SDR famil...  70.5    3e-11   
ref|WP_041328299.1|  3-oxoacyl-ACP reductase                          70.5    3e-11   
ref|WP_033706796.1|  3-oxoacyl-ACP reductase                          70.1    3e-11   
ref|WP_026995388.1|  short-chain dehydrogenase                        70.1    3e-11   
ref|WP_021330318.1|  putative gluconate 5-dehydrogenase               70.1    3e-11   
ref|XP_008183291.1|  PREDICTED: dehydrogenase/reductase SDR famil...  70.1    3e-11   
ref|WP_007758627.1|  oxidoreductase                                   70.1    3e-11   
ref|WP_015580326.1|  MULTISPECIES: 3-oxoacyl-[acyl-carrier protei...  70.5    3e-11   
ref|WP_021495749.1|  putative gluconate 5-dehydrogenase               70.1    4e-11   
ref|WP_008768195.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            70.1    4e-11   
ref|WP_015018187.1|  glucose 1-dehydrogenase                          70.1    4e-11   
ref|WP_043611888.1|  3-oxoacyl-ACP reductase                          70.1    4e-11   
gb|ABG05322.1|  short-chain dehydrogenase/reductase SDR               70.5    4e-11   
ref|WP_011135098.1|  3-oxoacyl-ACP reductase                          70.1    4e-11   
ref|WP_016119276.1|  3-oxoacyl-[acyl-carrier protein] reductase       70.1    4e-11   
ref|WP_028444265.1|  oxidoreductase                                   70.5    4e-11   
ref|WP_041508196.1|  sugar dehydrogenase                              70.1    4e-11   
ref|WP_019548307.1|  hypothetical protein                             70.1    4e-11   
ref|WP_005809552.1|  3-oxoacyl-ACP reductase                          69.7    4e-11   
ref|WP_002144105.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            69.7    4e-11   
gb|AAT90815.1|  probable 3-oxoacyl-acyl-carrier protein reductase     69.7    4e-11   
ref|WP_030627676.1|  MULTISPECIES: oxidoreductase                     70.1    4e-11   
ref|WP_014049974.1|  MULTISPECIES: oxidoreductase                     70.1    4e-11   
ref|WP_041700367.1|  short-chain dehydrogenase                        69.7    5e-11   
gb|KHG07824.1|  Levodione reductase                                   70.1    5e-11   
ref|WP_042564551.1|  short-chain dehydrogenase                        69.7    5e-11   
gb|AEY65119.1|  dehydrogenase of unknown specificity, short-chain...  69.7    5e-11   
ref|XP_002509494.1|  2,4-dienoyl-CoA reductase, putative              68.6    5e-11   
ref|WP_019144517.1|  oxidoreductase                                   70.1    5e-11   
gb|KCZ99863.1|  short chain dehydrogenase/reductase family oxidor...  69.7    5e-11   
ref|NP_001151665.1|  alcohol dehydrogenases                           69.7    5e-11   
ref|WP_013423822.1|  short-chain dehydrogenase                        69.3    6e-11   
ref|WP_030785043.1|  3-oxoacyl-ACP reductase                          69.3    6e-11   
ref|WP_040499708.1|  3-alpha-hydroxysteroid dehydrogenase             69.3    6e-11   
ref|WP_029269922.1|  short-chain dehydrogenase                        69.3    6e-11   
ref|WP_018585083.1|  hypothetical protein                             69.3    6e-11   
ref|WP_016481639.1|  3-oxoacyl-[acyl-carrier-protein] reductase       69.3    6e-11   
gb|EDS99629.1|  short-chain dehydrogenase/reductase SDR               68.9    6e-11   
gb|EMS68459.1|  Carbonyl reductase [NADPH] 2                          67.8    6e-11   
ref|WP_035594398.1|  2-deoxy-D-gluconate 3-dehydrogenase              69.3    7e-11   
ref|WP_030521030.1|  short-chain dehydrogenase                        69.3    7e-11   
gb|KCZ93950.1|  short chain dehydrogenase/reductase family oxidor...  68.9    7e-11   
gb|ADG86311.1|  3-ketoacyl ACP-reductase                              69.3    7e-11   
ref|WP_004104897.1|  3-oxoacyl-ACP reductase                          68.9    7e-11   
ref|XP_010442348.1|  PREDICTED: L-xylulose reductase-like             69.3    7e-11   
ref|WP_020129378.1|  hypothetical protein                             69.3    7e-11   
ref|WP_033245853.1|  MULTISPECIES: short-chain dehydrogenase          69.3    7e-11   
ref|WP_009657008.1|  polyketide synthase                              69.3    7e-11   
ref|WP_004114789.1|  MULTISPECIES: 3-oxoacyl-ACP reductase            68.9    7e-11   
ref|WP_040994276.1|  short-chain dehydrogenase                        68.9    8e-11   
ref|WP_032745825.1|  3-oxoacyl-ACP reductase                          68.9    8e-11   
ref|WP_003181868.1|  short-chain dehydrogenase                        68.9    8e-11   
ref|WP_034086957.1|  3-oxoacyl-ACP reductase                          69.3    8e-11   
ref|WP_036801993.1|  2-deoxy-D-gluconate 3-dehydrogenase              68.9    8e-11   
ref|WP_026729632.1|  short-chain dehydrogenase                        68.9    8e-11   
ref|WP_025438102.1|  2-deoxy-D-gluconate 3-dehydrogenase              68.9    8e-11   
gb|KJB78355.1|  hypothetical protein B456_012G085000                  67.8    8e-11   
ref|WP_043176560.1|  hypothetical protein                             68.9    8e-11   
ref|WP_039176252.1|  sugar dehydrogenase                              69.3    8e-11   
ref|WP_019743837.1|  glucose-1-dehydrogenase                          69.3    8e-11   
gb|KDN55616.1|  short-chain dehydrogenase                             67.4    9e-11   
ref|WP_008342137.1|  glucose-1-dehydrogenase                          68.9    9e-11   
ref|WP_035390548.1|  sugar dehydrogenase                              68.9    9e-11   
ref|WP_028393374.1|  short-chain dehydrogenase                        68.9    9e-11   
ref|WP_029335073.1|  2-deoxy-D-gluconate 3-dehydrogenase              68.9    9e-11   
ref|WP_035703088.1|  sugar dehydrogenase                              68.9    9e-11   
ref|WP_017562746.1|  oxidoreductase                                   69.3    9e-11   
ref|WP_002625185.1|  3-oxoacyl-[acyl-carrier protein] reductase       68.9    9e-11   
ref|WP_017366553.1|  glucose-1-dehydrogenase                          68.9    1e-10   
ref|WP_035612727.1|  2-deoxy-D-gluconate 3-dehydrogenase              68.9    1e-10   
ref|WP_030141714.1|  short-chain dehydrogenase                        68.9    1e-10   
ref|WP_025966978.1|  3-oxoacyl-ACP reductase                          68.9    1e-10   
ref|WP_042531821.1|  short-chain dehydrogenase                        68.9    1e-10   
ref|WP_023321510.1|  hypothetical protein                             68.6    1e-10   
ref|WP_033923929.1|  2-deoxy-D-gluconate 3-dehydrogenase              68.9    1e-10   
ref|WP_017145497.1|  3-oxoacyl-ACP reductase                          68.6    1e-10   
ref|WP_019086705.1|  2-deoxy-D-gluconate 3-dehydrogenase              68.9    1e-10   
ref|WP_008855897.1|  3-alpha-hydroxysteroid dehydrogenase             68.6    1e-10   
ref|WP_041091212.1|  sugar dehydrogenase                              68.9    1e-10   
ref|WP_027620487.1|  short-chain dehydrogenase                        68.9    1e-10   
ref|WP_013155652.1|  oxidoreductase                                   69.3    1e-10   
ref|WP_019608974.1|  oxidoreductase                                   69.3    1e-10   
ref|WP_024719007.1|  MULTISPECIES: sugar dehydrogenase                68.9    1e-10   
gb|EGD00865.1|  Short-chain dehydrogenase/reductase SDR               67.0    1e-10   
ref|WP_024647326.1|  short-chain dehydrogenase                        68.6    1e-10   
ref|WP_011442485.1|  2-deoxy-D-gluconate 3-dehydrogenase              68.9    1e-10   
ref|WP_025388988.1|  short-chain dehydrogenase                        68.6    1e-10   
ref|WP_022368789.1|  3-oxoacyl-[acyl-carrier protein] reductase       68.6    1e-10   
ref|WP_041526159.1|  2-deoxy-D-gluconate 3-dehydrogenase              68.6    1e-10   
ref|WP_019649740.1|  short-chain dehydrogenase                        68.6    1e-10   
ref|WP_039963222.1|  sugar dehydrogenase                              68.6    1e-10   
ref|WP_029282061.1|  MULTISPECIES: gluconate 5-dehydrogenase          68.6    1e-10   
gb|EMI14038.1|  glucose 1-dehydrogenase                               68.9    1e-10   
ref|WP_034642298.1|  3-oxoacyl-ACP reductase                          68.6    1e-10   
ref|WP_025034945.1|  2-deoxy-D-gluconate 3-dehydrogenase              68.6    1e-10   
ref|WP_019974516.1|  hypothetical protein                             68.6    1e-10   
ref|WP_009476893.1|  short chain dehydrogenase family protein         68.6    1e-10   
ref|WP_011355118.1|  7-alpha-hydroxysteroid dehydrogenase             68.9    1e-10   
ref|WP_033042819.1|  short-chain dehydrogenase                        68.6    1e-10   
ref|WP_015094660.1|  short-chain dehydrogenase/reductase SDR          68.6    1e-10   
dbj|GAE43562.1|  5-keto-D-gluconate 5-reductase                       67.0    1e-10   
gb|KHI44519.1|  oxidoreductase                                        68.6    1e-10   
ref|WP_026041005.1|  2-deoxy-D-gluconate 3-dehydrogenase              68.6    1e-10   
ref|WP_017903972.1|  short-chain dehydrogenase                        68.6    1e-10   
gb|ADU72223.1|  short-chain dehydrogenase/reductase SDR               68.6    1e-10   
ref|WP_027738181.1|  short-chain dehydrogenase                        68.6    1e-10   
ref|WP_007997636.1|  short-chain dehydrogenase                        68.6    1e-10   
gb|KCZ95903.1|  short chain dehydrogenase/reductase family oxidor...  67.8    1e-10   
gb|AJQ97065.1|  dehydrogenases with different specificities (rela...  68.6    1e-10   
ref|WP_008154197.1|  short-chain dehydrogenase                        68.6    1e-10   
ref|WP_044620326.1|  hypothetical protein                             68.6    1e-10   
ref|WP_006462000.1|  3-oxoacyl-(acyl-carrier-protein) reductase       68.6    1e-10   
ref|WP_040263450.1|  short-chain dehydrogenase                        68.6    1e-10   
ref|WP_018746413.1|  hypothetical protein                             68.6    1e-10   
ref|WP_036660729.1|  3-alpha-hydroxysteroid dehydrogenase             68.2    1e-10   
ref|NP_001284466.1|  carbonyl reductase [NADPH] 2                     68.6    1e-10   
ref|WP_028941121.1|  short-chain dehydrogenase                        68.6    1e-10   
ref|WP_027791662.1|  7-alpha-hydroxysteroid dehydrogenase             68.9    1e-10   
ref|WP_028307785.1|  hypothetical protein                             68.6    1e-10   
ref|WP_039791313.1|  hypothetical protein                             68.2    1e-10   
gb|KIL11680.1|  Glucose 1-dehydrogenase                               68.6    1e-10   
ref|WP_008065572.1|  short-chain dehydrogenase                        68.2    1e-10   
ref|WP_032106892.1|  oxidoreductase                                   67.0    1e-10   
gb|EXC94789.1|  short chain dehydrogenase family protein              66.2    1e-10   
gb|AFH60547.1|  alcohol dehydrogenase                                 68.6    1e-10   
ref|WP_041618601.1|  oxidoreductase                                   68.6    1e-10   
ref|WP_026331678.1|  short-chain dehydrogenase                        68.2    1e-10   
ref|WP_031466591.1|  oxidoreductase                                   68.6    1e-10   
ref|WP_014349869.1|  3-alpha-hydroxysteroid dehydrogenase             68.2    1e-10   
ref|WP_003934720.1|  short chain dehydrogenase                        68.9    1e-10   



>emb|CDP06201.1| unnamed protein product [Coffea canephora]
Length=285

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC+RM +AK GG ++NISSISGLNRGQLPGGLAY ++K A+N +T+VMA+EL
Sbjct  140  GTWLVSKYVCIRMRDAKQGGCVINISSISGLNRGQLPGGLAYASAKVAINTMTKVMAMEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT+GLMQKDWL  VAL+TVPLRT+GT++PALTS++RYLIHDS
Sbjct  200  GEHKIRVNSISPGLFKSEITEGLMQKDWLKNVALKTVPLRTYGTADPALTSVIRYLIHDS  259

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPG+PI
Sbjct  260  SEYVSGNNFIVDAGTTLPGLPI  281



>gb|KHN19831.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Glycine soja]
Length=177

 Score =   213 bits (542),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC RM +A+  GSI+NI+SI+GLNRGQLPGG AY++SK  VN LTRVMALEL
Sbjct  32   GTWLVSKYVCKRMRDAQRKGSIINIASIAGLNRGQLPGGAAYSSSKAGVNMLTRVMALEL  91

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT+ LM+K+WLN VA++TVPLR FGTS+PALTSL RYLIHDS
Sbjct  92   GAHKIRVNSISPGLFKSEITEKLMEKNWLNNVAMKTVPLRKFGTSDPALTSLARYLIHDS  151

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN ++VDAG TLPGVPI
Sbjct  152  SEYVSGNNFVVDAGATLPGVPI  173



>ref|XP_002517315.1| 2,4-dienoyl-CoA reductase, putative [Ricinus communis]
 gb|EEF45108.1| 2,4-dienoyl-CoA reductase, putative [Ricinus communis]
Length=285

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+W+VSKYVC+RM +AK GGSIVNISSI+GLNRGQLPG +AY +SK  +NALT+VMALEL
Sbjct  140  GSWIVSKYVCIRMRDAKLGGSIVNISSIAGLNRGQLPGAVAYASSKAGLNALTKVMALEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVNSISPGLFKSEIT+GLMQKDWL  +ALRTVPLR +GTS+PALTSLVRYLIHDS
Sbjct  200  GVHNIRVNSISPGLFKSEITEGLMQKDWLRNIALRTVPLREYGTSDPALTSLVRYLIHDS  259

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN ++VDAG TLPGVPI
Sbjct  260  SEYVSGNIFVVDAGATLPGVPI  281



>ref|XP_010055797.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Eucalyptus grandis]
 gb|KCW90025.1| hypothetical protein EUGRSUZ_A02228 [Eucalyptus grandis]
Length=282

 Score =   214 bits (546),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+RM +A  GGSIVNISSI+GLNRGQLPGG+AYT+SK A+N +T+VMALEL
Sbjct  137  GSWLVSKYVCIRMRDAHQGGSIVNISSIAGLNRGQLPGGVAYTSSKAALNTMTKVMALEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPGLFKSEIT GLMQ+DWLN VA +TVPLRT+GTS+PALT+L+RYLIHDS
Sbjct  197  GEYKIRVNSISPGLFKSEITQGLMQRDWLNNVAEKTVPLRTYGTSDPALTTLIRYLIHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEYI+GN +IVDAG TLPGVPI
Sbjct  257  SEYITGNIFIVDAGATLPGVPI  278



>ref|XP_003518977.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
isoform X1 [Glycine max]
 ref|XP_006575129.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
isoform X2 [Glycine max]
Length=282

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC RM +A+  GSI+NI+SI+GLNRGQLPGG AY++SK  VN LTRVMALEL
Sbjct  137  GTWLVSKYVCKRMRDAQRKGSIINIASIAGLNRGQLPGGAAYSSSKAGVNMLTRVMALEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT+ LM+K+WLN VA++TVPLR FGTS+PALTSL RYLIHDS
Sbjct  197  GAHKIRVNSISPGLFKSEITEKLMEKNWLNNVAMKTVPLRKFGTSDPALTSLARYLIHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN ++VDAG TLPGVPI
Sbjct  257  SEYVSGNNFVVDAGATLPGVPI  278



>ref|XP_006482063.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Citrus sinensis]
Length=276

 Score =   211 bits (538),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+RM +A  GGSI+NISSI+G+NRGQLPGG+AY +SK  +N++T+VMALEL
Sbjct  131  GSWLVSKYVCIRMRDANLGGSIINISSIAGINRGQLPGGVAYASSKAGLNSMTKVMALEL  190

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVNSISPGLF+SEIT+GLMQK WLN VAL+TVPLR FGTS+PALTSLVRYLIHDS
Sbjct  191  GVHNIRVNSISPGLFRSEITEGLMQKKWLNNVALKTVPLREFGTSDPALTSLVRYLIHDS  250

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGN +IVDAG TLPGVPI
Sbjct  251  SKYVSGNMFIVDAGATLPGVPI  272



>ref|XP_004294537.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=282

 Score =   211 bits (538),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYV L M NA  GGSI+NISSI+GLNRG LPGG AY  SK AVN L++VMALEL
Sbjct  137  GTWLVSKYVSLCMRNADKGGSIINISSIAGLNRGYLPGGPAYNCSKGAVNTLSKVMALEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN+ISPGLF+SEIT+GLMQKDWL+ VA+RTVPLRTFGTS+PALTSLVRYLIHDS
Sbjct  197  GAHKIRVNAISPGLFRSEITEGLMQKDWLHNVAMRTVPLRTFGTSDPALTSLVRYLIHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN YIVDAG TLPGVPI
Sbjct  257  SEYVSGNIYIVDAGATLPGVPI  278



>gb|ABK93994.1| unknown [Populus trichocarpa]
Length=290

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK VC+RM ++K GGS++NI+SI+GLNRGQLPGG+ Y  SKT VNA+++VMA+EL
Sbjct  145  GTWLVSKAVCIRMRDSKRGGSVINIASIAGLNRGQLPGGIHYVASKTGVNAISKVMAMEL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPGLFKSEIT GLMQKDWL+ VAL+TVPLRTFGT++PALTSL RYLIHDS
Sbjct  205  GAYKIRVNSISPGLFKSEITQGLMQKDWLSNVALKTVPLRTFGTADPALTSLARYLIHDS  264

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG TLPGVP+
Sbjct  265  SEYVTGNNFIVDAGATLPGVPL  286



>ref|XP_002323240.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEF05001.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=290

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK VC+RM ++K GGS++NI+SI+GLNRGQLPGG+ Y  SKT VNA+++VMA+EL
Sbjct  145  GTWLVSKAVCIRMRDSKRGGSVINIASIAGLNRGQLPGGIHYVASKTGVNAISKVMAMEL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPGLFKSEIT GLMQKDWL+ VAL+TVPLRTFGT++PALTSL RYLIHDS
Sbjct  205  GAYKIRVNSISPGLFKSEITQGLMQKDWLSNVALKTVPLRTFGTADPALTSLARYLIHDS  264

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG TLPGVP+
Sbjct  265  SEYVTGNNFIVDAGATLPGVPL  286



>ref|XP_009588398.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Nicotiana tomentosiformis]
Length=288

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+RM +A  GGS++NISSI+GLNRGQLPGGLAY +SKTA+N + ++MALEL
Sbjct  143  GAWLVSKYVCIRMRDANQGGSVINISSIAGLNRGQLPGGLAYASSKTALNTVMKMMALEL  202

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPGLF+SEIT+GLMQKDWL+ +ALRT+PLRT GTS+PALTS+VRYLIHDS
Sbjct  203  GPYKIRVNSISPGLFRSEITEGLMQKDWLHNIALRTIPLRTHGTSDPALTSVVRYLIHDS  262

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IV+AG TLPGVPI
Sbjct  263  SEYVSGNIFIVEAGATLPGVPI  284



>gb|KDO53625.1| hypothetical protein CISIN_1g023885mg [Citrus sinensis]
Length=276

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+RM +A  GGSI+NISSI+G+NRGQLPGG+AY +SK  +N++T+VMALEL
Sbjct  131  GSWLVSKYVCIRMRDANLGGSIINISSIAGINRGQLPGGVAYASSKAGLNSMTKVMALEL  190

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVNSISPGLF SEIT+GLMQK WLN VAL+TVPLR FGTS+PALTSLVRYLIHDS
Sbjct  191  GVHNIRVNSISPGLFISEITEGLMQKKWLNNVALKTVPLREFGTSDPALTSLVRYLIHDS  250

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGN +IVDAG TLPGVPI
Sbjct  251  SKYVSGNMFIVDAGATLPGVPI  272



>gb|KDP23890.1| hypothetical protein JCGZ_26632 [Jatropha curcas]
Length=285

 Score =   209 bits (533),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK VC RM + K GGSI+NISSI+GL+RGQLPGGLAYTTSKT +NA+T+VMALEL
Sbjct  140  GTWLVSKSVCKRMRDGKQGGSIINISSIAGLDRGQLPGGLAYTTSKTGINAMTKVMALEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT+ LMQKDWL  VA + VPLRT G S+PALTSLVRYLIHDS
Sbjct  200  GVHKIRVNSISPGLFKSEITEHLMQKDWLTNVAKKIVPLRTHGASDPALTSLVRYLIHDS  259

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +I+DAG TLPGVPI
Sbjct  260  SEYVSGNIFIIDAGATLPGVPI  281



>ref|XP_006430534.1| hypothetical protein CICLE_v10012432mg [Citrus clementina]
 gb|ESR43774.1| hypothetical protein CICLE_v10012432mg [Citrus clementina]
Length=276

 Score =   209 bits (532),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+RM +A  GGSI+NISSI+G+NRGQLPGG+AY +SK  +N++T+VMALEL
Sbjct  131  GSWLVSKYVCIRMRDANLGGSIINISSIAGINRGQLPGGVAYASSKAGLNSMTKVMALEL  190

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVNSISPGLF SEIT+GLMQK WLN VAL+TVPLR FGTS+PALTSLVRYLIHDS
Sbjct  191  GVHNIRVNSISPGLFISEITEGLMQKKWLNNVALKTVPLREFGTSDPALTSLVRYLIHDS  250

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGN +IVDAG TLPGVPI
Sbjct  251  SKYVSGNMFIVDAGATLPGVPI  272



>ref|XP_011000407.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Populus euphratica]
 ref|XP_011015779.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Populus euphratica]
Length=290

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK VC+RM ++K GGS++NI+SI+GLNRGQLPGG+ Y  SKT VNA+++VMA+EL
Sbjct  145  GTWLVSKAVCIRMRDSKRGGSVINIASIAGLNRGQLPGGVHYVASKTGVNAISKVMAMEL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSISPGLFKSEIT GLMQKDWL+ VAL+TVPLRTFGT++PALTSL RYLIHDS
Sbjct  205  GAYNIRVNSISPGLFKSEITQGLMQKDWLSNVALKTVPLRTFGTADPALTSLARYLIHDS  264

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG TLPGVP+
Sbjct  265  SEYVTGNNFIVDAGATLPGVPL  286



>ref|XP_007028287.1| 2,4-dienoyl-CoA reductase isoform 2 [Theobroma cacao]
 gb|EOY08789.1| 2,4-dienoyl-CoA reductase isoform 2 [Theobroma cacao]
Length=282

 Score =   206 bits (525),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+ M +A  GGSI+NISSI+GLNRGQLPGG+AY  SK  + A+T+ MALEL
Sbjct  137  GSWLVSKYVCMHMLDANQGGSIINISSIAGLNRGQLPGGVAYAASKAGLIAMTKSMALEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT GLM+KDWL  VA RT PLRTFGTS+PALTSLVRYLIHDS
Sbjct  197  GAHKIRVNSISPGLFKSEITQGLMKKDWLTNVATRTAPLRTFGTSDPALTSLVRYLIHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPG+PI
Sbjct  257  SEYVSGNMFIVDAGVTLPGIPI  278



>emb|CAN64848.1| hypothetical protein VITISV_036158 [Vitis vinifera]
Length=286

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV LRM +AK GGSI+NISSI+ LNRGQLPGG+AY +SK+ ++A+T+VMALEL
Sbjct  141  GSWLVSKYVGLRMRDAKNGGSIINISSIAALNRGQLPGGVAYVSSKSGLSAMTKVMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IR N+I+PGLFKSEIT GLMQKDWLN VA RT P+RTFGTS+PALTSLVRYLIHDS
Sbjct  201  GAYNIRANAIAPGLFKSEITSGLMQKDWLNTVAQRTCPMRTFGTSDPALTSLVRYLIHDS  260

