BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF019K15

Length=765
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089543.1|  PREDICTED: root phototropism protein 2-like        339   1e-109   Sesamum indicum [beniseed]
gb|KJB26283.1|  hypothetical protein B456_004G235100                    333   1e-107   Gossypium raimondii
ref|XP_009777101.1|  PREDICTED: root phototropism protein 2             333   3e-107   Nicotiana sylvestris
gb|KJB26284.1|  hypothetical protein B456_004G235100                    333   3e-107   Gossypium raimondii
gb|KJB26282.1|  hypothetical protein B456_004G235100                    333   4e-107   Gossypium raimondii
ref|XP_009611218.1|  PREDICTED: root phototropism protein 2             333   5e-107   Nicotiana tomentosiformis
emb|CDP04035.1|  unnamed protein product                                328   2e-105   Coffea canephora [robusta coffee]
ref|XP_006432049.1|  hypothetical protein CICLE_v10000673mg             319   5e-104   
emb|CBI15802.3|  unnamed protein product                                313   5e-104   Vitis vinifera
gb|EYU36889.1|  hypothetical protein MIMGU_mgv1a003487mg                324   2e-103   Erythranthe guttata [common monkey flower]
ref|XP_010244564.1|  PREDICTED: root phototropism protein 2             323   4e-103   Nelumbo nucifera [Indian lotus]
ref|XP_006432045.1|  hypothetical protein CICLE_v10000673mg             319   4e-102   
ref|XP_007017103.1|  Phototropic-responsive NPH3 family protein         319   9e-102   
ref|XP_006432046.1|  hypothetical protein CICLE_v10000673mg             318   2e-101   Citrus clementina [clementine]
gb|KDO54918.1|  hypothetical protein CISIN_1g007944mg                   316   7e-101   Citrus sinensis [apfelsine]
ref|XP_006353728.1|  PREDICTED: root phototropism protein 2-like        316   2e-100   Solanum tuberosum [potatoes]
ref|XP_010650806.1|  PREDICTED: root phototropism protein 2 isofo...    314   3e-100   
gb|KDO54917.1|  hypothetical protein CISIN_1g007944mg                   315   4e-100   Citrus sinensis [apfelsine]
ref|XP_004243653.1|  PREDICTED: root phototropism protein 2             315   4e-100   Solanum lycopersicum
ref|XP_002264896.1|  PREDICTED: root phototropism protein 2 isofo...    315   5e-100   Vitis vinifera
ref|XP_002325631.1|  ROOT PHOTOTROPISM 2 family protein                 313   1e-99    Populus trichocarpa [western balsam poplar]
ref|XP_011041764.1|  PREDICTED: root phototropism protein 2-like        313   1e-99    Populus euphratica
gb|KDP45678.1|  hypothetical protein JCGZ_17285                         313   2e-99    Jatropha curcas
ref|XP_010094443.1|  Root phototropism protein 2                        313   2e-99    Morus notabilis
ref|XP_004147730.1|  PREDICTED: root phototropism protein 2-like        313   3e-99    Cucumis sativus [cucumbers]
gb|KGN53487.1|  hypothetical protein Csa_4G056750                       313   3e-99    
ref|XP_008451888.1|  PREDICTED: root phototropism protein 2 isofo...    312   7e-99    Cucumis melo [Oriental melon]
ref|XP_002533880.1|  Root phototropism protein, putative                309   3e-98    
gb|ADL36608.1|  BZIP domain class transcription factor                  310   5e-98    Malus domestica [apple tree]
ref|XP_010677799.1|  PREDICTED: root phototropism protein 2             309   7e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004294714.1|  PREDICTED: root phototropism protein 2             309   1e-97    Fragaria vesca subsp. vesca
ref|XP_011011776.1|  PREDICTED: root phototropism protein 2-like        309   2e-97    Populus euphratica
ref|XP_011015900.1|  PREDICTED: root phototropism protein 2-like        308   2e-97    Populus euphratica
ref|XP_008451887.1|  PREDICTED: root phototropism protein 2 isofo...    310   4e-97    
ref|XP_007206420.1|  hypothetical protein PRUPE_ppa003347mg             308   4e-97    Prunus persica
ref|XP_008239576.1|  PREDICTED: root phototropism protein 2 isofo...    307   5e-97    Prunus mume [ume]
ref|XP_009374407.1|  PREDICTED: root phototropism protein 2-like        307   6e-97    Pyrus x bretschneideri [bai li]
ref|XP_008239637.1|  PREDICTED: root phototropism protein 2 isofo...    307   6e-97    Prunus mume [ume]
ref|XP_008366216.1|  PREDICTED: root phototropism protein 2-like        306   8e-97    
ref|XP_002319980.1|  ROOT PHOTOTROPISM 2 family protein                 306   1e-96    
ref|XP_010023564.1|  PREDICTED: root phototropism protein 2             303   1e-95    Eucalyptus grandis [rose gum]
ref|NP_001280895.1|  root phototropism protein 2-like                   303   2e-95    Malus domestica [apple tree]
ref|XP_006591739.1|  PREDICTED: root phototropism protein 2-like        300   6e-95    Glycine max [soybeans]
ref|XP_009355145.1|  PREDICTED: root phototropism protein 2-like        301   7e-95    Pyrus x bretschneideri [bai li]
ref|XP_008349518.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...    301   1e-94    
ref|XP_010557176.1|  PREDICTED: root phototropism protein 2             298   1e-93    Tarenaya hassleriana [spider flower]
ref|XP_006293884.1|  hypothetical protein CARUB_v10022870mg             299   1e-93    Capsella rubella
ref|XP_003544940.2|  PREDICTED: root phototropism protein 2-like        297   3e-93    Glycine max [soybeans]
ref|NP_001280845.1|  root phototropism protein 2-like                   297   4e-93    Malus domestica [apple tree]
ref|XP_007146905.1|  hypothetical protein PHAVU_006G080400g             296   5e-93    Phaseolus vulgaris [French bean]
ref|XP_010522018.1|  PREDICTED: root phototropism protein 2-like        296   6e-93    Tarenaya hassleriana [spider flower]
gb|ACJ85866.1|  unknown                                                 290   7e-93    Medicago truncatula
ref|XP_010469846.1|  PREDICTED: root phototropism protein 2 isofo...    296   2e-92    
ref|XP_003553189.1|  PREDICTED: root phototropism protein 2-like        295   2e-92    Glycine max [soybeans]
ref|XP_003519296.1|  PREDICTED: root phototropism protein 2             295   2e-92    
dbj|BAJ33924.1|  unnamed protein product                                295   3e-92    Eutrema halophilum
ref|XP_007142019.1|  hypothetical protein PHAVU_008G245700g             295   4e-92    Phaseolus vulgaris [French bean]
ref|XP_010414259.1|  PREDICTED: root phototropism protein 2-like        295   4e-92    Camelina sativa [gold-of-pleasure]
gb|KEH28209.1|  root phototropism-like protein                          293   5e-92    Medicago truncatula
gb|AAB63086.1|  unknown protein                                         289   5e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842585.1|  hypothetical protein AMTR_s00077p00161250          294   6e-92    Amborella trichopoda
gb|ACJ85743.1|  unknown                                                 283   7e-92    Medicago truncatula
ref|XP_002881117.1|  hypothetical protein ARALYDRAFT_481966             294   9e-92    
ref|XP_010510344.1|  PREDICTED: root phototropism protein 2-like        293   2e-91    Camelina sativa [gold-of-pleasure]
ref|XP_003616056.1|  Root phototropism protein                          293   2e-91    Medicago truncatula
ref|NP_001031446.1|  Root phototropism protein 2                        290   1e-90    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01791.1|  hypothetical protein                                   290   2e-90    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02185.1|  hypothetical protein                                   290   2e-90    Arabidopsis thaliana [mouse-ear cress]
gb|EPS73802.1|  hypothetical protein M569_00954                         290   2e-90    Genlisea aurea
ref|NP_850147.1|  Root phototropism protein 2                           290   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490729.1|  PREDICTED: root phototropism protein 2-like        289   4e-90    Cicer arietinum [garbanzo]
gb|AAF33112.1|AF181683_1  RPT2                                          289   7e-90    Arabidopsis thaliana [mouse-ear cress]
gb|KFK22949.1|  root phototropism protein 2                             288   3e-89    Arabis alpina [alpine rockcress]
ref|XP_003600551.1|  Root phototropism protein                          285   4e-89    
gb|AES70802.2|  root phototropism-like protein                          285   7e-89    Medicago truncatula
ref|XP_003600550.1|  Root phototropism protein                          285   1e-88    Medicago truncatula
ref|XP_004500391.1|  PREDICTED: root phototropism protein 2-like        283   1e-87    Cicer arietinum [garbanzo]
ref|XP_010044625.1|  PREDICTED: root phototropism protein 2-like        282   1e-87    Eucalyptus grandis [rose gum]
emb|CDY10743.1|  BnaA05g11930D                                          280   2e-86    Brassica napus [oilseed rape]
emb|CDX84827.1|  BnaA03g14030D                                          279   2e-86    
ref|XP_009144295.1|  PREDICTED: root phototropism protein 2             280   2e-86    Brassica rapa
ref|XP_009132742.1|  PREDICTED: root phototropism protein 2-like        279   3e-86    Brassica rapa
emb|CDY23992.1|  BnaC03g16990D                                          277   1e-85    Brassica napus [oilseed rape]
gb|KCW86718.1|  hypothetical protein EUGRSUZ_B03325                     275   1e-84    Eucalyptus grandis [rose gum]
emb|CDY02075.1|  BnaC04g14260D                                          272   1e-83    
ref|XP_009402206.1|  PREDICTED: root phototropism protein 2 isofo...    271   2e-83    
ref|XP_009402205.1|  PREDICTED: root phototropism protein 2 isofo...    271   5e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384760.1|  PREDICTED: root phototropism protein 2-like ...    265   3e-81    
ref|XP_009384759.1|  PREDICTED: root phototropism protein 2-like ...    265   6e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011080638.1|  PREDICTED: root phototropism protein 2             259   2e-78    Sesamum indicum [beniseed]