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S YISGN +IVDAG TLPGVPI
Sbjct  261  SRYISGNIFIVDAGATLPGVPI  282



>pir||S39508 alcohol dehydrogenase homolog, ripening-related - tomato  (fragment)
Length=242

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+KYVC+ M  A  GGSI+NISSI+G+NRGQLPG LAYT+SK A+N++T+V+ALEL
Sbjct  97   GAWLVTKYVCMHMRAANQGGSIINISSIAGINRGQLPGSLAYTSSKEALNSITKVLALEL  156

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPGLFKSEIT+GL+QKDW+  + LRT+PLRT GTS+PALTS+VRYLIHDS
Sbjct  157  GPYKIRVNSISPGLFKSEITEGLIQKDWIKNIELRTIPLRTHGTSHPALTSVVRYLIHDS  216

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPGVPI
Sbjct  217  SEYVSGNMFIVDAGATLPGVPI  238



>ref|XP_007145484.1| hypothetical protein PHAVU_007G242900g [Phaseolus vulgaris]
 gb|ESW17478.1| hypothetical protein PHAVU_007G242900g [Phaseolus vulgaris]
Length=286

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK VC RM +A+  GSI+NI+SI+GLNRGQLPG  AY++SK  VN LT+VMALEL
Sbjct  141  GTWLVSKSVCKRMRDAQRKGSIINIASIAGLNRGQLPGSAAYSSSKAGVNILTKVMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT+ LM+KDWLNKVA++TVPLR +GT++PALTSL RYLIHDS
Sbjct  201  GAHKIRVNSISPGLFKSEITEKLMEKDWLNKVAMKTVPLRRYGTADPALTSLARYLIHDS  260

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG TLPG+PI
Sbjct  261  SEYVTGNNFIVDAGATLPGLPI  282



>gb|KDO53626.1| hypothetical protein CISIN_1g031340mg [Citrus sinensis]
Length=161

 Score =   201 bits (511),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+KYVC+RM +AK GGS++NISS  GLNRG LPGG+AY +SK  +NA+T+VMALEL
Sbjct  16   GCWLVAKYVCIRMRDAKQGGSVINISSTGGLNRGHLPGGVAYASSKAGLNAMTKVMALEL  75

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN ISPG+F+SEIT  LM+KDWL  VA++TVPLR  GT+ PALTSL+RYL+HDS
Sbjct  76   GAHKIRVNCISPGIFRSEITKALMEKDWLTNVAMKTVPLREHGTTAPALTSLIRYLVHDS  135

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPGVPI
Sbjct  136  SEYVSGNIFIVDAGTTLPGVPI  157



>ref|XP_007202394.1| hypothetical protein PRUPE_ppa009414mg [Prunus persica]
 gb|EMJ03593.1| hypothetical protein PRUPE_ppa009414mg [Prunus persica]
Length=293

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV +RM +A  GGSI+N+SSI+GL+RG LPGG+AY  SK  VN L +VMA+EL
Sbjct  148  GSWLVSKYVSIRMRDADQGGSIINVSSIAGLHRGYLPGGVAYNCSKAGVNTLAKVMAMEL  207

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN+ISPGLF+SEIT+GLM+KDWL+ VA++TVPLRTFGTS+PALTSLVRYL+HDS
Sbjct  208  GVHKIRVNAISPGLFRSEITEGLMKKDWLHNVAMKTVPLRTFGTSDPALTSLVRYLVHDS  267

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN YIVDAG TLPGVPI
Sbjct  268  SEYVSGNVYIVDAGATLPGVPI  289



>ref|XP_010653621.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Vitis vinifera]
Length=286

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV +RM +AK GGSI+NISSI+ LNRGQLPGG+AY +SK+ ++A+T+VMALEL
Sbjct  141  GSWLVSKYVGMRMRDAKNGGSIINISSIAALNRGQLPGGVAYVSSKSGLSAMTKVMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IR N+I+PGLFKSEIT GLMQKDWLN VA RT P+RTFGTS+PALTSLVRYLIHDS
Sbjct  201  GAYNIRANAIAPGLFKSEITSGLMQKDWLNTVAQRTCPMRTFGTSDPALTSLVRYLIHDS  260

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S YISGN +IVDAG TLPGVPI
Sbjct  261  SRYISGNIFIVDAGATLPGVPI  282



>ref|XP_009383217.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=280

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK+VC RMC+AK  G ++NISSI G++RG LPGG+AY+ SKT  NA+T+VMALEL
Sbjct  135  GTWLVSKHVCKRMCDAKQKGCVINISSIGGIDRGHLPGGIAYSASKTGANAITKVMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGLF+SEIT GLM+++WLN+VA RTVPLRT+G S+PALTSL+RYLIHDS
Sbjct  195  GAFNIRVNSIAPGLFRSEITAGLMEREWLNRVAERTVPLRTYGKSDPALTSLIRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVDAG TLPG+P+
Sbjct  255  SAYVSGNIFIVDAGVTLPGIPL  276



>ref|XP_004249319.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Solanum lycopersicum]
Length=287

 Score =   204 bits (519),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+KYVC+ M  A  GGSI+NISSI+G+NRGQLPG LAYT+SK A+N++T+V+ALEL
Sbjct  142  GAWLVTKYVCMHMRAANQGGSIINISSIAGINRGQLPGSLAYTSSKEALNSITKVLALEL  201

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPGLFKSEIT+GL+QKDW+  + LRT+PLRT GTS+PALTS+VRYLIHDS
Sbjct  202  GPYKIRVNSISPGLFKSEITEGLIQKDWIKNIELRTIPLRTHGTSHPALTSVVRYLIHDS  261

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPGVPI
Sbjct  262  SEYVSGNMFIVDAGATLPGVPI  283



>ref|XP_010913911.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Elaeis guineensis]
Length=281

 Score =   204 bits (518),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK+VC RM + K  GS++NISSI+GL RGQLPG LAY+ SKTAVNALTRVMALEL
Sbjct  136  GLWLVSKHVCKRMRDTKQKGSVINISSINGLERGQLPGNLAYSVSKTAVNALTRVMALEL  195

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVNSISPG+FKSEIT GLM KDWL++V  +TVPL+T GTS+PALTSLVRYLIHDS
Sbjct  196  GVHNIRVNSISPGIFKSEITKGLMVKDWLDRVTKKTVPLKTTGTSDPALTSLVRYLIHDS  255

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPGVP+
Sbjct  256  SEYVSGNVFIVDAGATLPGVPL  277



>ref|XP_006430531.1| hypothetical protein CICLE_v10012408mg [Citrus clementina]
 gb|ESR43771.1| hypothetical protein CICLE_v10012408mg [Citrus clementina]
Length=282

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+KYVC+RM +AK GGS++NISS  GLNRG LPGG+AY +SK  +NA+T+VMALEL
Sbjct  137  GCWLVAKYVCIRMRDAKQGGSVINISSTGGLNRGHLPGGVAYASSKAGLNAMTKVMALEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN ISPG+F+SEIT  LM+KDWL  VA++TVPLR  GT++PALTSL+RYL+HDS
Sbjct  197  GAHKIRVNCISPGIFRSEITKALMEKDWLTNVAMKTVPLREHGTTDPALTSLIRYLVHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPGVPI
Sbjct  257  SEYVSGNIFIVDAGTTLPGVPI  278



>ref|XP_009371362.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=295

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK+V +RM +A  GGSIVNISSI+GLNRG LPG  AY  SK  VN LT+ MA+EL
Sbjct  150  GTWLVSKFVAIRMRDADQGGSIVNISSIAGLNRGYLPGATAYNCSKAGVNTLTKTMAMEL  209

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN+ISPGLF+SEIT+GLMQKDWL+ VA++TVPLRTFG S+PALTSLVRYL+HDS
Sbjct  210  GVHKIRVNAISPGLFRSEITEGLMQKDWLHNVAMKTVPLRTFGASDPALTSLVRYLVHDS  269

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN YIVDAG TLPGVPI
Sbjct  270  SEYVSGNIYIVDAGATLPGVPI  291



>ref|XP_010943529.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Elaeis guineensis]
Length=295

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC +M +AK  GS++NISSI G+NRGQLPGG+AYT SK  VNA+T+VMALEL
Sbjct  150  GLWLVSKYVCRQMRDAKQKGSVINISSIGGINRGQLPGGIAYTASKAGVNAITKVMALEL  209

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVNSI+PGLF SEIT GLMQ+ WLN VA +TVPL+T+GTS+PALTSLVRYLIHDS
Sbjct  210  GVHNIRVNSIAPGLFSSEITAGLMQRKWLNDVAKKTVPLQTYGTSDPALTSLVRYLIHDS  269

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG TLPG+PI
Sbjct  270  SEYVTGNIFIVDAGVTLPGIPI  291



>ref|XP_010112844.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
 gb|EXC34967.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
Length=283

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC  M +A  GGS++NISSISGLNRGQLPGGLAY+ SK  VN L++VMALEL
Sbjct  138  GTWLVSKYVCRLMRDAGRGGSVINISSISGLNRGQLPGGLAYSASKAGVNTLSKVMALEL  197

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPGLFKSEIT+GL++KDWL+ V  R VPLRTFGTS+PALTSLVRYLIHDS
Sbjct  198  GPYKIRVNSISPGLFKSEITEGLIKKDWLSIVGERIVPLRTFGTSDPALTSLVRYLIHDS  257

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN Y+VDAG+ LP VPI
Sbjct  258  SEYVSGNVYVVDAGSILPAVPI  279



>gb|ACS12983.1| 2,4-dienoyl-CoA reductase [Jatropha curcas]
Length=308

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSK VCLRM +AK GGSI+NISSI+GL+RGQLPG +AY +SK  +NA+T+VMALEL
Sbjct  163  GSWLVSKSVCLRMRDAKQGGSIINISSIAGLDRGQLPGAVAYASSKAGLNAMTKVMALEL  222

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT+ LMQKDWL  VA + VPLRT G S+PALTSLVRYLIHDS
Sbjct  223  GVHKIRVNSISPGLFKSEITEHLMQKDWLTNVAKKIVPLRTHGASDPALTSLVRYLIHDS  282

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +I+DAG TLPGVPI
Sbjct  283  SEYVSGNIFIIDAGATLPGVPI  304



>ref|XP_010673042.1| PREDICTED: L-xylulose reductase-like [Beta vulgaris subsp. vulgaris]
Length=296

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK VC+RM +AK GGSIVNISSI+GLNRGQLPG  AY+ SK  +N LT++MALEL
Sbjct  151  GAWLVSKSVCIRMRDAKIGGSIVNISSIAGLNRGQLPGSAAYSASKAGLNTLTKMMALEL  210

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIR+NSISPGLFKSEIT+ LM+KDWLNKVA++TVPL+TFGTS+PALTSLVRYLI D+
Sbjct  211  GVYKIRINSISPGLFKSEITENLMEKDWLNKVAVKTVPLQTFGTSDPALTSLVRYLILDA  270

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG TLPGVPI
Sbjct  271  SEYVTGNIFIVDAGATLPGVPI  292



>ref|XP_011079077.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Sesamum indicum]
Length=285

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC+RM + + GGS+VNISSI+GL RG LPGGLAY  +KTA+NA+T+VMALEL
Sbjct  140  GTWLVSKYVCMRMRDGRHGGSVVNISSIAGLERGHLPGGLAYACAKTAINAMTKVMALEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  +IRVNSISPGLFKSEIT GL++KDWL  V  RTVPLRTFGT +PALTSL+RYLIHDS
Sbjct  200  GAFEIRVNSISPGLFKSEITQGLVRKDWLKNVERRTVPLRTFGTLDPALTSLLRYLIHDS  259

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S++ISGN +IVDAG TLPG+PI
Sbjct  260  SKHISGNLFIVDAGVTLPGIPI  281



>ref|XP_006482062.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Citrus sinensis]
Length=282

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+KYVC+RM +AK GGS++NISS  GLNRG LPGG+AY +SK  +NA+T+VMALEL
Sbjct  137  GCWLVAKYVCIRMRDAKQGGSVINISSTGGLNRGHLPGGVAYASSKAGLNAMTKVMALEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN ISPG+F+SEIT  LM+KDWL  VA++TVPLR  GT+ PALTSL+RYL+HDS
Sbjct  197  GAHKIRVNCISPGIFRSEITKALMEKDWLTNVAMKTVPLREHGTTAPALTSLIRYLVHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPGVPI
Sbjct  257  SEYVSGNIFIVDAGTTLPGVPI  278



>gb|KDO53624.1| hypothetical protein CISIN_1g023555mg [Citrus sinensis]
Length=280

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+RM +A   GS++NISSI+  +RGQLPGG+AY +SK  +NA+T+ ++LEL
Sbjct  135  GSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI PGLFKSEIT+GLM+KDWLN VA RT PLR FGT++PALTSLVRYL+HDS
Sbjct  195  GVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVD+G TLPG+PI
Sbjct  255  SEYVSGNIFIVDSGATLPGLPI  276



>ref|XP_006430535.1| hypothetical protein CICLE_v10012421mg [Citrus clementina]
 gb|ESR43775.1| hypothetical protein CICLE_v10012421mg [Citrus clementina]
Length=280

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+RM +A   GS++NISSI+  +RGQLPGG+AY +SK  +NA+T+ ++LEL
Sbjct  135  GSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI PGLFKSEIT+GLM+KDWLN VA RT PLR FGT++PALTSLVRYL+HDS
Sbjct  195  GVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVD+G TLPG+PI
Sbjct  255  SEYVSGNIFIVDSGATLPGLPI  276



>gb|EYU18609.1| hypothetical protein MIMGU_mgv1a011131mg [Erythranthe guttata]
Length=291

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M +AK GGS+VNISSI+GLNRGQLPG LAY  SKTAVN +T++MA+EL
Sbjct  146  GAWLVSKYVCSHMRDAKQGGSVVNISSIAGLNRGQLPGSLAYAASKTAVNTMTKMMAIEL  205

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSISPGLFKSEIT+ LM+KDWL  VA +TVPLRT+G S+PALTSLVRYLIH+S
Sbjct  206  GVYGIRVNSISPGLFKSEITENLMEKDWLKNVATKTVPLRTYGESDPALTSLVRYLIHES  265

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN Y+V+AG TLPGVPI
Sbjct  266  SEYVSGNVYVVEAGATLPGVPI  287



>gb|KHN24253.1| 3-oxoacyl-[acyl-carrier-protein] reductase 1 [Glycine soja]
Length=202

 Score =   199 bits (506),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC RMC+ +  GSI+NISS+SGLNRGQLPG  AY +SK  VN LT+VMA+EL
Sbjct  57   GCWLVSKYVCKRMCDIQLKGSIINISSVSGLNRGQLPGAAAYASSKAGVNMLTKVMAMEL  116

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPG+FKSEIT+ L+QKDWLN V  + +PLR  GTS+PALTSL RYLIHDS
Sbjct  117  GMHKIRVNSISPGIFKSEITENLLQKDWLNDVVRKIMPLRRLGTSDPALTSLARYLIHDS  176

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVD G TLPGVPI
Sbjct  177  SEYVTGNNFIVDYGGTLPGVPI  198



>ref|XP_004515513.1| PREDICTED: glucose 1-dehydrogenase-like [Cicer arietinum]
Length=284

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC  M +AK  GSI+NISSI+GL+RGQLPG  AY  SK AVN LT+VMALEL
Sbjct  139  GTWLVSKYVCKLMRDAKIKGSIINISSIAGLDRGQLPGATAYACSKGAVNMLTKVMALEL  198

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT  LM+K WL  VA +TVPLR+FGTSNPALTS+VRYLIHDS
Sbjct  199  GAHKIRVNSISPGLFKSEITADLMEKHWLLNVAKKTVPLRSFGTSNPALTSIVRYLIHDS  258

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG T+PGVPI
Sbjct  259  SEYVTGNIFIVDAGATIPGVPI  280



>gb|AFK48641.1| unknown [Medicago truncatula]
 gb|KEH30025.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
 gb|KEH30027.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=273

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC  M ++K  GSI+NISSI+GL RGQLPGG AY  SK  VN LT+VMALEL
Sbjct  128  GTWLVSKYVCKLMRDSKRKGSIINISSIAGLERGQLPGGTAYACSKAGVNMLTKVMALEL  187

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPGLFKSEIT+ LM+KDWLN VA+RTVPLR +GTSNPALTS+ RYLIHDS
Sbjct  188  GAYKIRVNSISPGLFKSEITESLMKKDWLNNVAIRTVPLREWGTSNPALTSIARYLIHDS  247

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +I DAG TLPG PI
Sbjct  248  SEYVTGNIFIADAGATLPGFPI  269



>ref|XP_006482064.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Citrus sinensis]
Length=296

 Score =   202 bits (513),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+RM +A   GS++NISSI+  +RGQLPGG+AY +SK  +NA+T+ ++LEL
Sbjct  151  GSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLEL  210

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI PGLFKSEIT+GLM+KDWLN VA RT PLR FGT++PALTSLVRYL+HDS
Sbjct  211  GVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDS  270

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVD+G TLPG+PI
Sbjct  271  SEYVSGNIFIVDSGATLPGLPI  292



>gb|KJB54601.1| hypothetical protein B456_009G041000 [Gossypium raimondii]
Length=283

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+ M +AK GGS++NISSI+GLNRGQLPGGLAY +SK  +N +T+ MA+EL
Sbjct  138  GSWLVSKYVCMLMRDAKQGGSVINISSIAGLNRGQLPGGLAYASSKAGLNTMTKTMAMEL  197

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT+GL++K WL +VA +  PLRTFGT++PALTSLVRYLIHDS
Sbjct  198  GMHKIRVNSISPGLFKSEITEGLLKKAWLQEVATKINPLRTFGTADPALTSLVRYLIHDS  257

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG+TLPGVPI
Sbjct  258  SEYVTGNIFIVDAGSTLPGVPI  279



>ref|XP_008808086.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Phoenix dactylifera]
Length=294

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC +M +AK  GS++NISSI G+NRGQLPGG+AYT SK  VNA+T+VMALEL
Sbjct  149  GLWLVSKYVCRQMRDAKQKGSVINISSIGGINRGQLPGGIAYTASKAGVNAITKVMALEL  208

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGLF SEIT GLMQ+ WL+ VA +TVPL+T+GTS+PALTSLVRYLIHDS
Sbjct  209  GAYNIRVNSIAPGLFSSEITAGLMQRKWLDNVAKKTVPLQTYGTSDPALTSLVRYLIHDS  268

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG TLPG+PI
Sbjct  269  SEYVTGNIFIVDAGVTLPGIPI  290



>ref|XP_006339259.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum tuberosum]
Length=290

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+KYVC+ M  A  GGS++NISS +GLNRG+LPG LAY +SK A+N++T+VMA+EL
Sbjct  145  GAWLVTKYVCIHMRAANQGGSVINISSTAGLNRGKLPGSLAYASSKDALNSITKVMAIEL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPG+FKSEIT+ L+QKDW   VAL+T+PLRT GTSNPALTS+VRYLIHDS
Sbjct  205  GPYKIRVNSISPGVFKSEITERLIQKDWFKNVALKTIPLRTHGTSNPALTSVVRYLIHDS  264

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPGVPI
Sbjct  265  SEYVSGNIFIVDAGATLPGVPI  286



>gb|KHG26617.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Gossypium arboreum]
Length=283

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+ M +AK GGS++NISSI+GLNRGQLPGGLAY +SK  +N +T+ MA+EL
Sbjct  138  GSWLVSKYVCMLMRDAKQGGSVINISSIAGLNRGQLPGGLAYASSKAGLNTMTKTMAMEL  197

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT+GL++K WL +VA +  PLRTFGT++PALTSLVRYLIHDS
Sbjct  198  GMHKIRVNSISPGLFKSEITEGLLKKAWLQEVATKINPLRTFGTADPALTSLVRYLIHDS  257

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GN +IVDAG+TLPG+PI
Sbjct  258  SKYVTGNIFIVDAGSTLPGIPI  279



>ref|XP_008805478.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Phoenix dactylifera]
Length=286

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK+VC RM + K  GS++N+SSI+GL RGQLPG LAY+ SKT VNALTRVMALEL
Sbjct  141  GLWLVSKHVCKRMRDTKQKGSVINVSSINGLERGQLPGNLAYSVSKTGVNALTRVMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVNSISPG+FKSEIT GLM K+WL++V  +TVPL+T GTS+PALTSLVRYLIHDS
Sbjct  201  GVHNIRVNSISPGIFKSEITKGLMVKEWLDRVTKKTVPLQTLGTSDPALTSLVRYLIHDS  260

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            +EY+SGN ++VDAG TLPGVP+
Sbjct  261  TEYVSGNVFVVDAGATLPGVPL  282



>gb|AAN32641.1|AF416732_1 putative short-chain type alcohol dehydrogenase [Solanum tuberosum]
Length=290

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+KYVC+ M  A  GG+++NISS +GLNRG+LPG LAY +SK A+N++T+VMA+EL
Sbjct  145  GAWLVTKYVCIHMRAANQGGTVINISSTAGLNRGKLPGSLAYASSKDALNSITKVMAIEL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPG+FKSEIT+ L+QKDW   VAL+T+PLRT GTSNPALTS+VRYLIHDS
Sbjct  205  GPYKIRVNSISPGVFKSEITERLIQKDWFKNVALKTIPLRTHGTSNPALTSVVRYLIHDS  264

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPGVPI
Sbjct  265  SEYVSGNIFIVDAGATLPGVPI  286



>ref|XP_003518969.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Glycine max]
Length=282

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC RMC+ +  GSI+NISS+SGLNRGQLPG  AY +SK  VN LT+VMA+EL
Sbjct  137  GCWLVSKYVCKRMCDIQLKGSIINISSVSGLNRGQLPGAAAYASSKAGVNMLTKVMAMEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPG+FKSEIT+ L+QKDWLN V  + +PLR  GTS+PALTSL RYLIHDS
Sbjct  197  GMHKIRVNSISPGIFKSEITENLLQKDWLNDVVRKIMPLRRLGTSDPALTSLARYLIHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVD G TLPGVPI
Sbjct  257  SEYVTGNNFIVDYGGTLPGVPI  278



>gb|KEH30026.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=219

 Score =   197 bits (501),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M ++K  GSI+NISSI+GL RGQ+PGG AY  SK  VN LT+VMALEL
Sbjct  74   GAWLVSKYVCKLMRDSKRKGSIINISSIAGLERGQVPGGTAYACSKAGVNMLTKVMALEL  133

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT+ LM+KDWLN VA RTVPLR +GTSNPALT +VRYLIHDS
Sbjct  134  GAHKIRVNSISPGLFKSEITESLMKKDWLNNVAKRTVPLREWGTSNPALTKIVRYLIHDS  193

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +I DAG TLPG PI
Sbjct  194  SEYVTGNIFIADAGATLPGFPI  215



>ref|XP_009417296.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=287

 Score =   199 bits (506),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK+VC  M +AK  GS++NISSI G+ RGQLPGGLAY  SKT VNA+T+VMALEL
Sbjct  142  GLWLVSKHVCKHMRDAKQKGSVINISSIGGIERGQLPGGLAYVASKTGVNAVTKVMALEL  201

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGLFKSEITDGLM+++WLNKVA RTVPLRT+GT +PALTS+VR+L+HDS
Sbjct  202  GAFNIRVNSIAPGLFKSEITDGLMKREWLNKVAERTVPLRTYGTLDPALTSIVRFLMHDS  261

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN ++VDAG TLPG+P+
Sbjct  262  SAYVSGNIFVVDAGVTLPGIPL  283



>ref|NP_001274762.1| putative short-chain type alcohol dehydrogenase [Solanum tuberosum]
 gb|AAK29646.1|AF349916_1 putative short-chain type alcohol dehydrogenase [Solanum tuberosum]
Length=283

 Score =   199 bits (505),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+K+VC  M  A   GS++NISSI+GLN GQLPG LAY +SK A+N++T+V+ALEL
Sbjct  138  GAWLVTKFVCKHMRAANQEGSVINISSIAGLNPGQLPGCLAYASSKEALNSITKVLALEL  197

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPGLFKSEIT+GL+QKDWL  + LRT+PLRT GTSNPALTS+VRYLIHDS
Sbjct  198  GPYKIRVNSISPGLFKSEITEGLIQKDWLQNIELRTIPLRTHGTSNPALTSVVRYLIHDS  257

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPGVPI
Sbjct  258  SEYVSGNMFIVDAGATLPGVPI  279



>gb|KEH30024.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=273

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M ++K  GSI+NISSI+GL RGQ+PGG AY  SK  VN LT+VMALEL
Sbjct  128  GAWLVSKYVCKLMRDSKRKGSIINISSIAGLERGQVPGGTAYACSKAGVNMLTKVMALEL  187

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPGLFKSEIT+ LM+KDWLN VA RTVPLR +GTSNPALT +VRYLIHDS
Sbjct  188  GAHKIRVNSISPGLFKSEITESLMKKDWLNNVAKRTVPLREWGTSNPALTKIVRYLIHDS  247

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +I DAG TLPG PI
Sbjct  248  SEYVTGNIFIADAGATLPGFPI  269



>ref|XP_004249318.1| PREDICTED: D-erythrulose reductase-like [Solanum lycopersicum]
Length=290

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+KYVC+ M  A  GGS++NISS +GLNRG+LPG LAY +SK A+N++T++MA+EL
Sbjct  145  GAWLVTKYVCIHMRAANQGGSVINISSTAGLNRGKLPGSLAYASSKEALNSITKLMAIEL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNS+SPG+FKSEIT+ L+QKDW   VAL+T+PLRT GTSNPALTS+VRYLIHDS
Sbjct  205  GPYKIRVNSVSPGVFKSEITERLIQKDWFKTVALKTIPLRTHGTSNPALTSMVRYLIHDS  264

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPGVPI
Sbjct  265  SEYVSGNIFIVDAGATLPGVPI  286



>gb|EYU20812.1| hypothetical protein MIMGU_mgv1a011359mg [Erythranthe guttata]
Length=284

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC RM +AK  GS+V+ISSI+GL RGQLPGGLAY  SKTA+N +T+VMALEL
Sbjct  139  GTWLVSKYVCTRMRDAKISGSLVSISSIAGLERGQLPGGLAYACSKTAINTMTKVMALEL  198

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSISPGLFKSEIT GL++K WL  V  RTVPLR++GT +PALTSL+RYLIHDS
Sbjct  199  GIYGIRVNSISPGLFKSEITQGLVEKHWLKNVERRTVPLRSYGTLDPALTSLLRYLIHDS  258

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+ ++GN +IVDAG TLPGVPI
Sbjct  259  SKQVTGNLFIVDAGTTLPGVPI  280



>ref|XP_011075453.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=312

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK+VC  M +AK GGS++NISSI+GL+RGQLPG L Y  SK AVN +T+VMA+EL
Sbjct  167  GTWLVSKHVCRLMRDAKRGGSVINISSIAGLDRGQLPGSLVYAASKAAVNTMTKVMAMEL  226

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PGLF+SEIT GLMQKDWL  VA +TVPLRT+G S+PALTSL RYLIHDS
Sbjct  227  GVYKIRVNSIAPGLFQSEITQGLMQKDWLKIVAAKTVPLRTYGESDPALTSLARYLIHDS  286

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IV+AG TLPG+PI
Sbjct  287  SEYVSGNVFIVEAGATLPGIPI  308



>ref|XP_008386836.1| PREDICTED: probable L-xylulose reductase [Malus domestica]
Length=296

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSK+V +RM +A  GGSIVNISSI+G+NRG LPGG AY  SK  VN LT+ MA+EL
Sbjct  151  GSWLVSKFVAIRMRDADQGGSIVNISSIAGINRGHLPGGTAYICSKAGVNTLTKTMAMEL  210

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN+ISPGLF+SEIT+GLMQK W+  VA++ VPLRT+GTS+PALTSL+RYL+HDS
Sbjct  211  GVHKIRVNAISPGLFRSEITEGLMQKKWIPNVAMKIVPLRTYGTSDPALTSLLRYLVHDS  270

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN YIVDAG TLPGVPI
Sbjct  271  SEYVSGNIYIVDAGTTLPGVPI  292



>ref|XP_007145483.1| hypothetical protein PHAVU_007G242800g [Phaseolus vulgaris]
 gb|ESW17477.1| hypothetical protein PHAVU_007G242800g [Phaseolus vulgaris]
Length=282

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC RMC+A   GSI+NISS++GLNRGQLPG +AY +SK  VN LT+VMA EL
Sbjct  137  GCWLVSKYVCKRMCDAPMKGSIINISSVAGLNRGQLPGAVAYASSKAGVNMLTKVMASEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPG+FKSEIT+ LMQK WL  V  + +PLR  GTS+PALTSL RYLIHDS
Sbjct  197  GVHKIRVNSISPGIFKSEITESLMQKKWLEDVVRKIMPLRRLGTSDPALTSLARYLIHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVD G TLPGVPI
Sbjct  257  SEYVTGNNFIVDFGATLPGVPI  278



>ref|XP_008455729.1| PREDICTED: uncharacterized oxidoreductase C922.06-like [Cucumis 
melo]
Length=284

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC  M ++K GGS+++ISSISG+ RGQLPGGLAY  SK  +N LT+VMALEL
Sbjct  139  GSWLVSKYVCGHMRDSKRGGSVISISSISGIERGQLPGGLAYAASKAGINTLTKVMALEL  198

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGLFKSEIT+GLMQKDWLN VA +T PLRTFGTS+PALT+L+RYLI DS
Sbjct  199  GPYNIRVNSIAPGLFKSEITEGLMQKDWLNTVAYKTTPLRTFGTSDPALTTLIRYLIDDS  258

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN YIVD G TLPG PI
Sbjct  259  SRYVSGNIYIVDTGATLPGFPI  280



>ref|XP_010257447.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nelumbo nucifera]
Length=290

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKY+   M N    GSI+N++SI+GLNRGQLPGG+AY  SK  +NALT+VMALEL
Sbjct  145  GTWLVSKYIGRCMSNTNQKGSIINVTSIAGLNRGQLPGGVAYVASKAGLNALTKVMALEL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVN+I+PGLFKSEIT GL+QK+W+N+VA +TVPLRTFGT++PALTSL+RYLIHDS
Sbjct  205  GQHNIRVNAIAPGLFKSEITQGLLQKEWINEVARKTVPLRTFGTTDPALTSLIRYLIHDS  264

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +I DAG TLPGVPI
Sbjct  265  SYYVTGNIFIADAGATLPGVPI  286



>ref|XP_008340560.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
Length=295

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSK+V +RM +A  GGSIVNISSI+GLNRG LPG  AY  SK  VN LT+ MA+EL
Sbjct  150  GSWLVSKFVAIRMRDADQGGSIVNISSIAGLNRGYLPGATAYNCSKAGVNTLTKTMAMEL  209

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN+IS GLF+SEIT+ LMQKDWL+ VA++ VPLRTFGTS+PALTSLVRYL+HDS
Sbjct  210  GVHKIRVNAISLGLFRSEITERLMQKDWLHNVAMKIVPLRTFGTSDPALTSLVRYLVHDS  269

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN YIVDAG +LPGVPI
Sbjct  270  SEYVSGNIYIVDAGTSLPGVPI  291



>ref|XP_009394521.1| PREDICTED: hydroxysteroid dehydrogenase-like protein 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC +M NAK  G+++NISSISGLNRG+LPG +AY  SK  VNA+T+VMALE+
Sbjct  139  GLWLVSKYVCKQMVNAKLKGTVINISSISGLNRGKLPGAIAYAVSKEGVNAITKVMALEM  198

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVNSISPG+FKSEIT+ LM+K W+NKVA + +PLRTFGTS+PA+TS+VRYLIHDS
Sbjct  199  GVHNIRVNSISPGIFKSEITESLMRKKWINKVATKIIPLRTFGTSDPAITSVVRYLIHDS  258

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG TLPG P+
Sbjct  259  SEYVTGNIFIVDAGATLPGFPV  280



>ref|XP_004144326.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
 gb|KGN54691.1| hypothetical protein Csa_4G427270 [Cucumis sativus]
Length=286

 Score =   194 bits (492),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC  M ++K GGS+++ISSISG+ RGQLPGGLAY  SK  +N LT+VMALEL
Sbjct  141  GSWLVSKYVCSHMRDSKRGGSVISISSISGIERGQLPGGLAYAASKAGINILTKVMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IR NSI+PGLFKSEIT+GLMQKDWLN VA +T PLRTFGTS+PALT+L+RYLI DS
Sbjct  201  GPYNIRANSIAPGLFKSEITEGLMQKDWLNTVAYKTSPLRTFGTSDPALTTLIRYLIDDS  260

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN YIVD G TLPG PI
Sbjct  261  SRYVSGNIYIVDTGATLPGFPI  282



>ref|XP_008787372.1| PREDICTED: LOW QUALITY PROTEIN: estradiol 17-beta-dehydrogenase 
8-like [Phoenix dactylifera]
Length=203

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK++C RM + K  GS +NISSISG  RG+LPGG+AY  SK  V A+T+VMALEL
Sbjct  58   GLWLVSKHICRRMHDTKQNGSGINISSISGTQRGELPGGVAYAASKAGVGAITKVMALEL  117

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVN+I PGLFKSEIT+GLMQK WL++V  RTVPL+T  TS+PALTSLVRYLIHDS
Sbjct  118  GVHSIRVNAIXPGLFKSEITEGLMQKGWLDRVTKRTVPLQTLDTSDPALTSLVRYLIHDS  177

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SG+ +IVDAG TLPGVP+
Sbjct  178  SEYVSGSIFIVDAGTTLPGVPL  199



>ref|XP_009769812.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Nicotiana sylvestris]
 ref|XP_009772623.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Nicotiana sylvestris]
Length=134

 Score =   187 bits (475),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -3

Query  609  LNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLN  430
            LNRGQLPGGLAY +SKTA+N + ++MA+ELG  KI+VNSISPGLF+SEIT+GLMQKDWL+
Sbjct  19   LNRGQLPGGLAYASSKTALNTVMKMMAIELGPYKIKVNSISPGLFRSEITEGLMQKDWLH  78

Query  429  KVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPI  274
             +ALRT+PLRT GTS+PALTS+VRYLIHDSSEY+SGN +IV+AG TLPGVPI
Sbjct  79   NIALRTIPLRTHGTSDPALTSVVRYLIHDSSEYVSGNIFIVEAGATLPGVPI  130



>ref|XP_011075452.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=313

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK+VC  M +AK GGS++NISSI+GL+RGQLPG L Y  SK AVN +T+VMA+EL
Sbjct  167  GTWLVSKHVCRLMRDAKRGGSVINISSIAGLDRGQLPGSLVYAASKAAVNTMTKVMAMEL  226

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PGLF+SEIT GLMQKDWL  VA +TVPLRT+G S+PALTSL RYLIHDS
Sbjct  227  GVYKIRVNSIAPGLFQSEITQGLMQKDWLKIVAAKTVPLRTYGESDPALTSLARYLIHDS  286

Query  339  SEYISGNTYIVDAGNTLPGV  280
            SEY+SGN +IV+AG TLPG+
Sbjct  287  SEYVSGNVFIVEAGATLPGL  306



>ref|XP_002282735.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Vitis vinifera]
Length=286

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV +RM +AK GGSI+NISSI  LNRGQ PG +AY +SK+ ++A+T+VMALEL
Sbjct  141  GSWLVSKYVGMRMRDAKNGGSIINISSIVSLNRGQSPGAVAYVSSKSGLSAMTKVMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IR N+I+PG+FKSEIT GLMQKDWLN V  RT PLR +GTS+PALTSLVRYLIHDS
Sbjct  201  GAYNIRANAIAPGIFKSEITAGLMQKDWLNTVVQRTCPLRAYGTSDPALTSLVRYLIHDS  260

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S YISGN + VDAG TLPGVPI
Sbjct  261  SRYISGNVFNVDAGATLPGVPI  282



>ref|XP_004170137.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxoacyl-[acyl-carrier-protein] 
reductase FabG-like [Cucumis sativus]
Length=286

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC  M ++K GGS+++ISSISG+ RGQLPGGLAY  SK  +N LT+VMALEL
Sbjct  141  GSWLVSKYVCSHMRDSKRGGSVISISSISGIERGQLPGGLAYAASKAGINILTKVMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IR NSI+PG FKSEIT+GLMQKDWLN VA +T PLRTFGTS+PALT+L+RYLI DS
Sbjct  201  GPYNIRANSIAPGXFKSEITEGLMQKDWLNTVAYKTSPLRTFGTSDPALTTLIRYLIDDS  260

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN YIVD G TLPG PI
Sbjct  261  SRYVSGNIYIVDTGATLPGFPI  282



>gb|EPS63859.1| hypothetical protein M569_10924, partial [Genlisea aurea]
Length=269

 Score =   191 bits (484),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            GTWLVSK+VC RM +AK  GGS++NISSI+GL+RGQLPG LAY  SKTAVN +T++MA+E
Sbjct  123  GTWLVSKHVCTRMRDAKQGGGSVINISSIAGLDRGQLPGSLAYAASKTAVNNMTKMMAVE  182

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSISPGLFKSEIT+ L +K+WL  V LRT+PLRT G+S+PALTSLVRYLIHD
Sbjct  183  LGIYNIRVNSISPGLFKSEITESLFRKEWLETVNLRTIPLRTVGSSDPALTSLVRYLIHD  242

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS Y++GN +IVDAG TLPG+PI
Sbjct  243  SSSYVTGNMFIVDAGATLPGIPI  265



>ref|XP_010530038.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X3 [Tarenaya 
hassleriana]
Length=279

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  +  AK GGS++NISSI+G+ RG LPGG+AY +SK AVN +TR+MALEL
Sbjct  134  GPWLVSKYVCRLIREAKRGGSVINISSIAGIQRGMLPGGVAYNSSKGAVNIMTRMMALEL  193

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLF+SEIT  LM+K WL KVA RTVPL+ +GT +PALTSL+RYLIHDS
Sbjct  194  GEHKIRVNSIAPGLFRSEITGTLMEKGWLKKVAERTVPLKEYGTVDPALTSLLRYLIHDS  253

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GNT+IVDAG TLPGVPI
Sbjct  254  SEYVTGNTFIVDAGATLPGVPI  275



>ref|XP_010530193.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X5 [Tarenaya 
hassleriana]
Length=278

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  +  AK GGS++NISSI+G+ RG LPGG+AY +SK AVN +TR+MALEL
Sbjct  133  GPWLVSKYVCRLIREAKRGGSVINISSIAGIQRGMLPGGVAYNSSKGAVNIMTRMMALEL  192

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLF+SEIT  LM+K WL KVA RTVPL+ +GT +PALTSL+RYLIHDS
Sbjct  193  GEHKIRVNSIAPGLFRSEITGTLMEKGWLKKVAERTVPLKEYGTVDPALTSLLRYLIHDS  252

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GNT+IVDAG TLPGVPI
Sbjct  253  SEYVTGNTFIVDAGATLPGVPI  274



>ref|XP_010530115.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X4 [Tarenaya 
hassleriana]
Length=279

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  +  AK GGS++NISSI+G+ RG LPGG+AY +SK AVN +TR+MALEL
Sbjct  134  GPWLVSKYVCRLIREAKRGGSVINISSIAGIQRGMLPGGVAYNSSKGAVNIMTRMMALEL  193

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLF+SEIT  LM+K WL KVA RTVPL+ +GT +PALTSL+RYLIHDS
Sbjct  194  GEHKIRVNSIAPGLFRSEITGTLMEKGWLKKVAERTVPLKEYGTVDPALTSLLRYLIHDS  253

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GNT+IVDAG TLPGVPI
Sbjct  254  SEYVTGNTFIVDAGATLPGVPI  275



>ref|XP_010529958.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X2 [Tarenaya 
hassleriana]
Length=280

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  +  AK GGS++NISSI+G+ RG LPGG+AY +SK AVN +TR+MALEL
Sbjct  135  GPWLVSKYVCRLIREAKRGGSVINISSIAGIQRGMLPGGVAYNSSKGAVNIMTRMMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLF+SEIT  LM+K WL KVA RTVPL+ +GT +PALTSL+RYLIHDS
Sbjct  195  GEHKIRVNSIAPGLFRSEITGTLMEKGWLKKVAERTVPLKEYGTVDPALTSLLRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GNT+IVDAG TLPGVPI
Sbjct  255  SEYVTGNTFIVDAGATLPGVPI  276



>ref|XP_008339342.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
 ref|XP_008352851.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
Length=295

 Score =   191 bits (486),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSK+V +RM +A  GGSIVNISSI+GLNRG  PG  AY  SK  VN LT+ MA+EL
Sbjct  150  GSWLVSKFVAIRMRDADQGGSIVNISSITGLNRGFAPGATAYNCSKAGVNTLTKTMAMEL  209

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN+IS GLF+SEIT+ LMQKDWL+ VA++ VPLRTFGTS+PALTSLVRYL+HDS
Sbjct  210  GVHKIRVNAISLGLFRSEITERLMQKDWLHNVAMKIVPLRTFGTSDPALTSLVRYLVHDS  269

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN YIVDAG +LPGVPI
Sbjct  270  SEYVSGNIYIVDAGTSLPGVPI  291



>ref|XP_010529885.1| PREDICTED: carbonyl reductase [NADPH] 2-like isoform X1 [Tarenaya 
hassleriana]
Length=284

 Score =   191 bits (485),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  +  AK GGS++NISSI+G+ RG LPGG+AY +SK AVN +TR+MALEL
Sbjct  139  GPWLVSKYVCRLIREAKRGGSVINISSIAGIQRGMLPGGVAYNSSKGAVNIMTRMMALEL  198

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLF+SEIT  LM+K WL KVA RTVPL+ +GT +PALTSL+RYLIHDS
Sbjct  199  GEHKIRVNSIAPGLFRSEITGTLMEKGWLKKVAERTVPLKEYGTVDPALTSLLRYLIHDS  258

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GNT+IVDAG TLPGVPI
Sbjct  259  SEYVTGNTFIVDAGATLPGVPI  280



>ref|XP_010473483.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Camelina sativa]
Length=280

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVCL M  AK GGS++NISSISGL+RG LPGGLAY  SK  V+ +TR+MA+EL
Sbjct  135  GSWLVSKYVCLLMREAKRGGSVINISSISGLHRGLLPGGLAYACSKGGVDTMTRMMAIEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
              NKIRVNSI+PGLF+SEIT GLMQK+WL KV  RTVPL+   T +P LTSL+RYLIHDS
Sbjct  195  AANKIRVNSIAPGLFRSEITQGLMQKEWLKKVTERTVPLKMQQTVDPGLTSLMRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  255  SQYVTGNTYIVDSGTTLPGVPI  276



>ref|XP_004170138.1| PREDICTED: uncharacterized oxidoreductase Rv1714/MT1753.1-like 
[Cucumis sativus]
Length=174

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M  A  GGSI+NISSISGLNR    G +AY TSK A+N  T+VMA+EL
Sbjct  29   GQWLVSKYVCILMNKANRGGSIINISSISGLNRPLEMGAVAYITSKAALNTFTKVMAMEL  88

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI PGLFKSEIT  LM+KDW+  VA R VPLRTFGTSNPALT++VRYL+HDS
Sbjct  89   GAHKIRVNSICPGLFKSEITKDLMKKDWIKNVARRMVPLRTFGTSNPALTTIVRYLVHDS  148

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGN +IVDAG+TLPGVPI
Sbjct  149  SKYVSGNIFIVDAGSTLPGVPI  170



>ref|XP_009631508.1| PREDICTED: probable L-xylulose reductase [Nicotiana tomentosiformis]
Length=275

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKY+C RM +AK GG  V   S +  LNR  +PGG+AY +SK A++  T++MALE
Sbjct  129  GAWLVSKYICRRMRDAKQGGGSVINISSTAGLNRVLIPGGVAYASSKMALDMFTKMMALE  188

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNS+SPG+FKSEIT+ LMQK+W N V LRT+PL+T GT++PALTS+VRYLIHD
Sbjct  189  LGVDKIRVNSVSPGIFKSEITESLMQKEWFNNVTLRTIPLKTLGTTDPALTSVVRYLIHD  248

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SSEY+SGN +IVDAG TL GVPI
Sbjct  249  SSEYVSGNVFIVDAGTTLVGVPI  271



>ref|XP_008443382.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Cucumis melo]
Length=286

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+ M +    GS++NISSI GLNRG +PGG AY+ SK  +N LT++MA EL
Sbjct  141  GSWLVSKYVCIHMRDTNRSGSVINISSIGGLNRGHIPGGPAYSASKAGLNTLTKIMAHEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI PG+FKSEIT GLMQKDWL  VAL+TVPL+T+GTS+PALT+LVRYL+H+S
Sbjct  201  GAYNIRVNSICPGIFKSEITKGLMQKDWLKNVALKTVPLQTYGTSDPALTTLVRYLVHES  260

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +IVDAG TLPGVPI
Sbjct  261  STYVTGNIFIVDAGATLPGVPI  282



>ref|XP_009390649.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=283

 Score =   189 bits (480),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK+VC  M +AK  GS++NISSI G  RG LPGG+AY  SKT VNA+T+VMALEL
Sbjct  138  GLWLVSKHVCKHMRDAKQKGSVINISSIGGTERGHLPGGVAYVASKTGVNAVTKVMALEL  197

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVN+I+PGLF+SEIT GLM+++WLNKVA +TVPLRT+GT +PALTS+VR+LIHDS
Sbjct  198  GGFNIRVNAIAPGLFRSEITAGLMEREWLNKVAEKTVPLRTYGTLDPALTSVVRFLIHDS  257

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVDAG TLPG+P+
Sbjct  258  SSYVSGNIFIVDAGVTLPGIPL  279



>ref|XP_004172090.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 2 [Cucumis sativus]
Length=286

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+ M +    GS++NISSI GLNRG +PGG  Y  SK  +N LT++MALEL
Sbjct  141  GSWLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHIPGGSVYGASKAGLNTLTKIMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI PG+FKSEIT  LMQKDWL  VAL+TVPL+T+GTSNPALT+L+RYL+HDS
Sbjct  201  GAYNIRVNSICPGIFKSEITKVLMQKDWLKNVALKTVPLQTYGTSNPALTTLIRYLVHDS  260

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +IVDAG TLPGVPI
Sbjct  261  SRYVTGNIFIVDAGATLPGVPI  282



>ref|XP_008340561.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Malus domestica]
Length=295

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSK+V +RM +A  GGSIVNISSI+GLNRG  PG  AY  SK  VN LT+ MA+EL
Sbjct  150  GSWLVSKFVAIRMRDADQGGSIVNISSITGLNRGFAPGATAYNCSKAGVNTLTKTMAMEL  209

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN+IS GLF+SEIT+ LM+KDWL+ VA++  PLRTFGTS+PALTSLVRYL+HDS
Sbjct  210  GVHKIRVNAISXGLFRSEITERLMZKDWLHNVAMKXXPLRTFGTSDPALTSLVRYLVHDS  269

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN YIVDAG  LPGVPI
Sbjct  270  SEYVSGNIYIVDAGXXLPGVPI  291



>ref|XP_010516096.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X1 [Camelina sativa]
Length=281

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVCL M +AK GGS++NISSI+GL+RG LPGGLAY  SK  V+ ++R+MALEL
Sbjct  136  GPWLVSKYVCLLMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALEL  195

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHD+
Sbjct  196  GVHKIRVNSIAPGLFKSEITESLLQKEWMKNVTERVVPLKVQQTVDPGLTSLVRYLIHDA  255

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGNTYIVD+GNTLPGVPI
Sbjct  256  SQYVSGNTYIVDSGNTLPGVPI  277



>ref|XP_010516097.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X2 [Camelina sativa]
Length=280

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVCL M +AK GGS++NISSI+GL+RG LPGGLAY  SK  V+ ++R+MALEL
Sbjct  135  GPWLVSKYVCLLMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHD+
Sbjct  195  GVHKIRVNSIAPGLFKSEITESLLQKEWMKNVTERVVPLKVQQTVDPGLTSLVRYLIHDA  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGNTYIVD+GNTLPGVPI
Sbjct  255  SQYVSGNTYIVDSGNTLPGVPI  276



>ref|XP_004136692.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 2 [Cucumis sativus]
 gb|KGN59543.1| hypothetical protein Csa_3G824880 [Cucumis sativus]
Length=286