gb|KHG08105.1|  Root phototropism 2 -like protein                       251   4e-76    Gossypium arboreum [tree cotton]
ref|XP_010922790.1|  PREDICTED: root phototropism protein 2             245   4e-73    Elaeis guineensis
gb|KHN18647.1|  Root phototropism protein 2                             226   9e-69    Glycine soja [wild soybean]
ref|XP_008803009.1|  PREDICTED: root phototropism protein 2             226   1e-65    Phoenix dactylifera
gb|EMS47631.1|  Root phototropism protein 2                             219   3e-65    Triticum urartu
ref|XP_004978520.1|  PREDICTED: root phototropism protein 2-like        224   8e-65    Setaria italica
ref|XP_004977394.1|  PREDICTED: root phototropism protein 2-like        216   2e-62    Setaria italica
ref|XP_008669932.1|  PREDICTED: root phototropism protein 2-like        215   9e-62    Zea mays [maize]
dbj|BAJ91259.1|  predicted protein                                      212   1e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92463.1|  predicted protein                                      211   2e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002450159.1|  hypothetical protein SORBIDRAFT_05g001300          209   2e-59    
gb|KHN24717.1|  Root phototropism protein 2                             194   2e-58    Glycine soja [wild soybean]
ref|XP_006663162.1|  PREDICTED: root phototropism protein 2-like        204   5e-58    
ref|XP_003577852.1|  PREDICTED: root phototropism protein 2             193   2e-53    Brachypodium distachyon [annual false brome]
gb|EEC68739.1|  hypothetical protein OsI_37246                          190   2e-52    Oryza sativa Indica Group [Indian rice]
gb|ABG22339.1|  RPT2, putative, expressed                               189   3e-52    Oryza sativa Japonica Group [Japonica rice]
gb|ABA95649.1|  RPT2, putative, expressed                               188   7e-52    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065596.1|  Os11g0118300                                       188   8e-52    
ref|NP_001066000.1|  Os12g0117400                                       188   1e-51    
gb|EEC67555.1|  hypothetical protein OsI_34888                          188   1e-51    Oryza sativa Indica Group [Indian rice]
gb|AFW55920.1|  putative phototropic-responsive NPH3 family protein     183   1e-49    
ref|XP_008661889.1|  PREDICTED: LOC100281201 isoform X1                 183   1e-49    
ref|NP_001147592.1|  LOC100281201                                       182   3e-49    
ref|XP_002463481.1|  hypothetical protein SORBIDRAFT_01g000540          169   3e-47    
ref|XP_009374446.1|  PREDICTED: putative disease resistance prote...    177   1e-46    Pyrus x bretschneideri [bai li]
ref|XP_002441790.1|  hypothetical protein SORBIDRAFT_08g002330          167   7e-44    
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...    152   8e-39    Nelumbo nucifera [Indian lotus]
ref|XP_010277089.1|  PREDICTED: BTB/POZ domain-containing protein...    151   2e-38    
ref|XP_010277091.1|  PREDICTED: BTB/POZ domain-containing protein...    151   2e-38    
ref|XP_011006800.1|  PREDICTED: BTB/POZ domain-containing protein...    149   6e-38    Populus euphratica
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...    149   7e-38    Populus euphratica
ref|XP_011012052.1|  PREDICTED: BTB/POZ domain-containing protein...    149   7e-38    Populus euphratica
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...    149   7e-38    Populus euphratica
gb|AFK45576.1|  unknown                                                 148   9e-38    Medicago truncatula
ref|XP_008787157.1|  PREDICTED: BTB/POZ domain-containing protein...    147   7e-37    Phoenix dactylifera
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g             146   9e-37    Populus trichocarpa [western balsam poplar]
gb|EEC74727.1|  hypothetical protein OsI_10455                          146   2e-36    Oryza sativa Indica Group [Indian rice]
ref|XP_006380638.1|  hypothetical protein POPTR_0007s10060g             146   2e-36    
gb|AAN77296.1|  Hypothetical protein                                    145   2e-36    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529             145   2e-36    
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843             145   2e-36    Selaginella moellendorffii
gb|KHN36285.1|  BTB/POZ domain-containing protein                       145   3e-36    Glycine soja [wild soybean]
ref|XP_006579934.1|  PREDICTED: BTB/POZ domain-containing protein...    144   4e-36    Glycine max [soybeans]
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...    144   7e-36    Glycine max [soybeans]
ref|XP_008341358.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    144   7e-36    
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...    144   8e-36    
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...    144   9e-36    
ref|XP_002465671.1|  hypothetical protein SORBIDRAFT_01g043470          143   2e-35    
ref|XP_010412681.1|  PREDICTED: putative BTB/POZ domain-containin...    136   5e-35    Camelina sativa [gold-of-pleasure]
ref|XP_002533158.1|  Root phototropism protein, putative                142   5e-35    Ricinus communis
emb|CDP02580.1|  unnamed protein product                                141   7e-35    Coffea canephora [robusta coffee]
ref|XP_003538794.2|  PREDICTED: BTB/POZ domain-containing protein...    141   7e-35    Glycine max [soybeans]
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein         141   8e-35    
ref|XP_006590635.1|  PREDICTED: BTB/POZ domain-containing protein...    141   8e-35    Glycine max [soybeans]
gb|KHN12984.1|  BTB/POZ domain-containing protein                       141   8e-35    Glycine soja [wild soybean]
gb|KJB48679.1|  hypothetical protein B456_008G080700                    138   1e-34    Gossypium raimondii
ref|XP_009411062.1|  PREDICTED: BTB/POZ domain-containing protein...    140   1e-34    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...    140   1e-34    Pyrus x bretschneideri [bai li]
ref|XP_010905283.1|  PREDICTED: BTB/POZ domain-containing protein...    140   2e-34    Elaeis guineensis
gb|ACL53070.1|  unknown                                                 139   2e-34    Zea mays [maize]
ref|XP_010905282.1|  PREDICTED: BTB/POZ domain-containing protein...    140   2e-34    Elaeis guineensis
ref|XP_010028107.1|  PREDICTED: BTB/POZ domain-containing protein...    140   2e-34    Eucalyptus grandis [rose gum]
ref|XP_010028106.1|  PREDICTED: BTB/POZ domain-containing protein...    139   3e-34    Eucalyptus grandis [rose gum]
ref|XP_006600924.1|  PREDICTED: BTB/POZ domain-containing protein...    139   3e-34    Glycine max [soybeans]
ref|XP_010028108.1|  PREDICTED: BTB/POZ domain-containing protein...    139   3e-34    Eucalyptus grandis [rose gum]
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg             139   4e-34    Prunus persica
ref|XP_010559030.1|  PREDICTED: BTB/POZ domain-containing protein...    139   4e-34    Tarenaya hassleriana [spider flower]
tpg|DAA43883.1|  TPA: putative phototropic-responsive NPH3 family...    139   4e-34    
ref|XP_010559028.1|  PREDICTED: BTB/POZ domain-containing protein...    139   4e-34    Tarenaya hassleriana [spider flower]
gb|ACL52494.1|  unknown                                                 138   6e-34    Zea mays [maize]
gb|KJB48678.1|  hypothetical protein B456_008G080700                    138   7e-34    Gossypium raimondii
ref|XP_002989054.1|  hypothetical protein SELMODRAFT_272040             138   1e-33    Selaginella moellendorffii
ref|XP_010086959.1|  BTB/POZ domain-containing protein                  138   1e-33    
gb|KJB48677.1|  hypothetical protein B456_008G080700                    138   1e-33    Gossypium raimondii
ref|XP_002983725.1|  hypothetical protein SELMODRAFT_228979             137   2e-33    Selaginella moellendorffii
ref|XP_004149698.1|  PREDICTED: BTB/POZ domain-containing protein...    137   2e-33    
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g             137   2e-33    Phaseolus vulgaris [French bean]
dbj|BAK07863.1|  predicted protein                                      137   3e-33    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006466487.1|  PREDICTED: BTB/POZ domain-containing protein...    137   3e-33    Citrus sinensis [apfelsine]
gb|KDO78972.1|  hypothetical protein CISIN_1g006971mg                   137   3e-33    Citrus sinensis [apfelsine]
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...    137   3e-33    Nicotiana sylvestris
ref|NP_001152299.1|  transposon protein Mutator sub-class               136   3e-33    Zea mays [maize]
ref|XP_006426057.1|  hypothetical protein CICLE_v10025164mg             136   3e-33    Citrus clementina [clementine]
ref|XP_008368005.1|  PREDICTED: BTB/POZ domain-containing protein...    131   3e-33    
ref|XP_010412682.1|  PREDICTED: putative BTB/POZ domain-containin...    135   4e-33    Camelina sativa [gold-of-pleasure]
ref|XP_009379312.1|  PREDICTED: BTB/POZ domain-containing protein...    135   6e-33    
emb|CDY37857.1|  BnaAnng05180D                                          135   9e-33    Brassica napus [oilseed rape]
ref|XP_004509079.1|  PREDICTED: BTB/POZ domain-containing protein...    135   1e-32    Cicer arietinum [garbanzo]
emb|CAN71562.1|  hypothetical protein VITISV_007563                     135   1e-32    Vitis vinifera
ref|XP_004985270.1|  PREDICTED: BTB/POZ domain-containing protein...    135   1e-32    Setaria italica
gb|EPS72379.1|  hypothetical protein M569_02379                         135   1e-32    Genlisea aurea
ref|XP_002284242.2|  PREDICTED: BTB/POZ domain-containing protein...    135   1e-32    Vitis vinifera
ref|XP_009115683.1|  PREDICTED: BTB/POZ domain-containing protein...    134   1e-32    Brassica rapa
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...    135   1e-32    Pyrus x bretschneideri [bai li]
ref|XP_009115684.1|  PREDICTED: BTB/POZ domain-containing protein...    134   1e-32    Brassica rapa
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...    135   2e-32    Cicer arietinum [garbanzo]
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...    135   2e-32    Cicer arietinum [garbanzo]
gb|KEH27511.1|  phototropic-responsive NPH3 family protein              133   3e-32    Medicago truncatula
ref|XP_004511859.1|  PREDICTED: BTB/POZ domain-containing protein...    134   3e-32    
ref|XP_004511857.1|  PREDICTED: BTB/POZ domain-containing protein...    134   3e-32    
ref|XP_003597110.1|  Root phototropism protein                          133   5e-32    
ref|XP_006339816.1|  PREDICTED: BTB/POZ domain-containing protein...    133   6e-32    Solanum tuberosum [potatoes]
ref|XP_008457767.1|  PREDICTED: BTB/POZ domain-containing protein...    133   7e-32    Cucumis melo [Oriental melon]
ref|XP_008457766.1|  PREDICTED: BTB/POZ domain-containing protein...    133   7e-32    
gb|KFK28391.1|  hypothetical protein AALP_AA8G509000                    132   7e-32    Arabis alpina [alpine rockcress]
ref|XP_004231910.1|  PREDICTED: BTB/POZ domain-containing protein...    132   8e-32    Solanum lycopersicum
gb|AES90666.2|  phototropic-responsive NPH3 family protein              132   1e-31    Medicago truncatula
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...    132   2e-31    Nicotiana tomentosiformis
ref|XP_006393938.1|  hypothetical protein EUTSA_v10003858mg             132   2e-31    Eutrema salsugineum [saltwater cress]
gb|KFK34271.1|  hypothetical protein AALP_AA5G123300                    131   2e-31    Arabis alpina [alpine rockcress]
dbj|BAJ34215.1|  unnamed protein product                                131   2e-31    Eutrema halophilum
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...    131   3e-31    Sesamum indicum [beniseed]
ref|XP_007155848.1|  hypothetical protein PHAVU_003G236800g             130   4e-31    Phaseolus vulgaris [French bean]
gb|KDP32052.1|  hypothetical protein JCGZ_12513                         130   5e-31    Jatropha curcas
ref|XP_010939121.1|  PREDICTED: BTB/POZ domain-containing protein...    130   5e-31    Elaeis guineensis
gb|AAU05485.1|  At5g67385                                               129   1e-30    Arabidopsis thaliana [mouse-ear cress]
ref|NP_680473.2|  phototropic-responsive NPH3-like protein              129   1e-30    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130549.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    129   1e-30    Brassica rapa
ref|XP_010484509.1|  PREDICTED: BTB/POZ domain-containing protein...    129   1e-30    Camelina sativa [gold-of-pleasure]
ref|XP_010426528.1|  PREDICTED: putative BTB/POZ domain-containin...    129   1e-30    Camelina sativa [gold-of-pleasure]
emb|CBI33715.3|  unnamed protein product                                128   2e-30    Vitis vinifera
ref|XP_010464139.1|  PREDICTED: BTB/POZ domain-containing protein...    129   2e-30    Camelina sativa [gold-of-pleasure]
ref|XP_010484507.1|  PREDICTED: BTB/POZ domain-containing protein...    129   2e-30    Camelina sativa [gold-of-pleasure]
gb|KJB43883.1|  hypothetical protein B456_007G221600                    126   3e-30    Gossypium raimondii
ref|XP_001769248.1|  predicted protein                                  128   4e-30    
ref|XP_006290338.1|  hypothetical protein CARUB_v10016995mg             127   4e-30    
ref|XP_006650337.1|  PREDICTED: BTB/POZ domain-containing protein...    128   5e-30    Oryza brachyantha
ref|XP_006364419.1|  PREDICTED: BTB/POZ domain-containing protein...    127   5e-30    Solanum tuberosum [potatoes]
ref|XP_010503666.1|  PREDICTED: putative BTB/POZ domain-containin...    127   6e-30    Camelina sativa [gold-of-pleasure]
ref|XP_006841959.1|  hypothetical protein AMTR_s00144p00020600          127   7e-30    Amborella trichopoda
gb|KJB43882.1|  hypothetical protein B456_007G221600                    126   7e-30    Gossypium raimondii
gb|EEE59569.1|  hypothetical protein OsJ_11863                          126   8e-30    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009780159.1|  PREDICTED: BTB/POZ domain-containing protein...    127   9e-30    Nicotiana sylvestris
gb|ABR25380.1|  transposon protein                                      123   1e-29    Oryza sativa Indica Group [Indian rice]
gb|KJB43880.1|  hypothetical protein B456_007G221600                    126   1e-29    Gossypium raimondii
gb|EYU44474.1|  hypothetical protein MIMGU_mgv1a027075mg                126   2e-29    Erythranthe guttata [common monkey flower]
ref|XP_010687037.1|  PREDICTED: BTB/POZ domain-containing protein...    126   2e-29    Beta vulgaris subsp. vulgaris [field beet]
gb|ABF97836.1|  transposon protein, putative, Mutator sub-class, ...    126   2e-29    Oryza sativa Japonica Group [Japonica rice]
gb|ABF97835.1|  transposon protein, putative, Mutator sub-class, ...    126   2e-29    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561994.1|  PREDICTED: BTB/POZ domain-containing protein...    126   3e-29    Brachypodium distachyon [annual false brome]
gb|AAT85278.1|  NPH3 family protein                                     126   3e-29    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003558544.1|  PREDICTED: BTB/POZ domain-containing protein...    125   3e-29    Brachypodium distachyon [annual false brome]
ref|XP_004294000.1|  PREDICTED: BTB/POZ domain-containing protein...    126   3e-29    Fragaria vesca subsp. vesca
ref|XP_006280202.1|  hypothetical protein CARUB_v10026107mg             125   5e-29    Capsella rubella
ref|XP_002866705.1|  signal transducer                                  125   5e-29    Arabidopsis lyrata subsp. lyrata
ref|XP_006845260.1|  hypothetical protein AMTR_s00005p00262560          125   5e-29    
ref|XP_011096666.1|  PREDICTED: BTB/POZ domain-containing protein...    125   5e-29    Sesamum indicum [beniseed]
ref|XP_001763717.1|  predicted protein                                  125   5e-29    
ref|XP_009103425.1|  PREDICTED: BTB/POZ domain-containing protein...    124   7e-29    Brassica rapa
ref|XP_010234279.1|  PREDICTED: BTB/POZ domain-containing protein...    124   9e-29    Brachypodium distachyon [annual false brome]
ref|XP_008383422.1|  PREDICTED: BTB/POZ domain-containing protein...    124   9e-29    Malus domestica [apple tree]
ref|XP_004982336.1|  PREDICTED: uncharacterized protein LOC101754459    126   9e-29    
ref|XP_009344395.1|  PREDICTED: BTB/POZ domain-containing protein...    124   1e-28    Pyrus x bretschneideri [bai li]
ref|XP_009410501.1|  PREDICTED: BTB/POZ domain-containing protein...    122   2e-28    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573346.1|  PREDICTED: BTB/POZ domain-containing protein...    124   2e-28    Brachypodium distachyon [annual false brome]
ref|NP_001060924.1|  Os08g0130600                                       123   2e-28    
gb|KDP34960.1|  hypothetical protein JCGZ_09248                         123   2e-28    Jatropha curcas
ref|XP_003520918.1|  PREDICTED: BTB/POZ domain-containing protein...    123   2e-28    Glycine max [soybeans]
ref|XP_007133999.1|  hypothetical protein PHAVU_010G010500g             123   3e-28    Phaseolus vulgaris [French bean]
gb|EEC82855.1|  hypothetical protein OsI_27703                          123   3e-28    Oryza sativa Indica Group [Indian rice]
ref|XP_009410500.1|  PREDICTED: BTB/POZ domain-containing protein...    122   3e-28    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001770455.1|  predicted protein                                  122   3e-28    
ref|XP_004134651.1|  PREDICTED: BTB/POZ domain-containing protein...    122   4e-28    Cucumis sativus [cucumbers]
ref|XP_006653803.1|  PREDICTED: BTB/POZ domain-containing protein...    122   4e-28    Oryza brachyantha
ref|XP_002464177.1|  hypothetical protein SORBIDRAFT_01g013680          122   4e-28    Sorghum bicolor [broomcorn]
ref|NP_001280859.1|  BTB/POZ domain-containing protein At1g30440-...    122   4e-28    Malus domestica [apple tree]
ref|XP_008439559.1|  PREDICTED: BTB/POZ domain-containing protein...    122   5e-28    
gb|KJB26098.1|  hypothetical protein B456_004G225600                    122   5e-28    Gossypium raimondii
ref|XP_004166154.1|  PREDICTED: BTB/POZ domain-containing protein...    123   6e-28    
ref|XP_003533834.1|  PREDICTED: BTB/POZ domain-containing protein...    122   6e-28    Glycine max [soybeans]
ref|XP_010679605.1|  PREDICTED: BTB/POZ domain-containing protein...    121   6e-28    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006836308.1|  hypothetical protein AMTR_s00092p00041800          122   6e-28    Amborella trichopoda
ref|XP_010923665.1|  PREDICTED: BTB/POZ domain-containing protein...    122   7e-28    Elaeis guineensis
gb|ADZ04641.1|  hypothetical protein                                    122   7e-28    Oryza punctata
ref|XP_006659093.1|  PREDICTED: BTB/POZ domain-containing protein...    122   7e-28    Oryza brachyantha
ref|NP_001168297.1|  putative phototropic-resoponsive NPH3 family...    122   7e-28    Zea mays [maize]
ref|XP_010905600.1|  PREDICTED: BTB/POZ domain-containing protein...    122   7e-28    Elaeis guineensis
emb|CDY57436.1|  BnaAnng14510D                                          121   7e-28    Brassica napus [oilseed rape]
ref|XP_010317168.1|  PREDICTED: BTB/POZ domain-containing protein...    120   1e-27    
gb|KJB35735.1|  hypothetical protein B456_006G125900                    121   1e-27    Gossypium raimondii
gb|KHG15697.1|  hypothetical protein F383_22812                         121   1e-27    Gossypium arboreum [tree cotton]
ref|XP_004233453.1|  PREDICTED: BTB/POZ domain-containing protein...    121   1e-27    
ref|XP_011468062.1|  PREDICTED: BTB/POZ domain-containing protein...    121   1e-27    Fragaria vesca subsp. vesca
ref|XP_007201187.1|  hypothetical protein PRUPE_ppa002993mg             121   1e-27    Prunus persica