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+ M +    GS++NISSI GLNRG +PGG  Y  SK  +N LT++MALEL
Sbjct  141  GSWLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHIPGGSVYGASKAGLNTLTKIMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI PG+FKSEIT  LMQKDWL  VAL+TVPL+T+GTS+PALT+L+RYL+HDS
Sbjct  201  GAYNIRVNSICPGIFKSEITKVLMQKDWLKNVALKTVPLQTYGTSDPALTTLIRYLVHDS  260

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +IVDAG TLPGVPI
Sbjct  261  SRYVTGNIFIVDAGATLPGVPI  282



>ref|XP_006301634.1| hypothetical protein CARUB_v10022077mg, partial [Capsella rubella]
 gb|EOA34532.1| hypothetical protein CARUB_v10022077mg, partial [Capsella rubella]
Length=274

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC+ M +AK GGS++NISSISGL+RG LPGGLAY  SK  V+ +TR+MA+EL
Sbjct  129  GSWLVSKYVCVLMRDAKRGGSVINISSISGLHRGLLPGGLAYACSKGGVDTMTRMMAIEL  188

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PGLF+SEIT  LMQK+WL KV  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  189  GVYKIRVNSIAPGLFRSEITQALMQKEWLKKVTERTVPLKMQQTVDPGLTSLVRYLIHDS  248

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GNTYIVD+G TLPGVPI
Sbjct  249  SRYVTGNTYIVDSGTTLPGVPI  270



>ref|XP_010427295.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
 ref|XP_010427296.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
Length=281

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVCL M +AK GGS++NISSI+GL+RG LPGGLAY  SK  V+ ++R+MALEL
Sbjct  136  GPWLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALEL  195

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHD+
Sbjct  196  GVHKIRVNSIAPGLFKSEITESLLQKEWMKNVTERIVPLKVQQTVDPGLTSLVRYLIHDA  255

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+++SGNTYIVD+GNTLPGVPI
Sbjct  256  SQHVSGNTYIVDSGNTLPGVPI  277



>ref|XP_010427297.1| PREDICTED: probable L-xylulose reductase isoform X2 [Camelina 
sativa]
Length=280

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVCL M +AK GGS++NISSI+GL+RG LPGGLAY  SK  V+ ++R+MALEL
Sbjct  135  GPWLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHD+
Sbjct  195  GVHKIRVNSIAPGLFKSEITESLLQKEWMKNVTERIVPLKVQQTVDPGLTSLVRYLIHDA  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+++SGNTYIVD+GNTLPGVPI
Sbjct  255  SQHVSGNTYIVDSGNTLPGVPI  276



>ref|XP_010431696.1| PREDICTED: estradiol 17-beta-dehydrogenase 8-like [Camelina sativa]
Length=231

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSK+VCL M +AK GGS++NISSISGL+RG LPGGLAY  SK  V+ +TR+MA+EL
Sbjct  86   GSWLVSKHVCLLMRDAKRGGSVINISSISGLHRGLLPGGLAYACSKGGVDTMTRMMAIEL  145

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PGLF+SEIT GLMQK+WL  V  RTVPL+   T +P LTSL+RYLIHDS
Sbjct  146  GVYKIRVNSIAPGLFRSEITQGLMQKEWLKNVTERTVPLKMQQTVDPGLTSLMRYLIHDS  205

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  206  SQYVTGNTYIVDSGTTLPGVPI  227



>gb|KGN54692.1| hypothetical protein Csa_4G427280 [Cucumis sativus]
Length=297

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M  A  GGSI+NISSISGLNR    G +AY TSK A+N  T+VMA+EL
Sbjct  152  GQWLVSKYVCILMNKANRGGSIINISSISGLNRPLEMGAVAYITSKAALNTFTKVMAMEL  211

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI PGLFKSEIT  LM+KDW+  VA R VPLRTFGTSNPALT++VRYL+HDS
Sbjct  212  GAHKIRVNSICPGLFKSEITKDLMKKDWIKNVARRMVPLRTFGTSNPALTTIVRYLVHDS  271

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGN +IVDAG+TLPGVPI
Sbjct  272  SKYVSGNIFIVDAGSTLPGVPI  293



>ref|XP_004144361.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=297

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M  A  GGSI+NISSISGLNR    G +AY TSK A+N  T+VMA+EL
Sbjct  152  GQWLVSKYVCILMNKANRGGSIINISSISGLNRPLEMGAVAYITSKAALNTFTKVMAMEL  211

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI PGLFKSEIT  LM+KDW+  VA R VPLRTFGTSNPALT++VRYL+HDS
Sbjct  212  GAHKIRVNSICPGLFKSEITKDLMKKDWIKNVARRMVPLRTFGTSNPALTTIVRYLVHDS  271

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGN +IVDAG+TLPGVPI
Sbjct  272  SKYVSGNIFIVDAGSTLPGVPI  293



>emb|CDP20582.1| unnamed protein product [Coffea canephora]
Length=285

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC+ M +AK GG ++NISSI+GL+RGQLPG LAY ++K A+N +T+VMA+EL
Sbjct  140  GTWLVSKYVCIHMRDAKQGGCVINISSIAGLDRGQLPGALAYASAKAAINTMTKVMAMEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PG+FKSEIT+GLM+KDWL  V L+TVPL TFGT +PALTSL+RYLI DS
Sbjct  200  GKHKIRVNSIAPGIFKSEITEGLMEKDWLKNVTLKTVPLGTFGTIDPALTSLIRYLILDS  259

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGN +IVDAG TLPG PI
Sbjct  260  SEYVSGNIFIVDAGATLPGFPI  281



>ref|XP_006365803.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum tuberosum]
Length=272

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            GTWLVSKYVC  M ++K  G  V   S    LNR  +PGGLAY +SK A++ +T++MALE
Sbjct  126  GTWLVSKYVCRHMRDSKQDGGSVINISSISGLNRVLIPGGLAYASSKMALDMVTKMMALE  185

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG + IRVNSISPG+FKSEIT  LM+K+W N V +RT+PLRT GT++PALTS VRYLIHD
Sbjct  186  LGVDNIRVNSISPGIFKSEITKSLMEKEWFNNVTVRTIPLRTLGTTDPALTSTVRYLIHD  245

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SSEYISGN +IVDAG TL GVPI
Sbjct  246  SSEYISGNVFIVDAGTTLTGVPI  268



>ref|XP_006291426.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
 gb|EOA24324.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
Length=345

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M +AK GGS++NISSI+GL+RG LPGGLAY  SK  V+ ++R+MALEL
Sbjct  200  GPWLVSKYVCILMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALEL  259

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT+ L+QK W+  V  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  260  GVHKIRVNSIAPGLFKSEITESLLQKKWMKNVTERTVPLKEQQTVDPGLTSLVRYLIHDS  319

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGNTYIVD+GNTLPGVPI
Sbjct  320  SQYVSGNTYIVDSGNTLPGVPI  341



>ref|XP_006291425.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
 gb|EOA24323.1| hypothetical protein CARUB_v10017563mg, partial [Capsella rubella]
Length=344

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M +AK GGS++NISSI+GL+RG LPGGLAY  SK  V+ ++R+MALEL
Sbjct  199  GPWLVSKYVCILMRDAKRGGSVINISSIAGLHRGLLPGGLAYACSKGGVDTMSRMMALEL  258

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT+ L+QK W+  V  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  259  GVHKIRVNSIAPGLFKSEITESLLQKKWMKNVTERTVPLKEQQTVDPGLTSLVRYLIHDS  318

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGNTYIVD+GNTLPGVPI
Sbjct  319  SQYVSGNTYIVDSGNTLPGVPI  340



>ref|XP_010418256.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Camelina sativa]
Length=280

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSK+VC+ M +AK GGS +NISSISGL+RG LPGGLAY  SK  V+ +TR+MA+EL
Sbjct  135  GSWLVSKHVCVLMRDAKRGGSEINISSISGLHRGLLPGGLAYACSKGGVDTMTRMMAIEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
               KIRVNSI+PGLF+SEIT GLMQK+WL KV  RTVPL+   T +P LTSL+RYLIHDS
Sbjct  195  AVYKIRVNSIAPGLFRSEITQGLMQKEWLKKVTERTVPLKMQQTVDPGLTSLMRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  255  SQYVTGNTYIVDSGTTLPGVPI  276



>ref|XP_009596119.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=298

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV   M  AK GGSI+NISSI+GLNR  + GG+AY++SK A++++T+VMALEL
Sbjct  153  GSWLVSKYVGKHMQAAKRGGSIINISSIAGLNRISVRGGIAYSSSKAAMDSMTKVMALEL  212

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + +RVN+I+PG+FKSEIT+ L+QKDWL  VA R+VPL+TFGT+NPALTSLVRYL+HDS
Sbjct  213  GEHNVRVNAIAPGIFKSEITEKLLQKDWLKNVATRSVPLKTFGTTNPALTSLVRYLVHDS  272

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S YISGN +IVD+G TLPG+PI
Sbjct  273  SNYISGNIFIVDSGYTLPGIPI  294



>ref|NP_567019.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK76629.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AAL85073.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AEE79365.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=280

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK+VC+ M +AK GGS++NISSI+G+ RG LPGGLAY  SK  V+ ++R+MALEL
Sbjct  136  GPWLVSKHVCMLMRDAKRGGSVINISSIAGI-RGMLPGGLAYACSKGGVDTMSRMMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT GLMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  195  GVHKIRVNSIAPGLFKSEITQGLMQKEWLKNVTERTVPLKVQQTVDPGLTSLVRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+YISGNTYIVD+G TLPGVPI
Sbjct  255  SQYISGNTYIVDSGATLPGVPI  276



>ref|NP_974441.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE79366.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=279

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK+VC+ M +AK GGS++NISSI+G+ RG LPGGLAY  SK  V+ ++R+MALEL
Sbjct  135  GPWLVSKHVCMLMRDAKRGGSVINISSIAGI-RGMLPGGLAYACSKGGVDTMSRMMALEL  193

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT GLMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  194  GVHKIRVNSIAPGLFKSEITQGLMQKEWLKNVTERTVPLKVQQTVDPGLTSLVRYLIHDS  253

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+YISGNTYIVD+G TLPGVPI
Sbjct  254  SQYISGNTYIVDSGATLPGVPI  275



>emb|CAB75763.1| oxidoreductase-like protein [Arabidopsis thaliana]
Length=273

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK+VC+ M +AK GGS++NISSI+G+ RG LPGGLAY  SK  V+ ++R+MALEL
Sbjct  129  GPWLVSKHVCMLMRDAKRGGSVINISSIAGI-RGMLPGGLAYACSKGGVDTMSRMMALEL  187

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT GLMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  188  GVHKIRVNSIAPGLFKSEITQGLMQKEWLKNVTERTVPLKVQQTVDPGLTSLVRYLIHDS  247

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+YISGNTYIVD+G TLPGVPI
Sbjct  248  SQYISGNTYIVDSGATLPGVPI  269



>gb|KFK40341.1| hypothetical protein AALP_AA3G361500 [Arabis alpina]
Length=284

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYV + MC+AK GGS++NISS++GL RG+LPGGLAY  SK  V  +T +MALEL
Sbjct  139  GPWLVSKYVGVLMCDAKRGGSVINISSVAGLRRGELPGGLAYACSKGGVETMTMMMALEL  198

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PGLFKSEIT GLMQK+WL  VA R VPL+   T +P LTSLVRYLIH+S
Sbjct  199  GDYKIRVNSIAPGLFKSEITQGLMQKEWLKNVAERIVPLKMQQTVDPGLTSLVRYLIHNS  258

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+YISGNTYIVD+G TLPG+PI
Sbjct  259  SQYISGNTYIVDSGYTLPGLPI  280



>ref|XP_004157996.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=297

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M  A  GGSI+NISSISGLNR    G LAY TSK A+N LT+VMA+EL
Sbjct  152  GQWLVSKYVCILMNKANRGGSIINISSISGLNRALQRGALAYITSKAALNTLTKVMAMEL  211

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI PGLFKSEIT  LM+KDW+  VA R +PLRTFGTSNPALT+ VRYL+H+S
Sbjct  212  GAHKIRVNSICPGLFKSEITKDLMEKDWIKNVAKRMIPLRTFGTSNPALTTTVRYLVHES  271

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGN +IVDAGN+L GVPI
Sbjct  272  SKYVSGNIFIVDAGNSLLGVPI  293



>ref|XP_002876294.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH52553.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=280

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M +AK GGS++NISSI+G+ RG LPGGLAY  SK  V+ ++R+MA+EL
Sbjct  136  GPWLVSKYVCVLMRDAKRGGSVINISSIAGI-RGILPGGLAYACSKGGVDTMSRMMAIEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT GLMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  195  GVHKIRVNSIAPGLFKSEITQGLMQKEWLKNVTERTVPLKVQQTVDPGLTSLVRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+YISGNTYIVD+G TLPGVPI
Sbjct  255  SQYISGNTYIVDSGATLPGVPI  276



>emb|CDY48725.1| BnaA09g10000D [Brassica napus]
Length=287

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M +AK GGS++NISS++G++RG LPG +AY  SK  V+ +TR+MA+EL
Sbjct  142  GPWLVSKYVCILMRDAKQGGSVINISSMAGVHRGMLPGAVAYACSKGGVDIMTRMMAIEL  201

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIR+NSI+PGLFKSEIT GLMQK+WL KV  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  202  GVYKIRMNSIAPGLFKSEITQGLMQKEWLKKVNERTVPLKMQQTVDPGLTSLVRYLIHDS  261

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY+SGNTYIVD+G +LPG+PI
Sbjct  262  SEYVSGNTYIVDSGASLPGLPI  283



>ref|XP_004144362.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=297

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M  A  GGSI+NISSISGLNR    G LAY TSK A+N LT+VMA+EL
Sbjct  152  GQWLVSKYVCILMNKANRGGSIINISSISGLNRALQRGALAYITSKAALNTLTKVMAMEL  211

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI PGLFKSEIT  LM+KDW+  VA R +PLRTFGTSNPALT+ VRYL+H+S
Sbjct  212  GAHKIRVNSICPGLFKSEITKDLMKKDWIKNVAKRMIPLRTFGTSNPALTTTVRYLVHES  271

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGN +IVDAGN+L GVPI
Sbjct  272  SKYVSGNIFIVDAGNSLLGVPI  293



>ref|XP_009607267.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=285

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV   M  AK GGSI+NISSISGLNR  + GG+AY++SK A++++T++MALEL
Sbjct  140  GSWLVSKYVGRHMKAAKRGGSIINISSISGLNRALMRGGIAYSSSKAAMDSMTKIMALEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVN+I+PGLFKSEIT+ L+++DWL  VA RTVPL+TFGT++PALTSLVRYL+HDS
Sbjct  200  GEHNIRVNAIAPGLFKSEITEKLVEQDWLKNVATRTVPLKTFGTTDPALTSLVRYLVHDS  259

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVDAG TLPG+PI
Sbjct  260  SNYVSGNIFIVDAGYTLPGLPI  281



>ref|XP_010504384.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
 ref|XP_010504385.1| PREDICTED: probable L-xylulose reductase isoform X1 [Camelina 
sativa]
Length=281

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVCL M +AK GGS++NISSI+GL+RG LPGGLA   SK  V+ ++R+M LEL
Sbjct  136  GPWLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLLPGGLACACSKGGVDTMSRMMTLEL  195

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHDS
Sbjct  196  GVHKIRVNSIAPGLFKSEITESLLQKEWMKNVTGRVVPLKVQQTVDPGLTSLVRYLIHDS  255

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGNTYIVD+GNTLPGVPI
Sbjct  256  SQYVSGNTYIVDSGNTLPGVPI  277



>ref|XP_010504386.1| PREDICTED: probable L-xylulose reductase isoform X2 [Camelina 
sativa]
Length=280

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVCL M +AK GGS++NISSI+GL+RG LPGGLA   SK  V+ ++R+M LEL
Sbjct  135  GPWLVSKYVCLMMRDAKRGGSVINISSIAGLHRGLLPGGLACACSKGGVDTMSRMMTLEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT+ L+QK+W+  V  R VPL+   T +P LTSLVRYLIHDS
Sbjct  195  GVHKIRVNSIAPGLFKSEITESLLQKEWMKNVTGRVVPLKVQQTVDPGLTSLVRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGNTYIVD+GNTLPGVPI
Sbjct  255  SQYVSGNTYIVDSGNTLPGVPI  276



>emb|CDP06198.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYV   M  A   G IVN+SS+SGLNR QL G +AY++SK  ++++TR+MALEL
Sbjct  143  GAWLVSKYVGRHMREACRCGCIVNVSSVSGLNRAQLRGAVAYSSSKAGMDSMTRIMALEL  202

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPGLF SE+T+GL++K W+N VA RTVPLRTFGTS+PALTSLVR+LIHDS
Sbjct  203  GEYKIRVNSISPGLFSSELTEGLVKKPWINNVAERTVPLRTFGTSDPALTSLVRFLIHDS  262

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVDAG +LPGVPI
Sbjct  263  SSYVSGNHFIVDAGYSLPGVPI  284



>ref|XP_009112627.1| PREDICTED: probable L-xylulose reductase [Brassica rapa]
Length=287

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M +AK GGS++NISS++G++RG LPG +AY  SK  V+ +TR+MA+EL
Sbjct  142  GPWLVSKYVCILMRDAKQGGSVINISSMAGVHRGMLPGAVAYACSKGGVDIMTRMMAIEL  201

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PGLFKSEIT GLMQK+WL KV  RTVPL+   T +P +TSLVRYLIHDS
Sbjct  202  GVYKIRVNSIAPGLFKSEITQGLMQKEWLKKVNERTVPLKMQQTVDPGVTSLVRYLIHDS  261

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            +EY+SGNTYIVD+G +LPG+PI
Sbjct  262  AEYVSGNTYIVDSGASLPGLPI  283



>ref|XP_009391879.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK+VC+RM +A   G+++NISSI+G+ RGQLPG LAYT SKT VN++T VMALE+
Sbjct  130  GLWLVSKHVCIRMRDATQKGAVINISSIAGVARGQLPGSLAYTASKTGVNSITWVMALEM  189

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IR NS+ PG+FKSEIT+ LM+K+W+ KVA RTVPL TFGT+NP++ SL+RYL+ D+
Sbjct  190  GRYGIRTNSVCPGIFKSEITERLMEKEWIGKVARRTVPLGTFGTANPSVISLIRYLVDDA  249

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVDAG TLPGVP+
Sbjct  250  SEYVNGNVFIVDAGATLPGVPL  271



>ref|XP_002884088.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60347.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=278

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC+ M +AK GGS+++I S+SGL+RGQ+PGG+AY  SK  V+ +TR+MA+ L
Sbjct  133  GTWLVSKYVCILMRDAKRGGSVISILSVSGLHRGQVPGGVAYACSKGGVDTMTRMMAVGL  192

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PGL KSEIT GLMQK+WL  V  R VPL+     +P LTSLVRYLIHDS
Sbjct  193  GVYKIRVNSIAPGLLKSEITQGLMQKEWLKNVNERIVPLKVQQAVDPGLTSLVRYLIHDS  252

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+YISGNTYIVD+G++LPGVPI
Sbjct  253  SQYISGNTYIVDSGSSLPGVPI  274



>emb|CDY03343.1| BnaC09g10050D [Brassica napus]
Length=280

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M +AK GGS++NISS++G++RG LPG +AY  SK  V+ +TR+MA+EL
Sbjct  135  GPWLVSKYVCILMRDAKQGGSVINISSMAGVHRGMLPGAVAYACSKGGVDIMTRMMAIEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PGLFKSEIT GLMQK+WL KV  RTVPL+   + +P LTSLVRYLIHDS
Sbjct  195  GVYKIRVNSIAPGLFKSEITQGLMQKEWLKKVNERTVPLKMQQSVDPGLTSLVRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGNTYIVD+G +LPG+PI
Sbjct  255  SQYVSGNTYIVDSGASLPGLPI  276



>ref|XP_006403473.1| hypothetical protein EUTSA_v10010610mg [Eutrema salsugineum]
 gb|ESQ44926.1| hypothetical protein EUTSA_v10010610mg [Eutrema salsugineum]
Length=281

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVCL M +A  GGS++NISSISGL+RG+ PGG+AY  SK  V+ +TR+MA+EL
Sbjct  136  GPWLVSKYVCLLMKDANIGGSVINISSISGLHRGKKPGGVAYACSKGGVDTMTRMMAIEL  195

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PGLF+SEIT GL++K+WL KV  RTVPL    T +P L+SLVRYLIHDS
Sbjct  196  GVYKIRVNSIAPGLFRSEITQGLLEKEWLKKVTDRTVPLTVEQTVDPGLSSLVRYLIHDS  255

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGNTYIVD+G TLPGVPI
Sbjct  256  SQYVSGNTYIVDSGATLPGVPI  277



>gb|KFK34763.1| hypothetical protein AALP_AA5G190600 [Arabis alpina]
Length=282

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M +AK GGS++N+SSI+GL+RG LPGGLAY TSK  V+ +TR+MA+EL
Sbjct  137  GPWLVSKYVCILMRDAKRGGSVINVSSIAGLHRGMLPGGLAYATSKGGVDTMTRMMAIEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIR+N+I+PGLFKSEIT GLMQK+WL  V  + VPL+   T +P LTSLVRYLIHDS
Sbjct  197  GAYKIRLNTIAPGLFKSEITQGLMQKEWLKHVNEKIVPLKEEQTVDPGLTSLVRYLIHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGNTYIVD+G TL G+PI
Sbjct  257  SQYVSGNTYIVDSGTTLSGLPI  278



>gb|KFK34764.1| hypothetical protein AALP_AA5G190600 [Arabis alpina]
Length=281

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M +AK GGS++N+SSI+GL+RG LPGGLAY TSK  V+ +TR+MA+EL
Sbjct  136  GPWLVSKYVCILMRDAKRGGSVINVSSIAGLHRGMLPGGLAYATSKGGVDTMTRMMAIEL  195

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIR+N+I+PGLFKSEIT GLMQK+WL  V  + VPL+   T +P LTSLVRYLIHDS
Sbjct  196  GAYKIRLNTIAPGLFKSEITQGLMQKEWLKHVNEKIVPLKEEQTVDPGLTSLVRYLIHDS  255

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGNTYIVD+G TL G+PI
Sbjct  256  SQYVSGNTYIVDSGTTLSGLPI  277



>emb|CDP06199.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYV   M  A  GG IVN+SSISGLNR Q+ G +AY++SK  ++++TR+MALEL
Sbjct  143  GAWLVSKYVGRHMREAGRGGCIVNVSSISGLNRAQMRGSVAYSSSKAGMDSMTRIMALEL  202

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  K+RVNSISPGLF+S+IT+ L++K W+N VA RTVPLRTFGTS+PALTSLVR+LIHDS
Sbjct  203  GEYKVRVNSISPGLFRSQITEELVKKRWINNVAERTVPLRTFGTSDPALTSLVRFLIHDS  262

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVDAG TLPGVPI
Sbjct  263  SSYVSGNHFIVDAGYTLPGVPI  284



>ref|XP_009778773.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana sylvestris]
Length=285

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV   M  AK GGSI+NISSI GLNR  + GG+AY++SK AV+ +T+VMA EL
Sbjct  140  GSWLVSKYVGKHMQAAKRGGSIINISSIGGLNRISMRGGIAYSSSKAAVDTMTKVMAYEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVN+I+PG+FKSEIT+ L+QKDWL  VA R+VPL+TFGT+NP LTSLVRYL+HDS
Sbjct  200  GEHNIRVNAIAPGIFKSEITEKLLQKDWLKNVATRSVPLKTFGTTNPGLTSLVRYLVHDS  259

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVD+G TLPG+PI
Sbjct  260  SNYVSGNIFIVDSGYTLPGIPI  281



>ref|XP_006361353.1| PREDICTED: probable L-xylulose reductase-like, partial [Solanum 
tuberosum]
Length=276

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC RM +AK  GGS++NISS++GLNRG   G LAY TSK A++ LT++MA+E
Sbjct  130  GAWLVSKYVCRRMRDAKQGGGSVINISSLAGLNRGVFTGSLAYATSKMALDMLTKIMAVE  189

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSI+PG FKSEIT  LMQK W +    RTVPLRT GT +PALTS+VRYLIHD
Sbjct  190  LGVDKIRVNSIAPGYFKSEITGSLMQKKWFDNYTRRTVPLRTLGTIDPALTSMVRYLIHD  249

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN +IVDAG +LPGVPI
Sbjct  250  SSKYVSGNVFIVDAGTSLPGVPI  272



>ref|XP_011079072.1| PREDICTED: estradiol 17-beta-dehydrogenase 8-like isoform X1 
[Sesamum indicum]
Length=299