ref|XP_004288469.1|  PREDICTED: BTB/POZ domain-containing protein...    121   1e-27    Fragaria vesca subsp. vesca
ref|XP_009399039.1|  PREDICTED: BTB/POZ domain-containing protein...    121   1e-27    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004488271.1|  PREDICTED: BTB/POZ domain-containing protein...    121   1e-27    Cicer arietinum [garbanzo]
ref|XP_007138529.1|  hypothetical protein PHAVU_009G216900g             121   1e-27    Phaseolus vulgaris [French bean]
ref|XP_011468065.1|  PREDICTED: BTB/POZ domain-containing protein...    120   1e-27    Fragaria vesca subsp. vesca
ref|XP_003546563.1|  PREDICTED: BTB/POZ domain-containing protein...    121   2e-27    
ref|XP_007015158.1|  BZIP domain class transcription factor             121   2e-27    
ref|XP_010275929.1|  PREDICTED: BTB/POZ domain-containing protein...    120   2e-27    
ref|XP_010679598.1|  PREDICTED: BTB/POZ domain-containing protein...    120   2e-27    
gb|AAV50010.1|  phototropic response-like protein                       113   2e-27    
ref|XP_010679597.1|  PREDICTED: BTB/POZ domain-containing protein...    121   2e-27    
ref|XP_003595495.1|  BTB/POZ domain-containing protein                  121   2e-27    
dbj|BAJ87289.1|  predicted protein                                      120   2e-27    
ref|XP_011089989.1|  PREDICTED: BTB/POZ domain-containing protein...    120   2e-27    
ref|XP_010275927.1|  PREDICTED: BTB/POZ domain-containing protein...    120   2e-27    
ref|XP_008784787.1|  PREDICTED: BTB/POZ domain-containing protein...    120   2e-27    
ref|XP_002526612.1|  Root phototropism protein, putative                120   2e-27    
ref|XP_010275928.1|  PREDICTED: BTB/POZ domain-containing protein...    120   2e-27    
gb|KHN41442.1|  BTB/POZ domain-containing protein                       120   2e-27    
ref|XP_010241172.1|  PREDICTED: BTB/POZ domain-containing protein...    120   3e-27    
ref|XP_011089103.1|  PREDICTED: BTB/POZ domain-containing protein...    120   3e-27    
ref|XP_010520662.1|  PREDICTED: putative BTB/POZ domain-containin...    117   3e-27    
ref|XP_010051973.1|  PREDICTED: BTB/POZ domain-containing protein...    120   3e-27    
ref|XP_010241171.1|  PREDICTED: BTB/POZ domain-containing protein...    120   3e-27    
ref|XP_002963864.1|  hypothetical protein SELMODRAFT_141980             120   3e-27    
ref|XP_002521098.1|  protein binding protein, putative                  120   3e-27    
ref|XP_010486408.1|  PREDICTED: putative BTB/POZ domain-containin...    119   3e-27    
gb|EPS73600.1|  hypothetical protein M569_01153                         120   3e-27    
ref|XP_008235484.1|  PREDICTED: BTB/POZ domain-containing protein...    120   3e-27    
ref|XP_006386870.1|  hypothetical protein POPTR_0002s24380g             119   3e-27    
ref|XP_009362255.1|  PREDICTED: BTB/POZ domain-containing protein...    120   4e-27    
ref|XP_010685004.1|  PREDICTED: BTB/POZ domain-containing protein...    119   4e-27    
ref|XP_004247004.1|  PREDICTED: BTB/POZ domain-containing protein...    119   4e-27    
ref|XP_010941535.1|  PREDICTED: BTB/POZ domain-containing protein...    119   5e-27    
ref|XP_010941534.1|  PREDICTED: BTB/POZ domain-containing protein...    119   5e-27    
ref|XP_010683440.1|  PREDICTED: BTB/POZ domain-containing protein...    119   5e-27    
ref|XP_006404081.1|  hypothetical protein EUTSA_v10010248mg             119   5e-27    
emb|CDP05630.1|  unnamed protein product                                119   6e-27    
ref|XP_009763589.1|  PREDICTED: BTB/POZ domain-containing protein...    119   6e-27    
ref|XP_002988267.1|  hypothetical protein SELMODRAFT_447227             119   6e-27    
ref|XP_008225559.1|  PREDICTED: BTB/POZ domain-containing protein...    119   6e-27    
ref|XP_007214533.1|  hypothetical protein PRUPE_ppa002754mg             119   6e-27    
ref|XP_010922793.1|  PREDICTED: BTB/POZ domain-containing protein...    119   6e-27    
ref|XP_009593550.1|  PREDICTED: BTB/POZ domain-containing protein...    119   7e-27    
ref|XP_002281182.1|  PREDICTED: BTB/POZ domain-containing protein...    119   7e-27    
ref|XP_011469652.1|  PREDICTED: BTB/POZ domain-containing protein...    119   7e-27    
emb|CDX90249.1|  BnaA08g17350D                                          119   8e-27    
ref|XP_002317350.2|  hypothetical protein POPTR_0011s09340g             119   8e-27    
ref|XP_004978267.1|  PREDICTED: BTB/POZ domain-containing protein...    119   9e-27    
emb|CDY12841.1|  BnaC07g15920D                                          119   9e-27    
ref|XP_002301784.2|  hypothetical protein POPTR_0002s24380g             118   1e-26    
ref|XP_011015340.1|  PREDICTED: BTB/POZ domain-containing protein...    119   1e-26    
ref|XP_011024680.1|  PREDICTED: BTB/POZ domain-containing protein...    118   1e-26    
dbj|BAF95168.1|  similar to ROOT PHOTOTROPISM2 protein binding          109   1e-26    
ref|XP_009419001.1|  PREDICTED: BTB/POZ domain-containing protein...    118   1e-26    
gb|AFO63285.1|  bZIP6                                                   118   1e-26    
gb|EMT21744.1|  BTB/POZ domain-containing protein                       117   1e-26    
ref|XP_009630229.1|  PREDICTED: BTB/POZ domain-containing protein...    118   1e-26    
gb|KHG21232.1|  hypothetical protein F383_08117                         118   2e-26    
emb|CDY09586.1|  BnaC05g23330D                                          118   2e-26    
ref|XP_003579359.1|  PREDICTED: BTB/POZ domain-containing protein...    118   2e-26    
gb|EMT33147.1|  BTB/POZ domain-containing protein                       118   2e-26    
ref|XP_002445002.1|  hypothetical protein SORBIDRAFT_07g002590          118   2e-26    
ref|NP_001130370.1|  putative phototropic-resoponsive NPH3 family...    117   2e-26    
ref|XP_009406358.1|  PREDICTED: BTB/POZ domain-containing protein...    117   2e-26    
ref|XP_006349069.1|  PREDICTED: BTB/POZ domain-containing protein...    116   3e-26    
ref|XP_007049780.1|  Phototropic-responsive NPH3 family protein         117   3e-26    
ref|XP_002447182.1|  hypothetical protein SORBIDRAFT_06g030040          117   3e-26    
ref|XP_010027852.1|  PREDICTED: putative BTB/POZ domain-containin...    117   3e-26    
emb|CDY27653.1|  BnaUnng00030D                                          117   3e-26    
dbj|BAK04900.1|  predicted protein                                      117   3e-26    
ref|XP_010100164.1|  BTB/POZ domain-containing protein                  117   3e-26    
ref|XP_010056964.1|  PREDICTED: BTB/POZ domain-containing protein...    117   4e-26    
ref|XP_006468280.1|  PREDICTED: BTB/POZ domain-containing protein...    117   4e-26    
gb|EMT33625.1|  BTB/POZ domain-containing protein                       117   4e-26    
ref|XP_006448940.1|  hypothetical protein CICLE_v10014591mg             117   4e-26    
gb|KDO75322.1|  hypothetical protein CISIN_1g006764mg                   117   4e-26    
ref|XP_010036820.1|  PREDICTED: BTB/POZ domain-containing protein...    117   4e-26    
ref|XP_009406573.1|  PREDICTED: BTB/POZ domain-containing protein...    117   4e-26    
ref|XP_010543146.1|  PREDICTED: BTB/POZ domain-containing protein...    117   4e-26    
emb|CAN72130.1|  hypothetical protein VITISV_002335                     117   4e-26    
ref|NP_187478.1|  phototropic-responsive NPH3 family protein            116   4e-26    
ref|XP_010032181.1|  PREDICTED: BTB/POZ domain-containing protein...    117   4e-26    
gb|KDO64171.1|  hypothetical protein CISIN_1g035818mg                   116   5e-26    
ref|XP_009140161.1|  PREDICTED: BTB/POZ domain-containing protein...    117   5e-26    
ref|XP_009140160.1|  PREDICTED: BTB/POZ domain-containing protein...    117   6e-26    
ref|XP_009109587.1|  PREDICTED: BTB/POZ domain-containing protein...    117   6e-26    
ref|XP_006481239.1|  PREDICTED: BTB/POZ domain-containing protein...    116   6e-26    
ref|XP_009397397.1|  PREDICTED: BTB/POZ domain-containing protein...    116   6e-26    
ref|XP_010244572.1|  PREDICTED: BTB/POZ domain-containing protein...    116   6e-26    
gb|EMT10715.1|  BTB/POZ domain-containing protein                       118   7e-26    
ref|XP_010110255.1|  BTB/POZ domain-containing protein                  116   7e-26    
ref|XP_006429637.1|  hypothetical protein CICLE_v10011315mg             116   7e-26    
ref|XP_010244571.1|  PREDICTED: BTB/POZ domain-containing protein...    116   7e-26    
ref|XP_009397396.1|  PREDICTED: BTB/POZ domain-containing protein...    116   8e-26    
ref|XP_011459733.1|  PREDICTED: BTB/POZ domain-containing protein...    116   8e-26    
gb|KDO46252.1|  hypothetical protein CISIN_1g0470461mg                  115   8e-26    
ref|XP_009757420.1|  PREDICTED: BTB/POZ domain-containing protein...    116   8e-26    
gb|KHG00255.1|  hypothetical protein F383_19997                         116   8e-26    
ref|XP_006349068.1|  PREDICTED: BTB/POZ domain-containing protein...    116   8e-26    
ref|XP_010098595.1|  BTB/POZ domain-containing protein                  116   8e-26    
gb|KJB42465.1|  hypothetical protein B456_007G154300                    116   8e-26    
ref|XP_006359095.1|  PREDICTED: BTB/POZ domain-containing protein...    116   8e-26    
ref|XP_006436442.1|  hypothetical protein CICLE_v10031240mg             115   8e-26    
ref|XP_007163074.1|  hypothetical protein PHAVU_001G203800g             116   9e-26    
ref|NP_001266239.1|  Hop-interacting protein THI063                     116   9e-26    
gb|KDP21845.1|  hypothetical protein JCGZ_00632                         115   9e-26    
ref|XP_009783326.1|  PREDICTED: BTB/POZ domain-containing protein...    115   9e-26    
ref|XP_006602728.1|  PREDICTED: BTB/POZ domain-containing protein...    115   9e-26    
gb|ADV56692.1|  NPH3 family protein                                     116   1e-25    
ref|NP_001131511.1|  uncharacterized protein LOC100192849               114   1e-25    
ref|XP_003551322.2|  PREDICTED: BTB/POZ domain-containing protein...    115   1e-25    
ref|XP_004251006.1|  PREDICTED: BTB/POZ domain-containing protein...    115   1e-25    
ref|XP_002298828.2|  phototropic-responsive NPH3 family protein         115   1e-25    
ref|XP_008382632.1|  PREDICTED: BTB/POZ domain-containing protein...    115   1e-25    
ref|XP_011046734.1|  PREDICTED: BTB/POZ domain-containing protein...    115   1e-25    
ref|XP_002961348.1|  hypothetical protein SELMODRAFT_74933              115   1e-25    
gb|KJB55402.1|  hypothetical protein B456_009G074400                    115   1e-25    
ref|XP_004506596.1|  PREDICTED: BTB/POZ domain-containing protein...    115   1e-25    
ref|XP_009792130.1|  PREDICTED: BTB/POZ domain-containing protein...    115   1e-25    
gb|KHN13450.1|  BTB/POZ domain-containing protein                       115   1e-25    
ref|XP_011095171.1|  PREDICTED: BTB/POZ domain-containing protein...    115   1e-25    
gb|KJB55403.1|  hypothetical protein B456_009G074400                    115   1e-25    
gb|KJB55404.1|  hypothetical protein B456_009G074400                    115   1e-25    
ref|XP_003577427.1|  PREDICTED: BTB/POZ domain-containing protein...    115   1e-25    
gb|KFK44855.1|  hypothetical protein AALP_AA1G311200                    115   2e-25    
gb|AAO16690.1|  hypothetical protein-like protein                       115   2e-25    
ref|XP_010109730.1|  BTB/POZ domain-containing protein                  115   2e-25    
ref|NP_196864.1|  phototropic-responsive NPH3 family protein            115   2e-25    
ref|XP_009605138.1|  PREDICTED: BTB/POZ domain-containing protein...    115   2e-25    
emb|CDP03873.1|  unnamed protein product                                114   2e-25    
ref|XP_011089687.1|  PREDICTED: BTB/POZ domain-containing protein...    115   2e-25    
ref|XP_011089689.1|  PREDICTED: BTB/POZ domain-containing protein...    115   2e-25    
ref|NP_001054018.1|  Os04g0636500                                       115   2e-25    
gb|EEC78096.1|  hypothetical protein OsI_17587                          115   2e-25    
ref|XP_010499573.1|  PREDICTED: BTB/POZ domain-containing protein...    115   2e-25    
ref|XP_004246916.1|  PREDICTED: BTB/POZ domain-containing protein...    114   2e-25    
ref|XP_011089686.1|  PREDICTED: BTB/POZ domain-containing protein...    115   2e-25    
ref|XP_009605134.1|  PREDICTED: BTB/POZ domain-containing protein...    115   2e-25    
ref|XP_008794467.1|  PREDICTED: BTB/POZ domain-containing protein...    114   2e-25    
ref|XP_002312014.2|  hypothetical protein POPTR_0008s03850g             114   2e-25    
ref|XP_006415473.1|  hypothetical protein EUTSA_v10007010mg             115   2e-25    
ref|XP_004137290.1|  PREDICTED: putative BTB/POZ domain-containin...    114   2e-25    
ref|XP_006485653.1|  PREDICTED: BTB/POZ domain-containing protein...    114   3e-25    
ref|XP_006443605.1|  hypothetical protein CICLE_v10019330mg             114   3e-25    
ref|XP_004156559.1|  PREDICTED: putative BTB/POZ domain-containin...    114   3e-25    
ref|XP_002890870.1|  phototropic-responsive NPH3 family protein         115   3e-25    
ref|XP_009371616.1|  PREDICTED: BTB/POZ domain-containing protein...    114   3e-25    
ref|XP_006577128.1|  PREDICTED: BTB/POZ domain-containing protein...    113   3e-25    
ref|XP_010905431.1|  PREDICTED: BTB/POZ domain-containing protein...    114   3e-25    
gb|KDP29118.1|  hypothetical protein JCGZ_16507                         114   3e-25    
gb|KEH38919.1|  phototropic-responsive NPH3 family protein              114   3e-25    
ref|XP_003604967.1|  BTB/POZ domain-containing protein                  114   3e-25    
ref|XP_010558762.1|  PREDICTED: putative BTB/POZ domain-containin...    114   4e-25    
ref|XP_009334929.1|  PREDICTED: BTB/POZ domain-containing protein...    114   4e-25    
gb|KFK38267.1|  hypothetical protein AALP_AA3G091600                    114   4e-25    
ref|XP_010492128.1|  PREDICTED: putative BTB/POZ domain-containin...    114   4e-25    
ref|XP_010478425.1|  PREDICTED: BTB/POZ domain-containing protein...    114   4e-25    
ref|XP_009611132.1|  PREDICTED: BTB/POZ domain-containing protein...    114   4e-25    
ref|XP_008647352.1|  PREDICTED: uncharacterized protein LOC100192...    114   4e-25    
ref|XP_008803011.1|  PREDICTED: BTB/POZ domain-containing protein...    114   4e-25    
gb|KHF98556.1|  hypothetical protein F383_12747                         114   4e-25    
ref|XP_008776569.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    114   4e-25    
gb|ABR17518.1|  unknown                                                 114   4e-25    
gb|EYU42051.1|  hypothetical protein MIMGU_mgv1a003173mg                114   5e-25    
gb|ABA99392.2|  transposon protein, putative, Mutator sub-class, ...    114   5e-25    
gb|KHG06087.1|  hypothetical protein F383_05585                         114   5e-25    
ref|XP_008647351.1|  PREDICTED: uncharacterized protein LOC100192...    114   5e-25    
ref|XP_010067313.1|  PREDICTED: BTB/POZ domain-containing protein...    114   5e-25    
gb|ACN35855.1|  unknown                                                 114   5e-25    
gb|KJB27631.1|  hypothetical protein B456_005G002800                    114   5e-25    
ref|XP_009622877.1|  PREDICTED: BTB/POZ domain-containing protein...    114   5e-25    
ref|XP_007009861.1|  Phototropic-responsive NPH3 family protein         114   5e-25    
gb|KHN29482.1|  BTB/POZ domain-containing protein                       114   5e-25    
gb|ACA64834.1|  SKIP interacting protein 17                             114   5e-25    
ref|XP_006306918.1|  hypothetical protein CARUB_v10008482mg             114   6e-25    
ref|NP_174332.1|  phototropic-responsive NPH3-like protein              114   6e-25    
ref|XP_008233313.1|  PREDICTED: BTB/POZ domain-containing protein...    114   6e-25    
ref|XP_008794466.1|  PREDICTED: BTB/POZ domain-containing protein...    114   6e-25    
ref|XP_011090549.1|  PREDICTED: BTB/POZ domain-containing protein...    114   6e-25    
ref|XP_006306917.1|  hypothetical protein CARUB_v10008482mg             114   6e-25    
gb|AFW74482.1|  putative phototropic-responsive NPH3 family protein     114   6e-25    
emb|CDP19145.1|  unnamed protein product                                113   6e-25    
gb|AAF19742.1|AC009917_1  Contains a bZIP transcription factor PF...    114   6e-25    
ref|XP_008776743.1|  PREDICTED: BTB/POZ domain-containing protein...    113   6e-25    
emb|CDX84515.1|  BnaC03g49850D                                          114   6e-25    
ref|XP_006846819.1|  hypothetical protein AMTR_s00148p00085230          113   6e-25    
ref|XP_006356774.1|  PREDICTED: BTB/POZ domain-containing protein...    113   7e-25    
gb|KHN43539.1|  BTB/POZ domain-containing protein                       113   7e-25    
emb|CDY02293.1|  BnaA09g26090D                                          114   7e-25    
ref|XP_004144382.1|  PREDICTED: BTB/POZ domain-containing protein...    113   7e-25    
ref|XP_006604703.1|  PREDICTED: BTB/POZ domain-containing protein...    113   7e-25    
ref|XP_010524688.1|  PREDICTED: BTB/POZ domain-containing protein...    113   7e-25    
gb|KDP26391.1|  hypothetical protein JCGZ_17549                         113   7e-25    
ref|XP_010460834.1|  PREDICTED: BTB/POZ domain-containing protein...    113   7e-25    
ref|XP_010453448.1|  PREDICTED: putative BTB/POZ domain-containin...    113   8e-25    
gb|EYU19133.1|  hypothetical protein MIMGU_mgv1a004464mg                112   8e-25    
ref|XP_006587906.1|  PREDICTED: BTB/POZ domain-containing protein...    112   8e-25    
emb|CAN78287.1|  hypothetical protein VITISV_008137                     113   8e-25    
ref|XP_010931398.1|  PREDICTED: BTB/POZ domain-containing protein...    112   8e-25    
gb|KGN58361.1|  hypothetical protein Csa_3G627720                       113   9e-25    
ref|XP_004970185.1|  PREDICTED: BTB/POZ domain-containing protein...    113   9e-25    
ref|XP_009115147.1|  PREDICTED: BTB/POZ domain-containing protein...    113   9e-25    
ref|XP_003521542.1|  PREDICTED: BTB/POZ domain-containing protein...    113   9e-25    
emb|CDP07841.1|  unnamed protein product                                113   9e-25    
ref|XP_004309683.1|  PREDICTED: BTB/POZ domain-containing protein...    113   1e-24    
gb|EEC69668.1|  hypothetical protein OsI_39098                          114   1e-24    
ref|XP_009337391.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
ref|XP_007159657.1|  hypothetical protein PHAVU_002G256200g             113   1e-24    
gb|KHN28223.1|  BTB/POZ domain-containing protein                       113   1e-24    
ref|XP_006602729.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
ref|NP_001130315.1|  putative phototropic-resoponsive NPH3 family...    113   1e-24    
ref|XP_007033472.1|  Phototropic-responsive NPH3 family protein i...    112   1e-24    
ref|XP_006354400.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
ref|XP_011470995.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
ref|XP_004247086.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
ref|XP_010419951.1|  PREDICTED: putative BTB/POZ domain-containin...    112   1e-24    
ref|XP_002871575.1|  phototropic-responsive NPH3 family protein         112   1e-24    
ref|XP_002466392.1|  hypothetical protein SORBIDRAFT_01g006980          113   1e-24    
ref|XP_004981637.1|  PREDICTED: BTB/POZ domain-containing protein...    113   1e-24    
emb|CBI38224.3|  unnamed protein product                                112   1e-24    
ref|XP_009337389.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
gb|KDP44378.1|  hypothetical protein JCGZ_20058                         112   1e-24    
ref|XP_007033473.1|  Phototropic-responsive NPH3 family protein i...    112   1e-24    
ref|XP_003544563.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24    
ref|XP_001764279.1|  predicted protein                                  112   1e-24    