 Score =   181 bits (460),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC RM  A+ GGS++NISS +GLNRGQLPG L Y  SK AVN +T+ MALEL
Sbjct  142  GTWLVSKYVCSRMRYAQQGGSVINISSTAGLNRGQLPGSLVYAASKAAVNTITKGMALEL  201

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSISPG+FKSEIT GL+QKDWL  VA +T+PLRT GT++PALTSLVRYL+HD 
Sbjct  202  GMYKIRVNSISPGIFKSEITQGLLQKDWLKTVAFKTIPLRTHGTTDPALTSLVRYLVHDC  261

Query  339  SEYISGNTYIVDAGN  295
            SEY++GN +IV+A +
Sbjct  262  SEYVTGNVFIVEADD  276



>ref|XP_004249129.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum lycopersicum]
Length=291

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV  +M  +K GGSI+NISSISGLNR  + GG+AY++SK A++++T++MALEL
Sbjct  146  GSWLVSKYVGRQMQASKKGGSIINISSISGLNRALMRGGIAYSSSKAAMDSMTKIMALEL  205

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVN+I+PGLFKSEIT+ L++KDW+  VA R++PL+TFGT++PALTSL+RYL+HDS
Sbjct  206  GEHNIRVNAIAPGLFKSEITENLVKKDWIQNVAKRSIPLKTFGTTDPALTSLLRYLVHDS  265

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVDAG TLPGVPI
Sbjct  266  SNYVSGNIFIVDAGYTLPGVPI  287



>ref|XP_009773767.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana sylvestris]
Length=285

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV  RM  AK GGSI+NISSISGLNR    GG+AY++SK A++++T++MALEL
Sbjct  140  GSWLVSKYVGRRMKAAKRGGSIINISSISGLNRVLTRGGIAYSSSKAAMDSMTKIMALEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVN+I+PG+FKSEIT+ L+++DWL  VA RT+PL+TFGT++PALTSLVRYL+HDS
Sbjct  200  GEGNIRVNAIAPGIFKSEITEKLVEQDWLKNVATRTIPLKTFGTTDPALTSLVRYLVHDS  259

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVDAG TLPG PI
Sbjct  260  SNYVSGNIFIVDAGYTLPGFPI  281



>gb|KEH41456.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=281

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYVC R+C+A   GSI+NISS SGLNRG L G +AY +SK  +N LT+VMALEL
Sbjct  136  GSWLVSKYVCKRICDAHRKGSIINISSTSGLNRGNLSGAVAYASSKAGLNMLTKVMALEL  195

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSISPG+FKSEIT+ L++K WLN V  +  PLR+   S+P LTSL RYLIHD+
Sbjct  196  GAHKIRVNSISPGIFKSEITEKLVEKAWLNNVITKINPLRSLVASDPGLTSLARYLIHDA  255

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            SEY++GN +IVD G TLPGVPI
Sbjct  256  SEYVTGNNFIVDCGVTLPGVPI  277



>ref|XP_010112832.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
 gb|EXC34955.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
Length=488

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK+VC RM +A  GGS++NISSI+G+NRG LPGG AY +SK  +N LT+VMA+EL
Sbjct  153  GTWLVSKFVCKRMRDAGRGGSVINISSIAGVNRGHLPGGAAYASSKAGLNTLTKVMAIEL  212

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVN ISPGLFKSEIT+ LMQK WL+ VA RTVPL+  GTS+PALTSLVRYLIHDS
Sbjct  213  GEYKIRVNVISPGLFKSEITENLMQKAWLSNVAARTVPLKEHGTSDPALTSLVRYLIHDS  272

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVDAG TL G  +
Sbjct  273  SAYVSGNAFIVDAGVTLSGFEV  294


 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK+VC RM +A  GGS++NISSI+G+NRG LPGG AY +SK  +  LT+VMA+EL
Sbjct  322  GTWLVSKFVCKRMRDAGRGGSVINISSIAGVNRGHLPGGAAYASSKAGLKTLTKVMAIEL  381

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVN ISPGLFKSEIT+ LMQK WL+ VA RTVPL+  GTS+PALTSLVRYLIHDS
Sbjct  382  GEYKIRVNVISPGLFKSEITENLMQKAWLSNVAARTVPLKEHGTSDPALTSLVRYLIHDS  441

Query  339  SEYISGNTYIVDAGNTLPG  283
            S Y+SGN +IVDAG TL G
Sbjct  442  SAYVSGNAFIVDAGVTLSG  460



>ref|XP_009593495.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=285

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV   M  AK GGSI+NISSI G+NR  + GG+AY++SK AV+ +T+VMA EL
Sbjct  140  GSWLVSKYVGKHMQAAKRGGSIINISSIGGINRISMRGGIAYSSSKAAVDTMTKVMAYEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVN+I+PG+FKSEIT+ L+QKDWL  VA R+VPL+TFGT+NPALTSLVRYL+HDS
Sbjct  200  GEHNIRVNAIAPGIFKSEITEKLLQKDWLKNVATRSVPLKTFGTTNPALTSLVRYLVHDS  259

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVD+G TLPG+PI
Sbjct  260  SNYVSGNIFIVDSGYTLPGIPI  281



>ref|XP_010265875.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nelumbo nucifera]
Length=290

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+KYV   M      GSIVNI+SI+G  RGQLPGG  YT SK  +NAL +V A+EL
Sbjct  145  GSWLVTKYVGREMSKHNLKGSIVNITSIAGTERGQLPGGCPYTASKAGLNALAKVSAVEL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN+I+PG+FKSEIT+ LMQK WL  V  +TVPL TFGTS+PALTSLVRYLIHDS
Sbjct  205  GVHKIRVNAIAPGIFKSEITEKLMQKQWLTNVMKKTVPLGTFGTSDPALTSLVRYLIHDS  264

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVDAG TLPGVPI
Sbjct  265  SGYVSGNVFIVDAGATLPGVPI  286



>ref|XP_009371244.1| PREDICTED: LOW QUALITY PROTEIN: estradiol 17-beta-dehydrogenase 
8-like [Pyrus x bretschneideri]
Length=295

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSK+V +RM +A  GGSIV ISS++G+N G LPG  AY  SK  VN LT+ MA+EL
Sbjct  151  GSWLVSKFVAIRMRDADQGGSIVKISSVAGINGGYLPGATAYNCSKAGVNTLTKTMAMEL  210

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVN+ SPGLF+SEIT+GLMQK+WL+ VA++TVPLRTFGTS+ ALTSLVRYL+HDS
Sbjct  211  GVHKIRVNATSPGLFRSEITEGLMQKEWLHNVAMKTVPLRTFGTSDTALTSLVRYLLHDS  270

Query  339  SEYISGNTYIVDAGNTL  289
            SEY+SGN YI DAG TL
Sbjct  271  SEYMSGNIYIADAGTTL  287



>ref|NP_176449.2| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AEE33983.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=277

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WL+SKYVCL M +AK GGS++N+SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL
Sbjct  132  GSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIEL  191

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
               KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDS
Sbjct  192  AVYKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDS  251

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  252  SQYVTGNTYIVDSGATLPGVPI  273



>ref|NP_001031220.1| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AAV74220.1| At1g62610 [Arabidopsis thaliana]
 gb|AAW78588.1| At1g62610 [Arabidopsis thaliana]
 gb|AEE33985.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=278

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WL+SKYVCL M +AK GGS++N+SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL
Sbjct  133  GSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIEL  192

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
               KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDS
Sbjct  193  AVYKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDS  252

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  253  SQYVTGNTYIVDSGATLPGVPI  274



>ref|XP_009763303.1| PREDICTED: probable L-xylulose reductase isoform X2 [Nicotiana 
sylvestris]
Length=259

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFgg-sivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC RM +AK  G S++NISS + LNR  LPG LAY +SKTA++ +T++MALE
Sbjct  113  GAWLVSKYVCRRMHDAKQSGGSVINISSAAALNRAPLPGSLAYASSKTALDMITKIMALE  172

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIR+NSI+PG++KSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRYLIHD
Sbjct  173  LGVDKIRLNSIAPGVYKSEITEMLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYLIHD  232

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SSEY+SGN +IVDAG TL GVPI
Sbjct  233  SSEYVSGNVFIVDAGTTLVGVPI  255



>ref|NP_974072.1| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AEE33984.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=276

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WL+SKYVCL M +AK GGS++N+SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL
Sbjct  131  GSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIEL  190

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
               KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDS
Sbjct  191  AVYKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDS  250

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  251  SQYVTGNTYIVDSGATLPGVPI  272



>ref|NP_001185294.1| putative ketoacyl-ACP reductase [Arabidopsis thaliana]
 gb|AEE33986.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=282

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WL+SKYVCL M +AK GGS++N+SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL
Sbjct  137  GSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
               KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDS
Sbjct  197  AVYKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  257  SQYVTGNTYIVDSGATLPGVPI  278



>ref|NP_565425.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEC06694.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=312

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            GTWLVSKYVC+ M +AK GG  V   S    L+RGQ+PGG+AY  SK  V+ +TR+MALE
Sbjct  166  GTWLVSKYVCILMRDAKRGGGSVINISSVSWLHRGQVPGGVAYACSKGGVDTMTRMMALE  225

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG  KIRVNSI+PGL KSEIT GLMQK+WL  V  RTVPL+   T +P LTSL+RYL+HD
Sbjct  226  LGVYKIRVNSIAPGLLKSEITQGLMQKEWLKTVIERTVPLKVQQTVDPGLTSLLRYLVHD  285

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+YISGNTYIVDAG +L G+PI
Sbjct  286  SSKYISGNTYIVDAGASLVGLPI  308



>emb|CDP21456.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYV  +M  A  GG IVN+SSISGLNR Q+ G +AY++SK  ++++TR+MALEL
Sbjct  143  GAWLVSKYVGRQMREACTGGCIVNVSSISGLNRAQMRGSVAYSSSKAGMDSMTRIMALEL  202

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  K+RVNSISPGLF+S+IT+ L++K W+N VA RTVPLR FGT++PALTSLVR+LIHDS
Sbjct  203  GEYKVRVNSISPGLFRSQITEELVKKRWINNVAERTVPLRAFGTTDPALTSLVRFLIHDS  262

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVDAG TLPGVPI
Sbjct  263  SSYVSGNHFIVDAGYTLPGVPI  284



>ref|XP_009763295.1| PREDICTED: probable L-xylulose reductase isoform X1 [Nicotiana 
sylvestris]
Length=269

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFgg-sivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC RM +AK  G S++NISS + LNR  LPG LAY +SKTA++ +T++MALE
Sbjct  123  GAWLVSKYVCRRMHDAKQSGGSVINISSAAALNRAPLPGSLAYASSKTALDMITKIMALE  182

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIR+NSI+PG++KSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRYLIHD
Sbjct  183  LGVDKIRLNSIAPGVYKSEITEMLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYLIHD  242

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SSEY+SGN +IVDAG TL GVPI
Sbjct  243  SSEYVSGNVFIVDAGTTLVGVPI  265



>ref|NP_190203.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 emb|CAB90944.1| dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AAY78761.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
thaliana]
 gb|AEE78124.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=288

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M +AK GGS++NISSI+G+ RG LPG LAY  SK  V+ ++++MA+EL
Sbjct  144  GPWLVSKYVCVLMRDAKLGGSVINISSIAGI-RGILPGALAYACSKIGVDTMSKMMAVEL  202

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PG+FKSEIT GLMQK+W   V  RTVPL+   T +P +TSLVRYLIHDS
Sbjct  203  GVHKIRVNSIAPGIFKSEITQGLMQKEWFKNVTERTVPLKLQQTVDPGITSLVRYLIHDS  262

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+YISGNTYIVD+G TLPGVPI
Sbjct  263  SQYISGNTYIVDSGATLPGVPI  284



>ref|NP_176527.4| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE34092.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=282

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WL+SKYVCL M +A+ GGS++N+SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL
Sbjct  135  GSWLISKYVCLLMRDAERGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
               KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDS
Sbjct  195  AVYKIRVNSIAPGIFRSEITQGLFQKEWLKKVTEKVVPLKMQQTVDPGLTSLVRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  255  SQYVTGNTYIVDSGTTLPGVPI  276



>gb|AAF19703.1|AC008047_10 F2K11.24 [Arabidopsis thaliana]
Length=287

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WL+SKYVCL M +A+ GGS++N+SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL
Sbjct  140  GSWLISKYVCLLMRDAERGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
               KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDS
Sbjct  200  AVYKIRVNSIAPGIFRSEITQGLFQKEWLKKVTEKVVPLKMQQTVDPGLTSLVRYLIHDS  259

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  260  SQYVTGNTYIVDSGTTLPGVPI  281



>gb|AAD43618.1|AC005698_17 T3P18.17 [Arabidopsis thaliana]
Length=307

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WL+SKYVCL M +AK GGS++N+SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL
Sbjct  162  GSWLISKYVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIEL  221

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
               KIRVNSI+PG+F+SEIT GL QK+WL KV  + VPL+   T +P LTSLVRYLIHDS
Sbjct  222  AVYKIRVNSIAPGIFRSEITQGLFQKEWLEKVTEKIVPLKMQQTVDPGLTSLVRYLIHDS  281

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  282  SQYVTGNTYIVDSGATLPGVPI  303



>ref|XP_009631506.1| PREDICTED: probable L-xylulose reductase isoform X1 [Nicotiana 
tomentosiformis]
Length=269

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC RM +AK  GGS++NISS + LNR  LPG LAY +SK A++ +T++MALE
Sbjct  123  GAWLVSKYVCRRMPDAKQGGGSVINISSAAALNRALLPGSLAYASSKIALDMVTKIMALE  182

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSI+PG+FKSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRYLIH+
Sbjct  183  LGVDKIRVNSIAPGVFKSEITENLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYLIHN  242

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN +IVD G TLPGVPI
Sbjct  243  SSQYVSGNVFIVDGGGTLPGVPI  265



>ref|XP_009631507.1| PREDICTED: probable L-xylulose reductase isoform X2 [Nicotiana 
tomentosiformis]
Length=259

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC RM +AK  GGS++NISS + LNR  LPG LAY +SK A++ +T++MALE
Sbjct  113  GAWLVSKYVCRRMPDAKQGGGSVINISSAAALNRALLPGSLAYASSKIALDMVTKIMALE  172

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSI+PG+FKSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRYLIH+
Sbjct  173  LGVDKIRVNSIAPGVFKSEITENLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYLIHN  232

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN +IVD G TLPGVPI
Sbjct  233  SSQYVSGNVFIVDGGGTLPGVPI  255



>ref|NP_191091.2| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAD44022.1| beta-ketoacyl-ACP reductase - like protein [Arabidopsis thaliana]
 gb|AEE79367.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=279

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+KYVC+ M +AK GGS++NISS++G+ R  +PGGLAY+ SK  V+ ++R+MA+EL
Sbjct  135  GPWLVAKYVCVLMRDAKRGGSVINISSVAGV-RSIVPGGLAYSCSKGGVDTMSRMMAIEL  193

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT  LMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  194  GVHKIRVNSIAPGLFKSEITQALMQKEWLKNVTERTVPLKVQQTIDPGLTSLVRYLIHDS  253

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+YISGNTYIVD+G TLPGVPI
Sbjct  254  SQYISGNTYIVDSGATLPGVPI  275



>ref|XP_006361361.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Solanum tuberosum]
Length=297

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC RM +AK  GGS++NISS++GLNR    G   Y +SK A++ +T+ MA+E
Sbjct  151  GAWLVSKYVCRRMRDAKQGGGSVINISSMAGLNRVVYIGTFGYASSKMALDMVTKNMAME  210

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSI+PG FKSEIT+GLMQ  W N V  RT+PLRT GT NPALTS+VRYLIHD
Sbjct  211  LGVDKIRVNSIAPGYFKSEITEGLMQNKWFNNVTRRTIPLRTSGTINPALTSVVRYLIHD  270

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SSEYISGN +IVDAG TLPGVPI
Sbjct  271  SSEYISGNVFIVDAGTTLPGVPI  293



>emb|CAB75765.1| beta-ketoacyl-ACP reductase-like protein [Arabidopsis thaliana]
Length=298

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+KYVC+ M +AK GGS++NISS++G+ R  +PGGLAY+ SK  V+ ++R+MA+EL
Sbjct  154  GPWLVAKYVCVLMRDAKRGGSVINISSVAGV-RSIVPGGLAYSCSKGGVDTMSRMMAIEL  212

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G +KIRVNSI+PGLFKSEIT  LMQK+WL  V  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  213  GVHKIRVNSIAPGLFKSEITQALMQKEWLKNVTERTVPLKVQQTIDPGLTSLVRYLIHDS  272

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+YISGNTYIVD+G TLPGVPI
Sbjct  273  SQYISGNTYIVDSGATLPGVPI  294



>ref|XP_006403474.1| hypothetical protein EUTSA_v10010605mg [Eutrema salsugineum]
 gb|ESQ44927.1| hypothetical protein EUTSA_v10010605mg [Eutrema salsugineum]
Length=285

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 2/144 (1%)
 Frame = -3

Query  699  GTWLVSKYVC--LRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMAL  526
            G WLVSKYVC  +R  N   GGS++NISSISGL+RG LPGG+AY  SK  V+ +TR+MA+
Sbjct  138  GPWLVSKYVCILMRDANNHGGGSVINISSISGLHRGMLPGGVAYACSKGGVDTMTRMMAI  197

Query  525  ELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIH  346
            ELG  KIRVNSI+PGL KSEIT GLM+K+WL  V  RT+PL+   T +P LTSLVRYLIH
Sbjct  198  ELGVYKIRVNSIAPGLLKSEITQGLMEKEWLKNVTERTIPLKVQQTVDPGLTSLVRYLIH  257

Query  345  DSSEYISGNTYIVDAGNTLPGVPI  274
            DSS+Y+SGNTYIVD+G TLPG+PI
Sbjct  258  DSSQYVSGNTYIVDSGATLPGLPI  281



>ref|XP_002886464.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62723.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=290

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSK+V + M +AK GGS++NISSISGL+RG  PG LAY  SK  V+ +TR+MA+EL
Sbjct  145  GSWLVSKFVGVLMRDAKRGGSVINISSISGLHRGLRPGCLAYACSKGGVDTMTRMMAIEL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PGLF+S+IT GLMQK+WL KV  RTVPL+   T +P LTSLVRYLIHDS
Sbjct  205  GVYKIRVNSIAPGLFRSDITQGLMQKEWLKKVTERTVPLKMQQTVDPGLTSLVRYLIHDS  264

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y++GNTYIVD+G TLPGVPI
Sbjct  265  SQYVTGNTYIVDSGATLPGVPI  286



>ref|XP_004252844.1| PREDICTED: probable L-xylulose reductase [Solanum lycopersicum]
Length=270

 Score =   175 bits (444),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFgg--sivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMAL  526
            G WL+SKYVC RM +AK  G  S++NISS+SGLNR  +PGGLAY  SK A++ LTR+MAL
Sbjct  123  GAWLLSKYVCRRMRDAKLQGGGSVINISSVSGLNRVLVPGGLAYACSKMALDMLTRMMAL  182

Query  525  ELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIH  346
            ELG + IRVNS++PG+FKS+IT+ LMQK+  N V L+TVPLR  G ++PALTSLV+YLIH
Sbjct  183  ELGVHNIRVNSVAPGVFKSQITESLMQKEGFNNVILQTVPLRYLGMTDPALTSLVKYLIH  242

Query  345  DSSEYISGNTYIVDAGNTLPGVPI  274
            DSSEY+SGN +IVD+G TL GVPI
Sbjct  243  DSSEYVSGNIFIVDSGGTLTGVPI  266



>ref|XP_009139179.1| PREDICTED: probable L-xylulose reductase isoform X3 [Brassica 
rapa]
Length=279

 Score =   175 bits (444),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M +AK GGS++N+SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+EL
Sbjct  134  GPWLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIEL  193

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDS
Sbjct  194  GVYNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDS  253

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGNTYI+D+G T+PG+PI
Sbjct  254  SRYVSGNTYILDSGATIPGLPI  275



>ref|XP_009139180.1| PREDICTED: probable L-xylulose reductase isoform X4 [Brassica 
rapa]
Length=275

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M +AK GGS++N+SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+EL
Sbjct  130  GPWLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIEL  189

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDS
Sbjct  190  GVYNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDS  249

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGNTYI+D+G T+PG+PI
Sbjct  250  SRYVSGNTYILDSGATIPGLPI  271



>emb|CDX76107.1| BnaA04g03710D [Brassica napus]
Length=280

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M +AK GGS++N+SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+EL
Sbjct  135  GPWLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDS
Sbjct  195  GVYNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGNTYI+D+G T+PG+PI
Sbjct  255  SRYVSGNTYILDSGATIPGLPI  276



>ref|XP_009139176.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=283

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M +AK GGS++N+SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+EL
Sbjct  138  GPWLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIEL  197

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDS
Sbjct  198  GVYNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDS  257

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGNTYI+D+G T+PG+PI
Sbjct  258  SRYVSGNTYILDSGATIPGLPI  279



>ref|XP_009139177.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=282

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M +AK GGS++N+SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+EL
Sbjct  137  GPWLVSKYVCSLMRDAKRGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDS
Sbjct  197  GVYNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGNTYI+D+G T+PG+PI
Sbjct  257  SRYVSGNTYILDSGATIPGLPI  278



>emb|CDY65313.1| BnaCnng46610D [Brassica napus]
Length=282

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M +AK GGS++N+SSI+GL+RG LPGG+AY  SK  V+ +TR+MA+EL
Sbjct  137  GPWLVSKYVCSLMRDAKGGGSVINVSSIAGLHRGLLPGGVAYACSKGGVDTMTRMMAIEL  196

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGL KSEIT GLMQK+WL  V  R++PL+   T +P LTSLVRYLIHDS
Sbjct  197  GVYNIRVNSIAPGLLKSEITQGLMQKEWLKNVTERSIPLKVQQTVDPGLTSLVRYLIHDS  256

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGNTYI+D+G T+PG+PI
Sbjct  257  SRYVSGNTYILDSGATIPGLPI  278



>ref|NP_001152499.1| LOC100286139 [Zea mays]
 gb|ACG47903.1| 3-oxoacyl-reductase [Zea mays]
Length=280

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG LPG   Y +SK AV+  T++MALEL
Sbjct  135  GSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G ++IRVNSI+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++
Sbjct  195  GADRIRVNSIAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEA  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +IVD+G T+PGVPI
Sbjct  255  SSYVTGNIFIVDSGATIPGVPI  276



>ref|XP_009139357.1| PREDICTED: probable L-xylulose reductase [Brassica rapa]
Length=280

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M +AK GGS++NISSI+GL+RG LPGG+AY+ SK+ V+ +T++MA+EL
Sbjct  135  GAWLVSKYVCSLMRDAKSGGSVINISSIAGLHRGMLPGGVAYSCSKSGVDIMTKMMAIEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PG+ KSEIT GL+QK+WL KV  RT PL+   T +P +TSLVRYLIHDS
Sbjct  195  GVYNIRVNSIAPGILKSEITQGLLQKEWLKKVTERTTPLKVQQTVDPGITSLVRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN YI+D+G T+PG+PI
Sbjct  255  SRYVSGNIYILDSGGTIPGLPI  276



>tpg|DAA47976.1| TPA: 3-oxoacyl-reductase [Zea mays]
Length=280

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG LPG   Y +SK AV+  T++MALEL
Sbjct  135  GSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G ++IRVNSI+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++
Sbjct  195  GADRIRVNSIAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEA  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +IVD+G T+PGVPI
Sbjct  255  SSYVTGNIFIVDSGATIPGVPI  276



>ref|XP_009594209.1| PREDICTED: probable L-xylulose reductase [Nicotiana tomentosiformis]
Length=269

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSK+VC RM +AK  GGS++NISS + LNR  LPG LAY +SK A++ +T++MALE
Sbjct  123  GAWLVSKHVCRRMRDAKQGGGSVINISSAAALNRALLPGSLAYASSKIALDMVTKIMALE  182

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSI+PG+FKSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRYLIH+
Sbjct  183  LGVDKIRVNSIAPGVFKSEITENLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYLIHN  242

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SG+ +IVD G TLPGVPI
Sbjct  243  SSQYVSGSVFIVDGGGTLPGVPI  265