>ref|XP_011089543.1| PREDICTED: root phototropism protein 2-like [Sesamum indicum]
Length=563

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 186/211 (88%), Gaps = 8/211 (4%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT+ ELSISKFNGIANLV K ARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  361  VDAYLGEIATYGELSISKFNGIANLVPKTARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  420

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D K TP+A+ TRNQLQA
Sbjct  421  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDHK-TPDALTTRNQLQA  479

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            D +LVKENEALRTELL+MKM+I D+Q        S   +S  + +KPTFFSS+SK LGKL
Sbjct  480  DTSLVKENEALRTELLKMKMYIQDIQK-------SQGTTSKGSAKKPTFFSSVSKTLGKL  532

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFKHGSKDTSN+DDG VD+TKPRRRRFSIS
Sbjct  533  NPFKHGSKDTSNIDDGMVDLTKPRRRRFSIS  563



>gb|KJB26283.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=532

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 183/212 (86%), Gaps = 5/212 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYL EIAT VELSISKFNGIANLV KGARKV+DDLYRAIDIYLK+HP LDEIEREKVC
Sbjct  325  VDAYLAEIATAVELSISKFNGIANLVPKGARKVEDDLYRAIDIYLKSHPNLDEIEREKVC  384

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQA
Sbjct  385  SSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQA  444

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LVKENEALRTELL+MKM+I+DMQ        +   S +   RKPTFFSSMSK LGKL
Sbjct  445  DVSLVKENEALRTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKL  500

Query  225  NPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            NPF+HGSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  501  NPFRHGSKDTSHIDDNLGVDVTKPRRRRFSIS  532



>ref|XP_009777101.1| PREDICTED: root phototropism protein 2 [Nicotiana sylvestris]
Length=574

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 182/211 (86%), Gaps = 4/211 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT  +L+I+KFNGIA LV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVC
Sbjct  368  VDAYLGEIATFGDLTIAKFNGIAILVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVC  427

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALY+DQLKIRSG +D  + P+A+ATRNQLQA
Sbjct  428  SVMDTLKLSYEARVHASQNKRLPVQIVLHALYFDQLKIRSGGDDTSNLPDAMATRNQLQA  487

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LVKENEALRTELL+MKM+I+D+Q            +  S  RKPTFFSS+SKKLGKL
Sbjct  488  DVSLVKENEALRTELLKMKMYISDIQK----TSQGTTSAKPSLSRKPTFFSSVSKKLGKL  543

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFKHGSKDTS +DD  VDITKPRRRRFSIS
Sbjct  544  NPFKHGSKDTSMIDDATVDITKPRRRRFSIS  574



>gb|KJB26284.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=574

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 183/212 (86%), Gaps = 5/212 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYL EIAT VELSISKFNGIANLV KGARKV+DDLYRAIDIYLK+HP LDEIEREKVC
Sbjct  367  VDAYLAEIATAVELSISKFNGIANLVPKGARKVEDDLYRAIDIYLKSHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQA
Sbjct  427  SSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQA  486

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LVKENEALRTELL+MKM+I+DMQ        +   S +   RKPTFFSSMSK LGKL
Sbjct  487  DVSLVKENEALRTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKL  542

Query  225  NPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            NPF+HGSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  543  NPFRHGSKDTSHIDDNLGVDVTKPRRRRFSIS  574



>gb|KJB26282.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=558

 Score =   333 bits (853),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 183/212 (86%), Gaps = 5/212 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYL EIAT VELSISKFNGIANLV KGARKV+DDLYRAIDIYLK+HP LDEIEREKVC
Sbjct  351  VDAYLAEIATAVELSISKFNGIANLVPKGARKVEDDLYRAIDIYLKSHPNLDEIEREKVC  410

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQA
Sbjct  411  SSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQA  470

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LVKENEALRTELL+MKM+I+DMQ        +   S +   RKPTFFSSMSK LGKL
Sbjct  471  DVSLVKENEALRTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKL  526

Query  225  NPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            NPF+HGSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  527  NPFRHGSKDTSHIDDNLGVDVTKPRRRRFSIS  558



>ref|XP_009611218.1| PREDICTED: root phototropism protein 2 [Nicotiana tomentosiformis]
Length=575

 Score =   333 bits (853),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 181/211 (86%), Gaps = 4/211 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT  +L+I+KFNGIA LV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVC
Sbjct  369  VDAYLGEIATFGDLTIAKFNGIAILVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVC  428

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALY+DQLKIRSG +D  + P A+ATRNQLQA
Sbjct  429  SVMDTLKLSYEARVHASQNKRLPVQIVLHALYFDQLKIRSGGDDTSNLPEAMATRNQLQA  488

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LVKENEALRTELL+MKM+I+D+Q            +  S  RKPTFFSS+SKKLGKL
Sbjct  489  DVSLVKENEALRTELLKMKMYISDIQK----TSQGTTSAKPSLSRKPTFFSSVSKKLGKL  544

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFKHGSKDTS +DD  VDITKPRRRRFSIS
Sbjct  545  NPFKHGSKDTSMIDDATVDITKPRRRRFSIS  575



>emb|CDP04035.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 179/211 (85%), Gaps = 5/211 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT  E SISKFNGIA LV K ARKVDDD+YRA+DIYLKAHP LDEIEREKVC
Sbjct  368  VDAYLGEIATFSEFSISKFNGIAILVPKAARKVDDDVYRAVDIYLKAHPNLDEIEREKVC  427

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ED K  PNAI TR QLQA
Sbjct  428  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTEDQK-MPNAITTRRQLQA  486

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            D +L +ENE LRTELL+MKM+IAD+Q            ++A++ ++PTFFSSMSK LGKL
Sbjct  487  DTSLARENEELRTELLKMKMYIADLQK----TQGPSTKATAASSKRPTFFSSMSKTLGKL  542

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFKHGSKDTSNLDD  VDI+KPRRRRFSIS
Sbjct  543  NPFKHGSKDTSNLDDALVDISKPRRRRFSIS  573



>ref|XP_006432049.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45289.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=382

 Score =   319 bits (817),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            V  YLGEIAT  ELSISKFNGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+C
Sbjct  169  VGTYLGEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKIC  228

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQA
Sbjct  229  SSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQA  288

Query  405  DVTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+L+KENEALR+EL +MK++I+DMQ     +   S   S  S  +K TFFSSMSK  GK
Sbjct  289  DVSLIKENEALRSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGK  348

Query  228  LNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            LNPFKHGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  349  LNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS  382



>emb|CBI15802.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   313 bits (801),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 182/212 (86%), Gaps = 7/212 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIA H ELSI KFNGIANLV K ARKVDDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  8    VDAYLGEIAAHGELSICKFNGIANLVPKDARKVDDDLYRAIDIFLKAHPNLDEIEREKVC  67

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQA
Sbjct  68   SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQA  124

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENEALR+EL++MKM+I+D+Q   S+ G    G  +    KPTFFSSMSK LGKL
Sbjct  125  DVSLVRENEALRSELMKMKMYISDIQKNSSAGGGKGLGGGSK---KPTFFSSMSKTLGKL  181

Query  225  NPFKHGSKDTSNLDD-GEVDITKPRRRRFSIS  133
            NPF+HGSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  182  NPFRHGSKDTSNIDDETAVDVTKPRRRRFSIS  213



>gb|EYU36889.1| hypothetical protein MIMGU_mgv1a003487mg [Erythranthe guttata]
Length=582

 Score =   324 bits (830),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 184/219 (84%), Gaps = 8/219 (4%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT+ EL ISKFNGIANLV K ARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  364  VDAYLGEIATYGELGISKFNGIANLVPKAARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  423

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQ  409
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL +RSGA ED   TP+A +TRNQLQ
Sbjct  424  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLMLRSGADEDDHKTPDAGSTRNQLQ  483

Query  408  ADVTLVKENEALRTELLQMKMFIADMQN-------kgssqgssvkgssasaVRKPTFFSS  250
            ADV+L KENEALRTELL+MKM+I D+Q          S+  S+   +SAS  RKP FFSS
Sbjct  484  ADVSLAKENEALRTELLKMKMYIQDIQRPQGTTSKAVSTSTSTSASASASTSRKPKFFSS  543

Query  249  MSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            MSK LGKLNPFKHGSKDT NLD+G  D+TKPRRRRFSIS
Sbjct  544  MSKTLGKLNPFKHGSKDTLNLDEGMPDLTKPRRRRFSIS  582



>ref|XP_010244564.1| PREDICTED: root phototropism protein 2 [Nelumbo nucifera]
Length=571

 Score =   323 bits (827),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 180/211 (85%), Gaps = 6/211 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT+ +L+ISKFNGIA LV K ARKVDDDLYRAIDIYLKAH  LDEIEREKVC
Sbjct  367  VDAYLGEIATYEDLAISKFNGIATLVPKTARKVDDDLYRAIDIYLKAHQNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDP KLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D + T +A+ TRNQ+QA
Sbjct  427  SVMDPHKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVIDDRKTQDALMTRNQIQA  486

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+L+KENEALRTELL+MKM+I+D+Q       +    S +   RKPTFFSS+SK LGKL
Sbjct  487  DVSLIKENEALRTELLKMKMYISDLQK------NQGTSSKSGGSRKPTFFSSVSKTLGKL  540

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPF+HGSKDTSN+DD  +D+TKPRRRRFS+S
Sbjct  541  NPFRHGSKDTSNIDDSAIDLTKPRRRRFSVS  571



>ref|XP_006432045.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432047.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45285.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45287.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=541

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            V  YLGEIAT  ELSISKFNGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+C
Sbjct  328  VGTYLGEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKIC  387

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQA
Sbjct  388  SSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQA  447

Query  405  DVTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+L+KENEALR+EL +MK++I+DMQ     +   S   S  S  +K TFFSSMSK  GK
Sbjct  448  DVSLIKENEALRSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGK  507

Query  228  LNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            LNPFKHGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  508  LNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS  541



>ref|XP_007017103.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY34722.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=576

 Score =   319 bits (818),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 182/214 (85%), Gaps = 7/214 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT  EL+I+KFNGIA LV KGARKV+DDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIATVDELTIAKFNGIAILVPKGARKVEDDLYRAIDIYLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAED--PKSTPNAIATRNQL  412
            S MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA D   ++  +A+ATRNQL
Sbjct  427  SSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGAVDDRERNAADAVATRNQL  486

Query  411  QADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  232
            QADV+LVKENEALR+EL +MKM+I+D+Q             SA+  RKPTFFSSMSK LG
Sbjct  487  QADVSLVKENEALRSELKKMKMYISDLQK----NNQGTCSKSAAGNRKPTFFSSMSKTLG  542

Query  231  KLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            KLNPF+HGSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  543  KLNPFRHGSKDTSNIDDSLGVDVTKPRRRRFSIS  576



>ref|XP_006432046.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432048.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006464960.1| PREDICTED: root phototropism protein 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45286.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45288.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=584

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            V  YLGEIAT  ELSISKFNGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+C
Sbjct  371  VGTYLGEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKIC  430

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQA
Sbjct  431  SSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQA  490

Query  405  DVTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+L+KENEALR+EL +MK++I+DMQ     +   S   S  S  +K TFFSSMSK  GK
Sbjct  491  DVSLIKENEALRSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGK  550

Query  228  LNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            LNPFKHGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  551  LNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS  584