>ref|XP_006362944.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=275

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSK+VC  M +AK  GGSI+N+SSI+GLNR  +PGGLAY +SK A++ LT +MALE
Sbjct  129  GAWLVSKFVCRHMIDAKQGGGSIINVSSIAGLNRVLVPGGLAYASSKMALDRLTEMMALE  188

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSI+PG+FKSE+T+ L+Q+ W + V  RT PLRT GT++PALTSLVRYLIH 
Sbjct  189  LGVHKIRVNSIAPGIFKSEMTESLIQQKWFHGVISRTTPLRTIGTTDPALTSLVRYLIHA  248

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            +SEY+SGN +IVD+G TL GVPI
Sbjct  249  ASEYVSGNVFIVDSGATLIGVPI  271



>ref|XP_006365797.1| PREDICTED: probable L-xylulose reductase-like [Solanum tuberosum]
Length=270

 Score =   172 bits (437),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC  M +AK  GGS++NI+SI+ LNR   PG LAY +SK A++ +T++MALE
Sbjct  124  GAWLVSKYVCRHMRDAKQGGGSVINITSIAALNRVITPGTLAYASSKMALDMVTKIMALE  183

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSISPG+FKSEIT+ L Q+ WL+K   +T+P R  GT++PALTS++RYLIHD
Sbjct  184  LGVDKIRVNSISPGIFKSEITESLFQQKWLHKFLYKTLPQRYIGTTDPALTSVIRYLIHD  243

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SSEY++GN +IVD G TLPGVPI
Sbjct  244  SSEYVTGNIFIVDGGGTLPGVPI  266



>ref|XP_006850022.1| hypothetical protein AMTR_s00022p00187970 [Amborella trichopoda]
 gb|ERN11603.1| hypothetical protein AMTR_s00022p00187970 [Amborella trichopoda]
Length=289

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLV++ VC RMC+A   GS++NISSI GL RG LPGG+AY  SK  V+ +T+VMALEL
Sbjct  144  GTWLVARSVCRRMCDANQKGSVINISSIGGLPRGLLPGGIAYAISKAGVDVMTKVMALEL  203

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGLFKS+IT  L+QKDW++KVA R +PLRT GT +PALTSL+ +LI DS
Sbjct  204  GKYNIRVNSIAPGLFKSDITARLVQKDWIDKVAERIIPLRTHGTIDPALTSLLDHLIDDS  263

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S +++GN +IVD G TLPGVP+
Sbjct  264  SGFVTGNVFIVDCGATLPGVPL  285



>ref|XP_008455802.1| PREDICTED: probable L-xylulose reductase [Cucumis melo]
Length=294

 Score =   173 bits (439),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC+ M  A  GGSI+NISSISGL+R    G LAY TSK A+N LT+VMA+EL
Sbjct  149  GQWLVSKYVCILMNKANRGGSIINISSISGLDRALQRGALAYITSKAALNTLTKVMAMEL  208

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVN I PGLFKSEIT  LM+KDW+  VA R  PL TFGTSNPALT+ +RYL+HDS
Sbjct  209  GEHNIRVNCICPGLFKSEITKDLMEKDWIKNVARRMNPLGTFGTSNPALTTTIRYLVHDS  268

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+Y+SGN +IVD+GN+L GVPI
Sbjct  269  SKYVSGNIFIVDSGNSLLGVPI  290



>ref|XP_004172089.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 1 [Cucumis sativus]
Length=314

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 116/170 (68%), Gaps = 28/170 (16%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTR------  538
            G+WLVSKYVC+ M +    GS++NISSI GLNRG +PGG  Y  SK  +N LT+      
Sbjct  141  GSWLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHIPGGSVYGASKAGLNTLTKSGKAYA  200

Query  537  ----------------------VMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKV  424
                                  +MALELG   IRVNSI PG+FKSEIT  LMQKDWL  V
Sbjct  201  RFYVATKGEFILYARNKCLVKEIMALELGAYNIRVNSICPGIFKSEITKVLMQKDWLKNV  260

Query  423  ALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPI  274
            AL+TVPL+T+GTSNPALT+L+RYL+HDSS Y++GN +IVDAG TLPGVPI
Sbjct  261  ALKTVPLQTYGTSNPALTTLIRYLVHDSSRYVTGNIFIVDAGATLPGVPI  310



>gb|KGN54695.1| hypothetical protein Csa_4G429290 [Cucumis sativus]
Length=134

 Score =   168 bits (425),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -3

Query  609  LNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLN  430
            LNR    G LAY TSK A+N LT+VMA+ELG +KIRVNSI PGLFKSEIT  LM+KDW+ 
Sbjct  19   LNRALQRGALAYITSKAALNTLTKVMAMELGAHKIRVNSICPGLFKSEITKDLMEKDWIK  78

Query  429  KVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPI  274
             VA R +PLRTFGTSNPALT+ VRYL+H+SS+Y+SGN +IVDAGN+L GVPI
Sbjct  79   NVAKRMIPLRTFGTSNPALTTTVRYLVHESSKYVSGNIFIVDAGNSLLGVPI  130



>ref|XP_011079074.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Sesamum indicum]
Length=291

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNA-KFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G+W V+K V  RM  A   GGSI+NISS+SGLNR Q   G+AY++SK  ++A+T++MAL+
Sbjct  145  GSWFVAKSVARRMREAGNRGGSIINISSVSGLNRTQYRDGIAYSSSKAGLDAMTKIMALD  204

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG  KIRVNSI+PGLFKSEIT+GL+QK+WL  VA RTVPL TFGTS+P LTSLVRYL+HD
Sbjct  205  LGEFKIRVNSIAPGLFKSEITEGLVQKNWLKNVAKRTVPLGTFGTSDPGLTSLVRYLVHD  264

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS YISGN +IVD+G +LPGVPI
Sbjct  265  SSSYISGNIFIVDSGYSLPGVPI  287



>ref|XP_004248275.1| PREDICTED: carbonyl reductase [NADPH] 2-like [Solanum lycopersicum]
Length=276

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC  M + K  GGSI+N+SS++GLNR  +PGG+AY +SK A++ LT +MALE
Sbjct  130  GAWLVSKYVCRHMIDVKQGGGSIINVSSVAGLNRVLVPGGVAYASSKMALDKLTEMMALE  189

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSI+PG+FKSE+T+ L+Q+ W + V  RT PLRT GT++PALTSLVRYLIH 
Sbjct  190  LGVHKIRVNSIAPGIFKSEMTESLIQQKWFHGVISRTAPLRTIGTTDPALTSLVRYLIHA  249

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SSEY+SGN +IVD+G TL GVPI
Sbjct  250  SSEYVSGNVFIVDSGATLIGVPI  272



>gb|EAZ43296.1| hypothetical protein OsJ_27892 [Oryza sativa Japonica Group]
Length=274

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC RM +AK  GS++NISS+SGLNRG LPG   Y  SK+A++  T++MALEL
Sbjct  129  GSWLVAKHVCRRMRDAKLKGSVINISSVSGLNRGHLPGSTGYAASKSAMHYATKLMALEL  188

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PG+FKSEIT  L+QK WL+ V  + VPL+T GT++PALTSLVR+LIH++
Sbjct  189  GAYGIRVNSIAPGIFKSEITAPLLQKKWLSTVVSKIVPLKTHGTTDPALTSLVRFLIHET  248

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +IVD+G TLPGVPI
Sbjct  249  SSYVTGNIFIVDSGATLPGVPI  270



>ref|XP_004973876.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Setaria italica]
Length=277

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+K+VC RM +AK  GS++NISSI+GLNRG LPG + Y +SK+AV+  T++MALEL
Sbjct  132  GLWLVAKHVCRRMRDAKLKGSVINISSIAGLNRGHLPGSIGYASSKSAVHYATKLMALEL  191

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVN+I+PGLFKSEIT  L+QK WLN VA + VPL+  GT++PALTSLVR+LIH++
Sbjct  192  GAYGIRVNAIAPGLFKSEITAPLLQKRWLNTVASKIVPLKEHGTTDPALTSLVRFLIHEA  251

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN ++VD+G ++PGVPI
Sbjct  252  SSYVTGNIFVVDSGVSIPGVPI  273



>ref|XP_010314314.1| PREDICTED: probable L-xylulose reductase [Solanum lycopersicum]
Length=271

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G W+VSKYVC RM +AK  GGS++NI+S++GLNR  +PG +AY TSK A++ +T++MA+E
Sbjct  125  GAWMVSKYVCKRMIDAKQGGGSVINITSMAGLNRTAVPGTIAYGTSKMALDMVTKIMAIE  184

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSISPG+ KSEIT+ L++  W +K  LRT+PL+  GT++PALTSL+RYL+HD
Sbjct  185  LGGENIRVNSISPGVVKSEITEDLVKNKWFHKFLLRTLPLKYLGTTDPALTSLIRYLMHD  244

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SSEY++GN +IVDAG TLPGVPI
Sbjct  245  SSEYVTGNVFIVDAGATLPGVPI  267



>ref|NP_001062206.1| Os08g0510400 [Oryza sativa Japonica Group]
 dbj|BAC57400.1| putative alcohol dehydrogenase homolog [Oryza sativa Japonica 
Group]
 dbj|BAF24120.1| Os08g0510400 [Oryza sativa Japonica Group]
 gb|EAZ07584.1| hypothetical protein OsI_29835 [Oryza sativa Indica Group]
 dbj|BAG91409.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC RM +AK  GS++NISS+SGLNRG LPG   Y  SK+A++  T++MALEL
Sbjct  139  GSWLVAKHVCRRMRDAKLKGSVINISSVSGLNRGHLPGSTGYAASKSAMHYATKLMALEL  198

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PG+FKSEIT  L+QK WL+ V  + VPL+T GT++PALTSLVR+LIH++
Sbjct  199  GAYGIRVNSIAPGIFKSEITAPLLQKKWLSTVVSKIVPLKTHGTTDPALTSLVRFLIHET  258

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +IVD+G TLPGVPI
Sbjct  259  SSYVTGNIFIVDSGATLPGVPI  280



>ref|XP_006660269.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Oryza brachyantha]
Length=246

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSK+VC RM +AK  GS++NISS+SGLNRG LPG   Y  SK+A++ +T++MALEL
Sbjct  101  GSWLVSKHVCRRMHDAKIKGSVINISSVSGLNRGHLPGSTGYAASKSAMHYVTKLMALEL  160

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PG+F+SEIT  L+QK WL  V  + VPL+T GT++PALTSLVR+LIH +
Sbjct  161  GAYGIRVNSIAPGIFQSEITAPLLQKKWLKTVVSKIVPLKTHGTTDPALTSLVRFLIHGT  220

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +IVD+G T+PGVPI
Sbjct  221  SSYVTGNIFIVDSGATIPGVPI  242



>ref|XP_004136691.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
isoform 1 [Cucumis sativus]
Length=314

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 116/170 (68%), Gaps = 28/170 (16%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTR------  538
            G+WLVSKYVC+ M +    GS++NISSI GLNRG +PGG  Y  SK  +N LT+      
Sbjct  141  GSWLVSKYVCIHMRDTNRSGSLINISSIGGLNRGHIPGGSVYGASKAGLNTLTKSGKAYA  200

Query  537  ----------------------VMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKV  424
                                  +MALELG   IRVNSI PG+FKSEIT  LMQKDWL  V
Sbjct  201  RFYVATKGEFILYARNKCLVKEIMALELGAYNIRVNSICPGIFKSEITKVLMQKDWLKNV  260

Query  423  ALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPI  274
            AL+TVPL+T+GTS+PALT+L+RYL+HDSS Y++GN +IVDAG TLPGVPI
Sbjct  261  ALKTVPLQTYGTSDPALTTLIRYLVHDSSRYVTGNIFIVDAGATLPGVPI  310



>emb|CDY29203.1| BnaA06g25540D [Brassica napus]
Length=278

 Score =   170 bits (430),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC+ M +AK  G  V   S    L+RG +PGG+AY TSK  V+ +TRVMA+E
Sbjct  132  GAWLVSKYVCILMRDAKDRGGSVINISSISGLHRGVVPGGIAYATSKGGVDTMTRVMAIE  191

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSI+PGL +SE+T GLM+K WL  V  RT+PL+   T +P +TSLVRYLIHD
Sbjct  192  LGVYNIRVNSIAPGLLESEMTQGLMKKKWLKNVTERTIPLKVQQTVDPGITSLVRYLIHD  251

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN YI+D+G T+PG+PI
Sbjct  252  SSQYVSGNIYILDSGATVPGLPI  274



>emb|CDY07814.1| BnaC03g48080D [Brassica napus]
Length=278

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC+ M +AK  G  V   S    L+RG +PGG+AY TSK  V+ +TRVMA+E
Sbjct  132  GAWLVSKYVCILMRDAKDRGGSVINISSISGLHRGVVPGGIAYATSKGGVDTMTRVMAIE  191

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSI+PGL +SE+T GLM+K WL  V  RT+PL+   T +P +TSLVRYLIHD
Sbjct  192  LGVYNIRVNSIAPGLLESEMTQGLMKKKWLKNVTERTIPLKVQQTVDPGITSLVRYLIHD  251

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN YI+D+G T+PG+PI
Sbjct  252  SSKYVSGNIYILDSGATVPGLPI  274



>ref|XP_009124575.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
[Brassica rapa]
Length=296

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC+ M +AK  G  V   S    L+RG +PGG+AY TSK  V+ +TRVMA+E
Sbjct  150  GAWLVSKYVCILMRDAKDRGGSVINISSISGLHRGVVPGGIAYATSKGGVDTMTRVMAIE  209

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSI+PGL +SE+T GLM+K WL  V  RT+PL+   T +P +TSLVRYLIHD
Sbjct  210  LGVYNIRVNSIAPGLLESEMTQGLMKKKWLKNVTERTIPLKVQQTVDPGITSLVRYLIHD  269

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN YI+D+G T+PG+PI
Sbjct  270  SSQYVSGNIYILDSGATVPGLPI  292



>ref|XP_003574753.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Brachypodium distachyon]
Length=281

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+K++C RM  +K  GS++NISS++GLNRG LPG + YT+SK+AV+  T+++ALEL
Sbjct  136  GLWLVAKHICRRMHESKIKGSVINISSVAGLNRGHLPGSIGYTSSKSAVHYATKLLALEL  195

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PG+F+SEIT  L+QK WL  V  + VPL+T GT++PALTSLVR+LIH++
Sbjct  196  GAYGIRVNSIAPGIFQSEITAPLLQKKWLKTVVSKIVPLKTHGTTDPALTSLVRFLIHET  255

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +IVD+G TLPGVPI
Sbjct  256  SSYVTGNIFIVDSGVTLPGVPI  277



>ref|XP_009781380.1| PREDICTED: L-xylulose reductase-like [Nicotiana sylvestris]
Length=269

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFgg-sivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC  M +AK GG S++NISS++ LNR  LPG LAY +SK A++ +T++MALE
Sbjct  123  GAWLVSKYVCRCMRDAKHGGGSVINISSVAALNRTLLPGSLAYASSKAALDMVTKIMALE  182

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSI+PG+FKSEIT+ L+++   + V  +TVPL+TF T++PALTS+VRYLIHD
Sbjct  183  LGVHKIRVNSIAPGVFKSEITENLVRQKRFHNVVFKTVPLKTFVTTDPALTSVVRYLIHD  242

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN +IVD G+TL GVPI
Sbjct  243  SSQYVSGNVFIVDGGSTLTGVPI  265



>ref|XP_002444769.1| hypothetical protein SORBIDRAFT_07g027700 [Sorghum bicolor]
 gb|EES14264.1| hypothetical protein SORBIDRAFT_07g027700 [Sorghum bicolor]
Length=279

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG LPG   Y +SK AV+  T++MALEL
Sbjct  134  GSWLVAKHVCRRMRDAKLYGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALEL  193

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGLFKSEIT  L+QK WL+ V  + VPL+  GT++PALTSLVR+LIH++
Sbjct  194  GAYGIRVNSIAPGLFKSEITAPLLQKRWLSTVTSKIVPLKEHGTTDPALTSLVRFLIHEA  253

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN ++VD+G  +PGVPI
Sbjct  254  SSYVTGNIFVVDSGAAIPGVPI  275



>gb|EMS63120.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Triticum urartu]
Length=193

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+K+VC  M +AK  GS++NISS++GLNRG LPG + Y +SK+AV+++T++MALEL
Sbjct  48   GLWLVAKHVCRHMRDAKIKGSVINISSVAGLNRGNLPGSIGYASSKSAVHSVTKIMALEL  107

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVN+I+PG+F+SEIT  L+QK WL+ V  + VPL+T GT++PALTSLVR+LIH+ 
Sbjct  108  GGYGIRVNAIAPGIFQSEITAPLLQKRWLSTVVSKIVPLKTNGTTDPALTSLVRFLIHEK  167

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            + YI+GN +IVD+G T+PGVPI
Sbjct  168  ASYITGNIFIVDSGVTVPGVPI  189



>gb|EMS50889.1| Gluconate 5-dehydrogenase [Triticum urartu]
Length=226

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC  M +AK  GS++NISS++GL+RG + G   Y +SK AV+A+T+VMALEL
Sbjct  81   GSWLVAKHVCRHMRDAKIKGSVINISSVAGLHRGDVHGSTGYASSKAAVHAVTKVMALEL  140

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PG+F+SEIT  L+QK W N V  + VPL+T+GT++PALTSLVR+LIH++
Sbjct  141  GPYGIRVNSIAPGIFQSEITAALLQKRWWNTVTSKIVPLKTYGTTDPALTSLVRFLIHET  200

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y++GN +IVDAG TLPGVP+
Sbjct  201  SLYLTGNIFIVDAGLTLPGVPL  222



>ref|XP_006362943.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=276

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 119/144 (83%), Gaps = 2/144 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALT-RVMAL  526
            G WLVSK+VC  M +AK  GGSI+N+SSI+GLNR  +PGGLAY +SK A++ LT ++MAL
Sbjct  129  GAWLVSKFVCRHMIDAKQGGGSIINVSSIAGLNRVLVPGGLAYASSKMALDRLTEQMMAL  188

Query  525  ELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIH  346
            ELG +KIRVNSI+PG+FKSE+T+ L+Q+ W + V  RT PLRT GT++PALTSLVRYLIH
Sbjct  189  ELGVHKIRVNSIAPGIFKSEMTESLIQQKWFHGVISRTTPLRTIGTTDPALTSLVRYLIH  248

Query  345  DSSEYISGNTYIVDAGNTLPGVPI  274
             +SEY+SGN +IVD+G TL GVPI
Sbjct  249  AASEYVSGNVFIVDSGATLIGVPI  272



>emb|CDY07809.1| BnaC03g48130D [Brassica napus]
Length=148

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G+WLVSKYVC+ MC+AK  GGS++NISSISGLNR    G +AY +SK+ V+ +TR MA+E
Sbjct  2    GSWLVSKYVCILMCDAKQGGGSVINISSISGLNRSLSYGAVAYASSKSGVDTMTRAMAIE  61

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSI+PGLFKSEIT  L+QK WL  V  R VPL    T +P LTSLVRYLIHD
Sbjct  62   LGVYNIRVNSIAPGLFKSEITQALIQKKWLKNVTDRIVPLTAEQTVDPGLTSLVRYLIHD  121

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+S N +IVDAG TLPG+PI
Sbjct  122  SSQYVSCNVFIVDAGATLPGLPI  144



>ref|XP_011079076.1| PREDICTED: L-rhamnose-1-dehydrogenase-like [Sesamum indicum]
Length=290

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K V  RM  A  GGSI+NISS +GLNR Q   G+AY  SK  ++A+T++MAL+L
Sbjct  145  GSWLVAKSVARRMREAGQGGSIINISSAAGLNRTQFRDGVAYGPSKAGLHAMTKIMALDL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVNSI+PG+FKSEIT+ L++K+WL  VA R+VPL TFGT++P LTSLVRYL+HDS
Sbjct  205  GEFKIRVNSIAPGIFKSEITEELVKKNWLKNVAKRSVPLGTFGTTDPGLTSLVRYLLHDS  264

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S YISGN +IVDAG +LPGVPI
Sbjct  265  SNYISGNIFIVDAGYSLPGVPI  286



>emb|CDX73333.1| BnaC05g27730D [Brassica napus]
Length=280

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M +AK GGS++N+SSI+GLNR    GG+AY  SK  V+ +TR+MA+EL
Sbjct  135  GVWLVSKYVCSLMRDAKRGGSVINVSSIAGLNRVMFFGGVAYACSKGGVDTMTRMMAIEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGL +SEIT GLMQK+WL  VA R +PL+   T +P LTSLVRYLIHDS
Sbjct  195  GVYNIRVNSIAPGLLQSEITQGLMQKEWLKNVADRIIPLKVQQTVDPGLTSLVRYLIHDS  254

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN YI+D+G TLPG+PI
Sbjct  255  SRYVSGNIYILDSGTTLPGLPI  276



>ref|XP_009599584.1| PREDICTED: probable L-xylulose reductase [Nicotiana tomentosiformis]
Length=269

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC  M +AK  GGS++NISS + LNR  LPG LAY +SK A++ +T++MALE
Sbjct  123  GAWLVSKYVCRCMPDAKQGGGSVINISSAAALNRALLPGSLAYASSKIALDMVTKIMALE  182

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSI+PG+FKSEIT+ L+ +   +    + VPLRTFGT++P LTS+VRYLIH+
Sbjct  183  LGVDKIRVNSIAPGVFKSEITENLVPQKRFHNAVFKAVPLRTFGTTDPTLTSVVRYLIHN  242

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN +IVD G TLPGVPI
Sbjct  243  SSQYVSGNVFIVDGGGTLPGVPI  265



>emb|CDY44938.1| BnaA02g04430D [Brassica napus]
Length=284

 Score =   168 bits (425),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M +AK GGS++N+SSI+GLNR    GG+AY  SK  V+ +TR+MA+EL
Sbjct  139  GVWLVSKYVCSLMRDAKRGGSVINVSSIAGLNRVMFFGGVAYACSKGGVDTMTRMMAIEL  198

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGL +SEIT GLMQK+WL  VA R +PL+   T +P LTSLVRYLIHDS
Sbjct  199  GVYNIRVNSIAPGLLQSEITQGLMQKEWLKNVADRIIPLKVQQTVDPGLTSLVRYLIHDS  258

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN YI+D+G TLPG+PI
Sbjct  259  SRYVSGNIYILDSGTTLPGLPI  280



>gb|EYU20810.1| hypothetical protein MIMGU_mgv1a011271mg [Erythranthe guttata]
Length=287

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K V  RM +A  GGSI+NISS+SGLNR Q+PG +AY++SK  ++  T VMALEL
Sbjct  142  GSWLVAKCVGKRMRDAARGGSIINISSVSGLNRMQVPGAVAYSSSKAGLHLTTMVMALEL  201

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVN+I+PGLFKSEIT  L++K W+  V  RTVPLR  GT++PALTSLVRYL+HDS
Sbjct  202  GNYKIRVNAIAPGLFKSEITGDLLEKKWMKNVTERTVPLRVLGTTDPALTSLVRYLVHDS  261

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN +IVD+G TLPG PI
Sbjct  262  SNYVSGNIFIVDSGYTLPGFPI  283



>gb|EMT14873.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Aegilops tauschii]
Length=283

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+K+VC  M +AK  GS++NISS++GLNRG LPG + Y +SK+AV+++T++MALEL
Sbjct  138  GLWLVAKHVCRHMRDAKIKGSVINISSVAGLNRGNLPGSIGYASSKSAVHSVTKIMALEL  197

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVN+I+PG+F+SEIT  L+QK WL+ V  + VPL+T GT++PALTSLVR+LIH+ 
Sbjct  198  GAYGIRVNAIAPGIFQSEITAPLLQKRWLSTVVSKIVPLKTNGTTDPALTSLVRFLIHEK  257

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            + YI+GN +IVD+G T+PGVPI
Sbjct  258  ASYITGNIFIVDSGVTVPGVPI  279



>emb|CDY29207.1| BnaA06g25500D [Brassica napus]
Length=148

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 109/143 (76%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC+ MC+AK  GGS++NISS+SGL+R    G +AY +SK+ V+ +TR MA+E
Sbjct  2    GAWLVSKYVCILMCDAKQGGGSVINISSVSGLHRSLSYGAVAYASSKSGVDTMTRAMAIE  61

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSI+PGLFKSEIT  L+QK W   V  R  PL    T +P LTSLVRYLIHD
Sbjct  62   LGVYNIRVNSIAPGLFKSEITQALIQKKWFKNVTDRIFPLTAEQTVDPGLTSLVRYLIHD  121

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN +IVDAG TLPG+PI
Sbjct  122  SSQYVSGNVFIVDAGATLPGLPI  144



>ref|XP_009116226.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=282

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSK+VC+ M +AK GG  V   S    L RG+LPG LAY  SK  ++ +T++MA+E
Sbjct  136  GPWLVSKHVCVLMRDAKRGGGSVINVSSIAGLQRGKLPGALAYACSKGGLDIMTKMMAVE  195

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            +G   IRVNSI+PGLFKSEIT+GLM+K+W+  V  RTVPL+   + +P LTSLVRYLIHD
Sbjct  196  MGEYGIRVNSIAPGLFKSEITEGLMRKEWMKNVRERTVPLKVQQSVDPGLTSLVRYLIHD  255

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS Y+SGN YIVDAG+TL G+PI
Sbjct  256  SSRYVSGNVYIVDAGSTLSGLPI  278



>ref|XP_009116225.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=283

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSK+VC+ M +AK GG  V   S    L RG+LPG LAY  SK  ++ +T++MA+E
Sbjct  137  GPWLVSKHVCVLMRDAKRGGGSVINVSSIAGLQRGKLPGALAYACSKGGLDIMTKMMAVE  196

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            +G   IRVNSI+PGLFKSEIT+GLM+K+W+  V  RTVPL+   + +P LTSLVRYLIHD
Sbjct  197  MGEYGIRVNSIAPGLFKSEITEGLMRKEWMKNVRERTVPLKVQQSVDPGLTSLVRYLIHD  256

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS Y+SGN YIVDAG+TL G+PI
Sbjct  257  SSRYVSGNVYIVDAGSTLSGLPI  279



>dbj|BAK03236.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=283

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+K+VC  M +AK  GS++NISS++GLNRG LPG + Y +SK+AV+++T++MALEL
Sbjct  138  GLWLVAKHVCRHMRDAKIKGSVINISSVAGLNRGNLPGSIGYASSKSAVHSVTKLMALEL  197

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVN+I+PG+F+SEIT  L+QK WL+ V  + VPL+T GT++PALTSLVR+LIH+ 
Sbjct  198  GAYGIRVNAIAPGIFQSEITAPLLQKRWLSTVVSKIVPLKTNGTTDPALTSLVRFLIHEK  257

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            + YI+GN +IVD+G T+PGVPI
Sbjct  258  ASYITGNIFIVDSGVTVPGVPI  279



>ref|XP_004252379.1| PREDICTED: probable L-xylulose reductase [Solanum lycopersicum]
Length=271

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G W+VSKYVC RM +AK  GGS++NI+S++GLNR  +PG  AY TSK A++ +T++MA+E
Sbjct  125  GAWMVSKYVCKRMIDAKQGGGSVINITSMAGLNRIAVPGTTAYATSKMALDMVTKIMAIE  184

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IR+NSISPG+FKSEIT+ L+++ W +K   +T+P R  GT++P LTSL+RYLIHD
Sbjct  185  LGGENIRLNSISPGVFKSEITESLVEQKWFHKFLYKTLPTRYLGTTDPGLTSLIRYLIHD  244

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SSEY++GN +IVD G +LPGVPI
Sbjct  245  SSEYVTGNVFIVDGGASLPGVPI  267



>ref|XP_009139356.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Brassica rapa]
Length=247

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC  M ++K GGS++N+SSISGL+RG   GG+AY  SK  V+ +TR+MA+EL
Sbjct  102  GPWLVSKYVCSLMRDSKRGGSVINVSSISGLHRGLFFGGVAYACSKGGVDTMTRMMAIEL  161

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGL KSEIT GLMQK+WL  V  R +PL+   T +P +TSLVRYLIHDS
Sbjct  162  GVYNIRVNSIAPGLLKSEITQGLMQKEWLKNVTDRIIPLKVQQTVDPGITSLVRYLIHDS  221

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGN YI+D+G TLPG+PI
Sbjct  222  SRYVSGNIYILDSGTTLPGLPI  243



>gb|ABE65821.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
thaliana]
Length=135

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -3

Query  609  LNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLN  430
            L+RGQ+PGG+AY  SK  V+ +TR+MALELG  KIRVNSI+PGL KSEIT GLMQK+WL 
Sbjct  20   LHRGQVPGGVAYACSKGGVDTMTRMMALELGVYKIRVNSIAPGLLKSEITQGLMQKEWLK  79

Query  429  KVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPI  274
             V  RTVPL+   T +P LTSL+RYL+HDSS+YISGNTYIVDAG +L G+PI
Sbjct  80   TVIERTVPLKVQQTVDPGLTSLLRYLVHDSSKYISGNTYIVDAGASLVGLPI  131



>gb|EMS67034.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Triticum urartu]
Length=248

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+K+VC RM +AK  GS++NISS SGL+ G   G LAY+ SK+AV+++T++MALEL
Sbjct  103  GVWLVAKHVCRRMRDAKLKGSVINISSTSGLDGGITHGSLAYSASKSAVHSVTKLMALEL  162

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVN+I+PG+FKSEIT  L+QK WLN V  + VPL+  GT +PALTSLVR+LIH++
Sbjct  163  GAHGIRVNTIAPGIFKSEITAPLLQKRWLNDVLSKIVPLKKIGTPDPALTSLVRFLIHET  222

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S YISGN ++VD+G  LPGVPI
Sbjct  223  SSYISGNIFVVDSGLVLPGVPI  244



>emb|CAN59905.1| hypothetical protein VITISV_033145 [Vitis vinifera]
Length=316

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV +RM +AK GGSI+NISSI  LNRGQ PG +AY +SK+ ++A+T+VMALEL
Sbjct  141  GSWLVSKYVGMRMRDAKNGGSIINISSIVSLNRGQSPGAVAYVSSKSGLSAMTKVMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IR N+I+PG+FKSEIT GLMQKDWLN V  RT PLR +GTS+PALTSLVRYLIHDS
Sbjct  201  GAYNIRANAIAPGIFKSEITAGLMQKDWLNTVVQRTCPLRAYGTSDPALTSLVRYLIHDS  260

Query  339  SEYIS  325
            S YIS
Sbjct  261  SRYIS  265



>ref|XP_006366156.1| PREDICTED: probable L-xylulose reductase-like, partial [Solanum 
tuberosum]
Length=300

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G W+VSKYVC  M +AK  GGS++NI+S++GLNR  +PG +AY TSK A++ +T++MA+E
Sbjct  154  GAWMVSKYVCKHMIDAKQGGGSVINITSMAGLNRVAVPGTIAYATSKMALDMVTKIMAIE  213

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IR+NSISPG+FKSEIT  L+++ W +K   +T+P R  GT++P LTSL+RYLIHD
Sbjct  214  LGGENIRLNSISPGVFKSEITQSLVEQKWFHKFLYKTLPTRYLGTTDPGLTSLIRYLIHD  273

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SSEY++GN +IVD G +LPGVPI
Sbjct  274  SSEYVTGNVFIVDGGASLPGVPI  296



>emb|CDY40209.1| BnaA09g34910D [Brassica napus]
Length=312

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSK+VC+ M +AK GG  V   S    L RG+LPG LAY  SK  ++ +T++MA+E
Sbjct  166  GPWLVSKHVCVLMRDAKRGGGSVINVSSIAGLQRGKLPGALAYACSKGGLDIMTKMMAVE  225

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            +G   IRVNSI+PGLFKSEIT+GLM+K+W+  V  R VPL+   + +P LTSLVRYLIHD
Sbjct  226  MGEYGIRVNSIAPGLFKSEITEGLMRKEWMKNVRERIVPLKVQQSVDPGLTSLVRYLIHD  285

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS Y+SGN YIVDAG+TL G+PI
Sbjct  286  SSRYVSGNVYIVDAGSTLSGLPI  308



>dbj|BAE99083.1| putative reductase [Arabidopsis thaliana]
Length=136

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  609  LNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLN  430
            L+RG L GGLAY  SK  V+ +TR+MA+EL   KIRVNSI+PG+F+SEIT GL QK+WL 
Sbjct  19   LHRGLLRGGLAYACSKGGVDTMTRMMAIELAVYKIRVNSIAPGIFRSEITQGLFQKEWLK  78

Query  429  KVALRTVPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTLPGVPI  274
            KV  + VPL+   T +P LTSLVRYLIHDSS+Y++GNTYIVD+G TLPGVPI
Sbjct  79   KVTEKVVPLKMQQTVDPGLTSLVRYLIHDSSQYVTGNTYIVDSGTTLPGVPI  130



>emb|CDX73391.1| BnaC08g26120D [Brassica napus]
Length=469

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFgg--sivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMAL  526
            G WLVSK+VC+ M +AK  G  S++N+SSI+GL RG+LPGGLAY  SK  ++ +T++MA+
Sbjct  322  GPWLVSKHVCVLMRDAKRRGGGSVINVSSIAGLQRGKLPGGLAYACSKGGLDIMTKMMAV  381

Query  525  ELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIH  346
            ELG   IRVNSI+PGLFKSEIT+GLM+K+W+  V  R VPL+   + +P LTSLVRYLIH
Sbjct  382  ELGEYGIRVNSIAPGLFKSEITEGLMRKEWMKNVRERIVPLKVQQSVDPGLTSLVRYLIH  441

Query  345  DSSEYISGNTYIVDAGNTLPGVPI  274
            DSS Y+SGN YIVDAG TL G+PI
Sbjct  442  DSSRYVSGNVYIVDAGATLSGLPI  465



>ref|XP_009150760.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=278

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC+ MC+AK GG  V   S    L+R    G +AY +SK+ V+ +TR MA+E
Sbjct  132  GAWLVSKYVCILMCDAKQGGGSVINISSVSGLHRSLSYGAVAYASSKSGVDTMTRAMAIE  191

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSI+PGLFKSEIT  L+QK W   V  R  PL    T +P LTSLVRYLIHD
Sbjct  192  LGVYNIRVNSIAPGLFKSEITQALIQKKWFKNVTDRIFPLTAEQTVDPGLTSLVRYLIHD  251

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS Y+SGN +IVDAG TLPG+PI
Sbjct  252  SSIYVSGNVFIVDAGATLPGLPI  274



>ref|XP_009150759.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=279

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC+ MC+AK GG  V   S    L+R    G +AY +SK+ V+ +TR MA+E
Sbjct  133  GAWLVSKYVCILMCDAKQGGGSVINISSVSGLHRSLSYGAVAYASSKSGVDTMTRAMAIE  192

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSI+PGLFKSEIT  L+QK W   V  R  PL    T +P LTSLVRYLIHD
Sbjct  193  LGVYNIRVNSIAPGLFKSEITQALIQKKWFKNVTDRIFPLTAEQTVDPGLTSLVRYLIHD  252

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS Y+SGN +IVDAG TLPG+PI
Sbjct  253  SSIYVSGNVFIVDAGATLPGLPI  275



>dbj|BAK02348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLV+K+VC RM +A+  GS++NISS SGL+ G   G LAY+ SK+AV+++T++MALEL
Sbjct  136  GVWLVAKHVCRRMRDAELKGSVINISSTSGLDGGITHGSLAYSASKSAVHSVTKLMALEL  195

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IRVN+I+PG+FKSEIT  L +K W+N VA + +PL+  GT +PALTSLVR+L H++
Sbjct  196  GAHGIRVNTIAPGIFKSEITAPLFEKRWMNDVASKILPLKKIGTPDPALTSLVRFLTHET  255

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S YISGN ++VD+G  LPGVPI
Sbjct  256  SSYISGNIFVVDSGLVLPGVPI  277



>gb|ADE77298.1| unknown [Picea sitchensis]
Length=289

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK V  RM  AK GGSI+NISSI GL RG+LPGG+AY+ SK  +NA+T++MALEL
Sbjct  144  GTWLVSKAVGKRMREAKRGGSIINISSIGGLPRGELPGGIAYSASKAGINAMTKIMALEL  203

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVN+++PGLF+SEIT GLM+KDWLN VA + VPL+T+G   P LTS +  L  D+
Sbjct  204  GMYNIRVNAVAPGLFRSEITAGLMEKDWLNTVARKIVPLQTWGEIEPTLTSTLHLLASDT  263

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y +GN  I+D G +LPGVP+
Sbjct  264  SAYTTGNIVIIDGGQSLPGVPL  285



>ref|XP_009121071.1| PREDICTED: probable L-xylulose reductase isoform X1 [Brassica 
rapa]
Length=279

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLV+KYVC+ M +AK GG  V   S     +R   PG LAY  SK+ V+ +TR+MA+E
Sbjct  133  GAWLVAKYVCVLMRDAKTGGGSVINISSIAGFHRSLAPGALAYACSKSGVDTMTRMMAIE  192

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSI+PGL  S+IT  LMQK WL  VA R +PL+   T +P LTSLVRYL+HD
Sbjct  193  LGAYNIRVNSIAPGLLNSDITKDLMQKKWLKVVAERILPLKVNQTVDPGLTSLVRYLLHD  252

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN YIVD+G TLPG+PI
Sbjct  253  SSQYVSGNIYIVDSGTTLPGLPI  275



>ref|XP_009121072.1| PREDICTED: probable L-xylulose reductase isoform X2 [Brassica 
rapa]
Length=278

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLV+KYVC+ M +AK GG  V   S     +R   PG LAY  SK+ V+ +TR+MA+E
Sbjct  132  GAWLVAKYVCVLMRDAKTGGGSVINISSIAGFHRSLAPGALAYACSKSGVDTMTRMMAIE  191

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG   IRVNSI+PGL  S+IT  LMQK WL  VA R +PL+   T +P LTSLVRYL+HD
Sbjct  192  LGAYNIRVNSIAPGLLNSDITKDLMQKKWLKVVAERILPLKVNQTVDPGLTSLVRYLLHD  251

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y+SGN YIVD+G TLPG+PI
Sbjct  252  SSQYVSGNIYIVDSGTTLPGLPI  274



>ref|XP_008680945.1| PREDICTED: LOC100286139 isoform X4 [Zea mays]
Length=275

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG LPG   Y +SK AV+  T++MALEL
Sbjct  135  GSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G ++IRVNSI+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++
Sbjct  195  GADRIRVNSIAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEA  254

Query  339  SEYISGNTYIVDA  301
            S Y++GN +IVD+
Sbjct  255  SSYVTGNIFIVDS  267



>ref|XP_008680943.1| PREDICTED: LOC100286139 isoform X3 [Zea mays]
Length=292

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG LPG   Y +SK AV+  T++MALEL
Sbjct  135  GSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G ++IRVNSI+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++
Sbjct  195  GADRIRVNSIAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEA  254

Query  339  SEYISGNTYIVDA  301
            S Y++GN +IVD+
Sbjct  255  SSYVTGNIFIVDS  267



>ref|XP_008680941.1| PREDICTED: LOC100286139 isoform X2 [Zea mays]
 gb|ACN26914.1| unknown [Zea mays]
Length=315

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG LPG   Y +SK AV+  T++MALEL
Sbjct  135  GSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G ++IRVNSI+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++
Sbjct  195  GADRIRVNSIAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEA  254

Query  339  SEYISGNTYIVDA  301
            S Y++GN +IVD+
Sbjct  255  SSYVTGNIFIVDS  267



>tpg|DAA47977.1| TPA: hypothetical protein ZEAMMB73_585385 [Zea mays]
Length=319

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG LPG   Y +SK AV+  T++MALEL
Sbjct  135  GSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G ++IRVNSI+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++
Sbjct  195  GADRIRVNSIAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEA  254

Query  339  SEYISGNTYIVDA  301
            S Y++GN +IVD+
Sbjct  255  SSYVTGNIFIVDS  267



>ref|XP_006367949.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like, 
partial [Solanum tuberosum]
Length=261

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivn-issisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            GTWLVSK VC RM +AK  G  V  ISS + LNR    G LAY +SK A++ +T++MA+E
Sbjct  115  GTWLVSKCVCRRMRDAKQSGGSVINISSAAALNRVVYKGSLAYASSKMALDMITKIMAIE  174

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            LG +KIRVNSI+PG FKSEIT+GL +     K  L+ VPLR  GT++  LTSLVRYLIHD
Sbjct  175  LGVDKIRVNSITPGFFKSEITEGLFKLKGFPKFLLKIVPLRFIGTTDLGLTSLVRYLIHD  234

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            SS+Y++GN +IVD G+T+ GVPI
Sbjct  235  SSKYVTGNVFIVDGGSTIVGVPI  257



>ref|XP_008680935.1| PREDICTED: LOC100286139 isoform X1 [Zea mays]
Length=366

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K+VC RM +AK  GS+VNI+SI+GLNRG LPG   Y +SK AV+  T++MALEL
Sbjct  135  GSWLVAKHVCRRMRDAKLKGSVVNITSIAGLNRGHLPGSTGYASSKAAVHYATKIMALEL  194

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G ++IRVNSI+PGLFKSEIT  L QK WL+ VA + VPL+  G ++PALTSLVR+LIH++
Sbjct  195  GADRIRVNSIAPGLFKSEITAPLFQKRWLSTVASKIVPLKEHGATDPALTSLVRFLIHEA  254

Query  339  SEYISGNTYIVDA  301
            S Y++GN +IVD+
Sbjct  255  SSYVTGNIFIVDS  267



>ref|XP_007028286.1| 2,4-dienoyl-CoA reductase, putative isoform 1 [Theobroma cacao]
 gb|EOY08788.1| 2,4-dienoyl-CoA reductase, putative isoform 1 [Theobroma cacao]
Length=364

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -3

Query  546  LTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTS  367
            L R MALELG +KIRVNSISPGLFKSEIT GLM+KDWL  VA RT PLRTFGTS+PALTS
Sbjct  270  LERSMALELGAHKIRVNSISPGLFKSEITQGLMKKDWLTNVATRTAPLRTFGTSDPALTS  329

Query  366  LVRYLIHDSSEYISGNTYIVDAGNTLPGVPI  274
            LVRYLIHDSSEY+SGN +IVDAG TLPG+PI
Sbjct  330  LVRYLIHDSSEYVSGNMFIVDAGVTLPGIPI  360



>ref|XP_008240678.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Prunus mume]
Length=264

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV +RM +A  GGSI+N+SSI+GL+RG LPG +AY  SK  VN L +VMA+EL
Sbjct  145  GSWLVSKYVSIRMRDADQGGSIINVSSIAGLHRGYLPGAVAYNCSKAGVNTLAKVMAMEL  204

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYL  352
            G +KIRVN+ISPGLF+SEIT+GLM+KDWL+ VA++TVPLRT+GTS+PALTSLVRYL
Sbjct  205  GVHKIRVNAISPGLFRSEITEGLMKKDWLHNVAMKTVPLRTYGTSDPALTSLVRYL  260



>ref|XP_006367340.1| PREDICTED: probable L-xylulose reductase-like, partial [Solanum 
tuberosum]
Length=271

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC RM +AK  GGS++NISS+SGLNR  LPG +AY +SK A++  TR+MALE
Sbjct  125  GAWLVSKYVCRRMRDAKQGGGSVINISSVSGLNRVLLPGSVAYASSKMALDMFTRMMALE  184

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            +G   IRVNSI+P +F+SEIT+ L+QK+   +V  + VPLR FG +NPA+TS+VRYL   
Sbjct  185  MGVYNIRVNSIAPAIFRSEITESLIQKESYKRVVSKIVPLRDFGKTNPAITSVVRYLNLH  244

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            +SEY+SGN +IVD+G +L GVPI
Sbjct  245  ASEYVSGNIFIVDSGCSLTGVPI  267



>ref|XP_001760079.1| predicted protein [Physcomitrella patens]
 gb|EDQ75204.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWL+SK V  R+  AK GGSI+NISSI G+ RG LPGGLAY+TSK AV  L+++MA+EL
Sbjct  129  GTWLMSKAVSKRLVAAKRGGSIINISSIGGIERGLLPGGLAYSTSKAAVIHLSKIMAMEL  188

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G + IR N+I+ GLFKSEIT+ L QK+WL+KVA + VP   +G  +P LTSLV  L  D 
Sbjct  189  GHHNIRTNAIAAGLFKSEITNDLFQKEWLHKVATKIVPAGKWGAVDPDLTSLVILLASDD  248

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S+YI+GNT+IVD G +LPG+PI
Sbjct  249  SQYITGNTFIVDGGQSLPGLPI  270



>ref|XP_011075456.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X2 [Sesamum indicum]
Length=284

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTW VSK V  R+  A+   SI+NISSI+GLNR Q  GG+AY +SK+A++++TR+MALEL
Sbjct  140  GTWEVSKCVASRLRFARRKASIINISSITGLNRVQFFGGIAYNSSKSAIDSITRIMALEL  199

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGLF SEI+  + Q D L  +A + +PL T G  NPALTSLVRYL+HDS
Sbjct  200  GGYNIRVNSIAPGLFPSEISGPIFQHD-LEILAKKIIPLGTSGAINPALTSLVRYLVHDS  258

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGNT+IVD G++LPG+PI
Sbjct  259  SNYVSGNTFIVDFGSSLPGLPI  280



>ref|XP_011079073.1| PREDICTED: estradiol 17-beta-dehydrogenase 8-like isoform X2 
[Sesamum indicum]
Length=284

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKYVC RM  A+ GGS++NISS +GLNRGQLPG L Y  SK AVN +T+ MALEL
Sbjct  142  GTWLVSKYVCSRMRYAQQGGSVINISSTAGLNRGQLPGSLVYAASKAAVNTITKGMALEL  201

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHD  343
            G  KIRVNSISPG+FKSEIT GL+QKDWL  VA +T+PLRT GT++PALTSLVR   +D
Sbjct  202  GMYKIRVNSISPGIFKSEITQGLLQKDWLKTVAFKTIPLRTHGTTDPALTSLVRRRQND  260



>ref|XP_011075454.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase 4-like 
isoform X1 [Sesamum indicum]
Length=287

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTW VSK V  R+  A+   SI+NISSI+GLNR Q  GG+AY +SK+A++++TR+MALEL
Sbjct  143  GTWEVSKCVASRLRFARRKASIINISSITGLNRVQFFGGIAYNSSKSAIDSITRIMALEL  202

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGLF SEI+  + Q D L  +A + +PL T G  NPALTSLVRYL+HDS
Sbjct  203  GGYNIRVNSIAPGLFPSEISGPIFQHD-LEILAKKIIPLGTSGAINPALTSLVRYLVHDS  261

Query  339  SEYISGNTYIVDAGNTLPGVPI  274
            S Y+SGNT+IVD G++LPG+PI
Sbjct  262  SNYVSGNTFIVDFGSSLPGLPI  283



>ref|XP_010265876.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Nelumbo nucifera]
Length=91

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -3

Query  534  MALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRY  355
            MA+E+G  KIRVN+I+PG+FKSEIT+ LM+K+W+N V  +TVPL TFGTS+PALTSLVRY
Sbjct  1    MAVEMGPYKIRVNAIAPGIFKSEITEKLMEKEWINNVMKKTVPLGTFGTSDPALTSLVRY  60

Query  354  LIHDSSEYISGNTYIVDAGNTLPGVPI  274
            LIHDSSEY+SGN +IVDAG TLPGVPI
Sbjct  61   LIHDSSEYVSGNVFIVDAGATLPGVPI  87



>ref|XP_006362945.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X3 [Solanum tuberosum]
Length=260

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 109/144 (76%), Gaps = 18/144 (13%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAK-FggsivnissisGLNRGQLPGGLAYTTSKTAVNALT-RVMAL  526
            G WLVSK+VC  M +AK  GGSI+N+SSI+GLNR  +PGGLAY +SK A++ LT ++MAL
Sbjct  129  GAWLVSKFVCRHMIDAKQGGGSIINVSSIAGLNRVLVPGGLAYASSKMALDRLTEQMMAL  188

Query  525  ELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIH  346
            ELG +KIRVNSI+PG+FKS+                RT PLRT GT++PALTSLVRYLIH
Sbjct  189  ELGVHKIRVNSIAPGIFKSD----------------RTTPLRTIGTTDPALTSLVRYLIH  232

Query  345  DSSEYISGNTYIVDAGNTLPGVPI  274
             +SEY+SGN +IVD+G TL GVPI
Sbjct  233  AASEYVSGNVFIVDSGATLIGVPI  256



>emb|CBI32789.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLVSKYV +RM +AK GGSI+NISSI  LNRGQ PG +AY +SK+ ++A+T+VMALEL
Sbjct  141  GSWLVSKYVGMRMRDAKNGGSIINISSIVSLNRGQSPGAVAYVSSKSGLSAMTKVMALEL  200

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVR  358
            G   IR N+I+PG+FKSEIT GLMQKDWLN V  RT PLR +GTS+PALTSL +
Sbjct  201  GAYNIRANAIAPGIFKSEITAGLMQKDWLNTVVQRTCPLRAYGTSDPALTSLAQ  254



>ref|XP_003632638.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Vitis vinifera]
Length=297

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 90/138 (65%), Gaps = 23/138 (17%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK+VC RM                   R    GGL     K  V     VMA+E 
Sbjct  141  GTWLVSKHVCRRM-------------------RDGHQGGLC----KLYVVTTKLVMAIEF  177

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   +RVN+ISPGLFKSEIT+GL+QK WLN V L+ VPL+TFGT +PA+TSLVR+L+HDS
Sbjct  178  GMYNVRVNAISPGLFKSEITEGLLQKSWLNNVTLKMVPLQTFGTLDPAVTSLVRFLVHDS  237

Query  339  SEYISGNTYIVDAGNTLP  286
            S YI+GN  IVDAG++LP
Sbjct  238  SRYITGNILIVDAGSSLP  255



>emb|CBI32790.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  609  LNRGQLPGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLN  430
            LNRGQLPGG+AY +SK+ ++A+T+VMALELG   IR N+I+PGLFKSEIT GLMQKDWLN
Sbjct  19   LNRGQLPGGVAYVSSKSGLSAMTKVMALELGAYNIRANAIAPGLFKSEITSGLMQKDWLN  78

Query  429  KVALRTVPLRTFGTSNPALTSLVR  358
             VA RT P+RTFGTS+PALTSLV+
Sbjct  79   TVAQRTCPMRTFGTSDPALTSLVQ  102



>ref|XP_002963314.1| hypothetical protein SELMODRAFT_80357 [Selaginella moellendorffii]
 gb|EFJ35185.1| hypothetical protein SELMODRAFT_80357 [Selaginella moellendorffii]
Length=275

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 94/143 (66%), Gaps = 2/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK V  RM  AK     +   S +  + G LPGG+AY +SK A+N LT+ MALEL
Sbjct  130  GTWLVSKAVARRMVAAK-KPGSIINISSTASSGGLLPGGIAYASSKAAINRLTQSMALEL  188

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVN+I+ G+F SEITD L+ K W++  A + VPLR FG  +P LTSLV  L  D 
Sbjct  189  GKFKIRVNAIAAGIFPSEITDSLLDKAWVHDAAAKIVPLRRFGQVSPDLTSLVLMLASDE  248

Query  339  -SEYISGNTYIVDAGNTLPGVPI  274
             S YI+G  Y VD G+TLPG+ +
Sbjct  249  HSSYITGQIYHVDGGHTLPGIQL  271



>ref|XP_006408894.1| hypothetical protein EUTSA_v10002227mg, partial [Eutrema salsugineum]
 gb|ESQ50347.1| hypothetical protein EUTSA_v10002227mg, partial [Eutrema salsugineum]
Length=283

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WL+SKYVC+ M + K  GS++NISSISGLNR  +P  LAY  SK +V+ +TR+MA+EL
Sbjct  142  GPWLISKYVCVLMRDCKLSGSVINISSISGLNRTIVPCALAYNCSKASVHTMTRMMAIEL  201

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G   IRVNSI+PGLFKSEIT  L+QK W   V  R +PL+     +P LTSLVRYLIHDS
Sbjct  202  GVYNIRVNSIAPGLFKSEITQSLLQKVWFKNVVERIIPLKKPQAVDPGLTSLVRYLIHDS  261

Query  339  SEYISG  322
            S+Y+S 
Sbjct  262  SQYVSA  267



>ref|XP_002963719.1| hypothetical protein SELMODRAFT_80710, partial [Selaginella moellendorffii]
 gb|EFJ35590.1| hypothetical protein SELMODRAFT_80710, partial [Selaginella moellendorffii]
Length=221

 Score =   132 bits (331),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 95/143 (66%), Gaps = 2/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK V  RM  AK     +   S S  + G LPGG AY +SK A+N LT++MALEL
Sbjct  76   GTWLVSKAVARRMVAAK-KPGSIINISSSASSGGILPGGTAYGSSKAAINRLTQIMALEL  134

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
            G  KIRVN+I+ G+F+SEIT+GL+ + W++  A   VPLR FG  +P LTSLV  L  D 
Sbjct  135  GKFKIRVNAIAAGIFRSEITEGLLDQAWVHDAAATIVPLRRFGLVSPGLTSLVLILASDE  194

Query  339  -SEYISGNTYIVDAGNTLPGVPI  274
             S YI+G  Y+ D G+TLPG+ +
Sbjct  195  HSSYITGQIYLEDGGHTLPGIQL  217



>ref|XP_002974604.1| hypothetical protein SELMODRAFT_101607 [Selaginella moellendorffii]
 gb|EFJ24124.1| hypothetical protein SELMODRAFT_101607 [Selaginella moellendorffii]
Length=278

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 93/141 (66%), Gaps = 2/141 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK V  RM  AK     +   S +  + G LPGG+AY +SK A+N LT+ MALEL
Sbjct  133  GTWLVSKAVARRMVAAK-KPGSIINISSTASSGGLLPGGIAYASSKAAINRLTQSMALEL  191

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLI-HD  343
            G  KIRVN+I+ G+F+SEITD L+ K W++  A + VPL  FG  +P LTSLV  L   +
Sbjct  192  GKFKIRVNAIAAGIFRSEITDSLLDKAWVHDAAAKIVPLLRFGQVSPDLTSLVLMLASEE  251

Query  342  SSEYISGNTYIVDAGNTLPGV  280
             S YI+G  Y VD G+TLPG+
Sbjct  252  HSSYITGQIYHVDGGHTLPGI  272



>ref|XP_009786105.1| PREDICTED: D-erythrulose reductase-like [Nicotiana sylvestris]
Length=251

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 92/117 (79%), Gaps = 1/117 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFgg-sivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            GTWLVSKYVC RM +AK  G S++NISS + LNR    G LAY +SK A++ +T++MALE
Sbjct  123  GTWLVSKYVCSRMRDAKQDGGSVINISSAAALNRALFKGSLAYASSKMALDMITKIMALE  182

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYL  352
            LG +KIRVNSISPG+FKSEIT+ L+Q+   +    + VPLRTFGT++PALTS+VRY+
Sbjct  183  LGVHKIRVNSISPGIFKSEITENLVQQKRFHNAVFKAVPLRTFGTTDPALTSVVRYI  239



>ref|XP_006374241.1| hypothetical protein POPTR_0015s05345g [Populus trichocarpa]
 gb|ERP52038.1| hypothetical protein POPTR_0015s05345g [Populus trichocarpa]
Length=96

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 73/92 (79%), Gaps = 5/92 (5%)
 Frame = -3

Query  534  MALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRY  355
            MA+E G  KIRVNSIS  L KSEI  GLMQKDWL+ VA +TVP RTFGT++PA TSLVRY
Sbjct  1    MAMEKGVYKIRVNSISSRLSKSEIMQGLMQKDWLSNVAQKTVPSRTFGTADPASTSLVRY  60

Query  354  LIHDSSEYISGNTYIV-----DAGNTLPGVPI  274
            LIH+SSEY++GN +IV     DAG TLPGVP+
Sbjct  61   LIHESSEYVTGNNFIVDAIKEDAGATLPGVPL  92



>ref|XP_004252861.2| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like isoform X2 [Solanum lycopersicum]
Length=613

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC  M ++K GG  V   S    LNR  +PGGLAY +SK A++ +T++MALE
Sbjct  125  GAWLVSKYVCRHMRDSKQGGGSVINISSIAGLNRVLIPGGLAYASSKMALDMVTKMMALE  184

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVR  358
            LG + IRVNSISPG+FKSEIT  LM+K+W N V +RT+PLRT GT++PALTS VR
Sbjct  185  LGVDNIRVNSISPGIFKSEITKSLMEKEWFNNVTVRTIPLRTLGTTDPALTSTVR  239



>ref|XP_010314672.1| PREDICTED: omega-6 fatty acid desaturase, endoplasmic reticulum 
isozyme 1-like isoform X1 [Solanum lycopersicum]
Length=614

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisG-LNRGQLPGGLAYTTSKTAVNALTRVMALE  523
            G WLVSKYVC  M ++K GG  V   S    LNR  +PGGLAY +SK A++ +T++MALE
Sbjct  125  GAWLVSKYVCRHMRDSKQGGGSVINISSIAGLNRVLIPGGLAYASSKMALDMVTKMMALE  184

Query  522  LGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVR  358
            LG + IRVNSISPG+FKSEIT  LM+K+W N V +RT+PLRT GT++PALTS VR
Sbjct  185  LGVDNIRVNSISPGIFKSEITKSLMEKEWFNNVTVRTIPLRTLGTTDPALTSTVR  239



>gb|ABK21106.1| unknown [Picea sitchensis]
Length=295

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSK V  RM +A   GSI+NISS +  NRG LPG + Y TSK  VN +T++MALEL
Sbjct  149  GVWLVSKCVAKRMRDAGKKGSIINISSTASANRGNLPGSMIYATSKVGVNQITKMMALEL  208

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALT-SLVRYLIHD  343
            G   IRVN+I+ G+FKSE+T G+ +KDW +KVA + VP + +G+++P  T  L+    + 
Sbjct  209  GRYGIRVNAIAAGIFKSEMTKGIFEKDWSHKVAEKVVPAQRWGSTDPDFTSLLLLLASNA  268

Query  342  SSEYISGNTYIVDAGNTLPGVPI  274
            +S Y++GN +I+D G+T+PG+P+
Sbjct  269  ASSYVTGNIFILDGGHTIPGLPL  291



>gb|EYU20809.1| hypothetical protein MIMGU_mgv11b016674mg [Erythranthe guttata]
Length=267

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WLV+K V  RM  A   GSI+NISS+SGLNRG   GG+A  +SK A++ +T+++ALE 
Sbjct  132  GSWLVAKSVGKRMRAAARNGSIINISSVSGLNRGVFRGGVACDSSKAAIDTMTKIVALEF  191

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRT-VPLRTFGTSNPALTSLVRYLIHD  343
            G  KIRVNSI+PGLFKSEIT+ L  K    K A++  VPL  FG  +PALT LVRYLI D
Sbjct  192  GDYKIRVNSIAPGLFKSEITENLFNKKLGLKNAMKKLVPLGEFGEGDPALTCLVRYLIDD  251

Query  342  SSEYISGNTY  313
            SSEY+SGN +
Sbjct  252  SSEYVSGNIF  261



>ref|XP_002308881.1| hypothetical protein POPTR_0006s03530g [Populus trichocarpa]
 gb|EEE92404.1| hypothetical protein POPTR_0006s03530g [Populus trichocarpa]
Length=97

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  534  MALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRY  355
            MA+E G  KIRVNSIS GL KSEI  GL+QKDWL+ VA +TVP RTFGT+NPA TSLVRY
Sbjct  1    MAMEKGVYKIRVNSISSGLSKSEIMQGLVQKDWLSIVAQKTVPSRTFGTANPASTSLVRY  60

Query  354  LIHDSSEYISGNTYIVDA  301
            LIH+S EY++GN +IVDA
Sbjct  61   LIHESLEYVTGNNFIVDA  78



>ref|XP_009394522.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=246

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G WLVSKYVC +M NAK  G+++NISSISGLNRG+LPG +AY  SK  VNA+T+VMALE+
Sbjct  139  GLWLVSKYVCKQMVNAKLKGTVINISSISGLNRGKLPGAIAYAVSKEGVNAITKVMALEM  198

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTV  409
            G + IRVNSISPG+FKSEIT+ LM+K W+NKV L  V
Sbjct  199  GVHNIRVNSISPGIFKSEITESLMRKKWINKVPLYQV  235



>emb|CBI32788.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 82/138 (59%), Gaps = 23/138 (17%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSK+VC RM                   R    GGL                 L  
Sbjct  122  GTWLVSKHVCRRM-------------------RDGHQGGLWPQNCFLFFKYYANYTWLP-  161

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
               +  VN+ISPGLFKSEIT+GL+QK WLN V L+ VPL+TFGT +PA+TSLVR+L+HDS
Sbjct  162  ---QNWVNAISPGLFKSEITEGLLQKSWLNNVTLKMVPLQTFGTLDPAVTSLVRFLVHDS  218

Query  339  SEYISGNTYIVDAGNTLP  286
            S YI+GN  IVDAG++LP
Sbjct  219  SRYITGNILIVDAGSSLP  236



>ref|XP_006299633.1| hypothetical protein CARUB_v10015813mg, partial [Capsella rubella]
 gb|EOA32531.1| hypothetical protein CARUB_v10015813mg, partial [Capsella rubella]
Length=195

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            GTWLVSKY+C+ M +AK GGS++NISS+SGL+RG +PGG+AY  SK  V+ +TR+MALEL
Sbjct  100  GTWLVSKYICVLMRDAKHGGSVINISSVSGLHRGLVPGGIAYACSKGGVDTMTRMMALEL  159

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRT  412
            G  KIRVNSI+PGL KSEIT GLM+K+WL  V  RT
Sbjct  160  GVYKIRVNSIAPGLLKSEITHGLMEKEWLKTVTERT  195



>ref|XP_006850023.1| hypothetical protein AMTR_s00022p00188500 [Amborella trichopoda]
 gb|ERN11604.1| hypothetical protein AMTR_s00022p00188500 [Amborella trichopoda]
Length=91

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -3

Query  534  MALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRY  355
            M + LG   I+VN ++P +FKS IT  L++KDWL+KV  +T PL+T GT++PALTSL+ Y
Sbjct  1    MTIALGKYNIKVNLVAPDIFKSAITSSLLEKDWLDKVVKKTYPLQTLGTTDPALTSLIVY  60

Query  354  LIHDSSEYISGNTYIVDAGNTLPGVPI  274
            LI D S Y++GN ++VD+G  L GVPI
Sbjct  61   LIGDDSNYVTGNAFVVDSGGALAGVPI  87



>emb|CDP06200.1| unnamed protein product [Coffea canephora]
Length=102

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 5/75 (7%)
 Frame = -3

Query  534  MALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRY  355
            MALELG +K+RVNS+SPG     IT GL++K W+  V  + +PL TFG S+PALTSLVR+
Sbjct  1    MALELGEHKVRVNSVSPG-----ITKGLLRKHWIFYVGKKIIPLGTFGPSDPALTSLVRF  55

Query  354  LIHDSSEYISGNTYI  310
            LIHDSS Y+SGN ++
Sbjct  56   LIHDSSGYVSGNHFV  70



>dbj|BAF47118.1| receptor like protein [Nicotiana tabacum]
Length=155

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  359  RTSDVSAGFDVPNVLKGTVLRATLLSQSFCMRPSVISDLKSPGDMEFTLIL  511
            RT++V AG DVP VLKG VL A L SQSFCMRPSVISDLKSPGD+EFTLIL
Sbjct  2    RTTEVKAGSDVPLVLKGMVLNAILWSQSFCMRPSVISDLKSPGDIEFTLIL  52



>ref|NP_001185300.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE34093.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis 
thaliana]
Length=215

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G+WL+SKYVCL M +A+ GGS++N+SSISGL+RG L GGLAY  SK  V+ +TR+MA+EL
Sbjct  137  GSWLISKYVCLLMRDAERGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIEL  196

Query  519  GTNKIRVNSISPGLFK  472
               KIRVNSI+PG+F+
Sbjct  197  AVYKIRVNSIAPGIFR  212



>gb|KCZ60467.1| hypothetical protein HY36_05665 [Hyphomonas atlantica]
Length=236

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G W V+KY    M  A+  GSI+NI+SI+ L    +    AY+ SK AV+ LTR MALE 
Sbjct  101  GVWRVAKYATKAMMQAEVKGSIINIASITALRPSNMIS--AYSASKAAVDHLTRTMALEA  158

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
              + IRVN+I+PG FK+ I D  +  +   ++A R VP+R FG     L + +  L  + 
Sbjct  159  ARHGIRVNAIAPGYFKTAINDEFLDSEAGQRMAKR-VPMRRFGNYEE-LNAPLLLLASEE  216

Query  339  SEYISGNTYIVDAGNTL  289
              Y++G+T +VD G++L
Sbjct  217  GSYMTGSTLVVDGGHSL  233



>ref|WP_035552356.1| 2-deoxy-D-gluconate 3-dehydrogenase [Hyphomonas atlantica]
Length=255

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G W V+KY    M  A+  GSI+NI+SI+ L    +    AY+ SK AV+ LTR MALE 
Sbjct  120  GVWRVAKYATKAMMQAEVKGSIINIASITALRPSNMIS--AYSASKAAVDHLTRTMALEA  177

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
              + IRVN+I+PG FK+ I D  +  +   ++A R VP+R FG     L + +  L  + 
Sbjct  178  ARHGIRVNAIAPGYFKTAINDEFLDSEAGQRMAKR-VPMRRFGNYEE-LNAPLLLLASEE  235

Query  339  SEYISGNTYIVDAGNTL  289
              Y++G+T +VD G++L
Sbjct  236  GSYMTGSTLVVDGGHSL  252



>ref|WP_028496717.1| MULTISPECIES: oxidoreductase [Microbacterium]
Length=270

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -3

Query  576  YTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRT  397
            Y+ SK AV+ LTR ++LELGT  +RVN+I+PG   +E+T  L  +  L + A+ +VPL  
Sbjct  171  YSASKAAVDHLTRFLSLELGTTGLRVNAIAPGFIDTEMTAWLHDQPGLLEKAVASVPLGR  230

Query  396  FGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGN  295
             GT++    +++ +L+ DS+ YISG+T  VD G+
Sbjct  231  IGTTDDIFAAVL-FLLSDSASYISGSTIFVDGGS  263



>gb|KCZ63815.1| hypothetical protein L53_04790 [Hyphomonas sp. L-53-1-40]
Length=236

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G W V+K+    M +A  GGSI+NI+SI+ L    +    AY+ SK AVN LTR MALE 
Sbjct  101  GVWRVAKHATKAMIDAGSGGSIINIASITALRPSNMIS--AYSASKAAVNHLTRTMALEA  158

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
              + IRVN+I+PG FK+ I D  +  +   ++A R VP+R FG     L+  +  L  + 
Sbjct  159  SRHGIRVNAIAPGYFKTAINDEFLDSEAGQRMAKR-VPMRRFGNYEE-LSGPLLLLASEQ  216

Query  339  SEYISGNTYIVDAGNTL  289
              Y++G+T +VD G+TL
Sbjct  217  GGYMTGSTLVVDGGHTL  233



>ref|WP_027836295.1| 2-deoxy-D-gluconate 3-dehydrogenase [Mastigocoleus testarum]
Length=255

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G W V+K+    M  A   GSI+NI+SI+GL    +    AY+ SK  V+ LTR MALE 
Sbjct  120  GVWRVAKHATRAMMQAGVPGSIINIASITGLRPSNIIS--AYSASKAGVDHLTRTMALEA  177

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
              + IRVN+I+PG FK+ I D  ++ +   ++A R VP+R FG  +  LT  +  L  D+
Sbjct  178  SRHGIRVNAIAPGYFKTAINDDFLESEAGQRMAKR-VPMRRFGDYDE-LTGPLLLLASDA  235

Query  339  SEYISGNTYIVDAGNTL  289
              Y++G T +VD G++L
Sbjct  236  GSYMTGATLVVDGGHSL  252



>ref|WP_034813394.1| 2-deoxy-D-gluconate 3-dehydrogenase [Hyphomonas sp. L-53-1-40]
Length=255

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = -3

Query  699  GTWLVSKYVCLRMCNAKFggsivnissisGLNRGQLPGGLAYTTSKTAVNALTRVMALEL  520
            G W V+K+    M +A  GGSI+NI+SI+ L    +    AY+ SK AVN LTR MALE 
Sbjct  120  GVWRVAKHATKAMIDAGSGGSIINIASITALRPSNMIS--AYSASKAAVNHLTRTMALEA  177

Query  519  GTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRTFGTSNPALTSLVRYLIHDS  340
              + IRVN+I+PG FK+ I D  +  +   ++A R VP+R FG     L+  +  L  + 
Sbjct  178  SRHGIRVNAIAPGYFKTAINDEFLDSEAGQRMAKR-VPMRRFGNYEE-LSGPLLLLASEQ  235

Query  339  SEYISGNTYIVDAGNTL  289
              Y++G+T +VD G+TL
Sbjct  236  GGYMTGSTLVVDGGHTL  252



>ref|WP_017987774.1| short-chain dehydrogenase [Amycolatopsis methanolica]
 gb|AIJ21912.1| short-chain dehydrogenase/reductase SDR [Amycolatopsis methanolica 
239]
Length=245

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = -3

Query  579  AYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLR  400
            AY  SK  V ALTRV+A+E     +RVN+++PG F ++++DGLM   W  +V +  VP R
Sbjct  150  AYAASKGGVEALTRVLAVEWADRGVRVNALAPGYFATDLSDGLMNSRW-GEVIVNAVPQR  208

Query  399  TFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNT  292
              G +N  L     +L  D+S Y++G+T  VD G T
Sbjct  209  RIGDANE-LAGAAVFLASDASSYVTGSTLRVDGGWT  243



>ref|WP_027931640.1| short-chain dehydrogenase [Amycolatopsis thermoflava]
Length=245

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = -3

Query  579  AYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLR  400
            AY  SK  V ALTRV+A+E     +RVN+++PG F ++++DGLM   W  +V +  VP R
Sbjct  150  AYAASKGGVEALTRVLAVEWADRGVRVNALAPGYFATDLSDGLMNSRW-GEVIVNAVPQR  208

Query  399  TFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNT  292
              G +N  L     +L  D+S Y++G+T  VD G T
Sbjct  209  RIGDANE-LAGAAVFLASDASSYVTGSTLRVDGGWT  243



>ref|WP_024713243.1| 3-oxoacyl-ACP reductase [Bacillus tequilensis]
Length=247

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = -3

Query  591  PGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRT  412
            P   AY +SK AV  LT+ +A+E G+  IRVNSISPG+ ++E+T+   Q D + ++    
Sbjct  144  PARAAYVSSKHAVIGLTKQLAMEFGSKGIRVNSISPGVIRTELTEEYFQDDEMVQLIKDN  203

Query  411  VPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAG  298
              L T+G  +  + S ++YL  D +++I+G+ +++D G
Sbjct  204  HALHTWGQPDD-IVSCMKYLASDEAQFITGSNFVIDGG  240



>ref|WP_009282872.1| short-chain dehydrogenase [Fibrisoma limi]
 emb|CCH54292.1| short-chain dehydrogenase/reductase SDR [Fibrisoma limi BUZ 3]
Length=242

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 62/101 (61%), Gaps = 1/101 (1%)
 Frame = -3

Query  591  PGGLAYTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRT  412
            P    Y  SK A+NA+ ++ ALEL + KIRVN++SPG   +EI + +   D L    + +
Sbjct  143  PTASVYAASKAAINAVMKIAALELASRKIRVNAVSPGPVATEIMNKMGLNDTLELQMISS  202

Query  411  VPLRTFGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTL  289
            +PL  FGT++  +  L+ +L  D++ +I+G  Y++D G ++
Sbjct  203  IPLARFGTASE-VAELIAFLSDDNAAFITGANYLIDGGQSV  242



>ref|WP_016435613.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Streptomyces sp. 
HGB0020]
 gb|EPD58772.1| 3-oxoacyl-[acyl-carrier-protein] reductase [Streptomyces sp. 
HGB0020]
Length=248

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 3/96 (3%)
 Frame = -3

Query  576  YTTSKTAVNALTRVMALELGTNKIRVNSISPGLFKSEITDGLMQKDWLNKVALRTVPLRT  397
            Y  SK  VN+LTR +A EL    IRVN+++PG   +++TD L +K    K AL +VPLR 
Sbjct  156  YAASKGGVNSLTRTLAKELARQGIRVNAVAPGFIDTDMTDTLSEK--ARKDALASVPLRR  213

Query  396  FGTSNPALTSLVRYLIHDSSEYISGNTYIVDAGNTL  289
            FGT+   +  L  +L+ D + YI+G    VD G  L
Sbjct  214  FGTAQE-VADLTSFLLSDKAGYITGQILQVDGGVAL  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320