>gb|KDO54918.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=541

 Score =   316 bits (810),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 179/214 (84%), Gaps = 3/214 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            V  YLGEIAT  ELSISKFNGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+C
Sbjct  328  VGTYLGEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKIC  387

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQA
Sbjct  388  SSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQA  447

Query  405  DVTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV L+KENEALR+EL +MK++I+D+Q     +   S   S  S  +K TFFSSMSK  GK
Sbjct  448  DVLLIKENEALRSELTRMKLYISDVQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGK  507

Query  228  LNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            LNPFKHGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  508  LNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS  541



>ref|XP_006353728.1| PREDICTED: root phototropism protein 2-like [Solanum tuberosum]
Length=576

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 183/214 (86%), Gaps = 7/214 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT  +LSISKFNGIA LV KGARK DDDLYRA+DIYLKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIATFGDLSISKFNGIAILVPKGARKADDDLYRAVDIYLKAHPHLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--PNAIATRNQL  412
            SVMDPLKLS+EARVHASQNKRLPVQIVLHALY+DQLK+RSGA D  +   P A+ATRNQL
Sbjct  427  SVMDPLKLSHEARVHASQNKRLPVQIVLHALYFDQLKLRSGAADDTNNNMPEAMATRNQL  486

Query  411  QADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  232
            QADV+LVKENE LRTELL+MKM+IAD+Q       +S +G+S   ++K TFFSS+SK LG
Sbjct  487  QADVSLVKENEVLRTELLKMKMYIADIQK----TTTSTQGTSKGGLKKTTFFSSVSKTLG  542

Query  231  KLNPFKHGSKDTSNL-DDGEVDITKPRRRRFSIS  133
            K NPFKHGSKDTSN+ DD  +D+TKPRRRRFSIS
Sbjct  543  KFNPFKHGSKDTSNIVDDAALDLTKPRRRRFSIS  576



>ref|XP_010650806.1| PREDICTED: root phototropism protein 2 isoform X2 [Vitis vinifera]
Length=527

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 182/212 (86%), Gaps = 7/212 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIA H ELSI KFNGIANLV K ARKVDDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  322  VDAYLGEIAAHGELSICKFNGIANLVPKDARKVDDDLYRAIDIFLKAHPNLDEIEREKVC  381

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQA
Sbjct  382  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQA  438

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENEALR+EL++MKM+I+D+Q   S+ G    G  +    KPTFFSSMSK LGKL
Sbjct  439  DVSLVRENEALRSELMKMKMYISDIQKNSSAGGGKGLGGGSK---KPTFFSSMSKTLGKL  495

Query  225  NPFKHGSKDTSNLDD-GEVDITKPRRRRFSIS  133
            NPF+HGSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  496  NPFRHGSKDTSNIDDETAVDVTKPRRRRFSIS  527



>gb|KDO54917.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=584

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 179/214 (84%), Gaps = 3/214 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            V  YLGEIAT  ELSISKFNGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+C
Sbjct  371  VGTYLGEIATSGELSISKFNGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKIC  430

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQA
Sbjct  431  SSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQA  490

Query  405  DVTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV L+KENEALR+EL +MK++I+D+Q     +   S   S  S  +K TFFSSMSK  GK
Sbjct  491  DVLLIKENEALRSELTRMKLYISDVQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGK  550

Query  228  LNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            LNPFKHGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  551  LNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS  584



>ref|XP_004243653.1| PREDICTED: root phototropism protein 2 [Solanum lycopersicum]
Length=576

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 184/214 (86%), Gaps = 7/214 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT  +LSISKFNGIA LV KGARK DDDLYRA+DIYLKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIATFGDLSISKFNGIAILVPKGARKADDDLYRAVDIYLKAHPHLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--PNAIATRNQL  412
            SVMDPLKLS+EARVHASQNKRLPVQIVLHALY+DQLKIRSGA D  +   P A+ATRNQL
Sbjct  427  SVMDPLKLSHEARVHASQNKRLPVQIVLHALYFDQLKIRSGAADDSNNNMPEAMATRNQL  486

Query  411  QADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  232
            QADV+LVKENE LRTELL+MKM+IAD+Q       +S +G+S  +++K TFFSS+SK LG
Sbjct  487  QADVSLVKENEVLRTELLKMKMYIADIQK----TTNSSQGTSKGSLKKTTFFSSVSKTLG  542

Query  231  KLNPFKHGSKDTSNL-DDGEVDITKPRRRRFSIS  133
            K NPFKHGSKDTS++ DD  +D+TKPRRRRFSIS
Sbjct  543  KFNPFKHGSKDTSSIVDDAALDLTKPRRRRFSIS  576



>ref|XP_002264896.1| PREDICTED: root phototropism protein 2 isoform X1 [Vitis vinifera]
Length=572

 Score =   315 bits (806),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 182/212 (86%), Gaps = 7/212 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIA H ELSI KFNGIANLV K ARKVDDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIAAHGELSICKFNGIANLVPKDARKVDDDLYRAIDIFLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQA
Sbjct  427  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQA  483

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENEALR+EL++MKM+I+D+Q   S+ G    G  +    KPTFFSSMSK LGKL
Sbjct  484  DVSLVRENEALRSELMKMKMYISDIQKNSSAGGGKGLGGGSK---KPTFFSSMSKTLGKL  540

Query  225  NPFKHGSKDTSNLDD-GEVDITKPRRRRFSIS  133
            NPF+HGSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  541  NPFRHGSKDTSNIDDETAVDVTKPRRRRFSIS  572



>ref|XP_002325631.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEF00013.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=575

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 184/214 (86%), Gaps = 6/214 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YLGEIAT+ EL+ISKFNGIA LV KGARKVDDDLYRAIDIYLKAHP LDE+EREKVC
Sbjct  365  VDSYLGEIATYPELTISKFNGIATLVRKGARKVDDDLYRAIDIYLKAHPNLDEMEREKVC  424

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEAR+HASQNKRLPVQIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+
Sbjct  425  SVMDPLKLSYEARLHASQNKRLPVQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQS  481

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV--RKPTFFSSMSKKLG  232
            DV+LV ENEALR+EL +MK++I+DMQ    S   S+  ++A+    RK TFFSSMSK LG
Sbjct  482  DVSLVSENEALRSELTKMKLYISDMQKDKGSSAKSISAAAATTSGPRKHTFFSSMSKTLG  541

Query  231  KLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            KLNPFKHGSKDTS++DD   VDITKPRRRRFS+S
Sbjct  542  KLNPFKHGSKDTSHIDDNIAVDITKPRRRRFSVS  575



>ref|XP_011041764.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=574

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 186/213 (87%), Gaps = 5/213 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YLGEIAT+ EL+ISKFNGIA LV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  365  VDSYLGEIATYPELTISKFNGIATLVRKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  424

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEAR+HASQNKRLP+QIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+
Sbjct  425  SVMDPLKLSYEARIHASQNKRLPLQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQS  481

Query  405  DVTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+LV ENEALR+EL +MK++I++MQ NKGSS  S    ++ S  RK TFFSSMSK LGK
Sbjct  482  DVSLVSENEALRSELKKMKLYISEMQKNKGSSAKSISAAAATSGPRKHTFFSSMSKTLGK  541

Query  228  LNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            LNPFKHGSKDTS++DD   VDITKPRRRRFS+S
Sbjct  542  LNPFKHGSKDTSHIDDNLAVDITKPRRRRFSVS  574



>gb|KDP45678.1| hypothetical protein JCGZ_17285 [Jatropha curcas]
Length=575

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 181/213 (85%), Gaps = 7/213 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +DAYLGEIAT+ E+ ISKFNGIA LV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  368  IDAYLGEIATYGEVGISKFNGIAILVPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  427

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA-TRNQLQ  409
            SVMDPLKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG  +  +    ++ T+NQLQ
Sbjct  428  SVMDPLKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGVVESSTPETPVSNTKNQLQ  487

Query  408  ADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGK  229
             DV+L++ENEALR+EL +MK++I+DMQ       S+   S+ S  RKPTFFSSMSK LGK
Sbjct  488  TDVSLIRENEALRSELTKMKLYISDMQK-----NSNQGSSTKSGSRKPTFFSSMSKTLGK  542

Query  228  LNPFKHGSKDTSNLDDGE-VDITKPRRRRFSIS  133
            LNPFKHGSKDTS+LDDG  +DITKPRRRRFSIS
Sbjct  543  LNPFKHGSKDTSHLDDGAGIDITKPRRRRFSIS  575



>ref|XP_010094443.1| Root phototropism protein 2 [Morus notabilis]
 gb|EXB56024.1| Root phototropism protein 2 [Morus notabilis]
Length=574

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 179/211 (85%), Gaps = 3/211 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +DAYLGEIA ++EL+ISKFNGIANLV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  367  IDAYLGEIAAYLELTISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D      A   R+QLQA
Sbjct  427  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVADDHDAKEAATARSQLQA  486

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENEALR EL +MK++I D+Q   + Q ++    +  + ++PTFFSS+SK LGKL
Sbjct  487  DVSLVRENEALRAELTKMKLYITDIQK--NGQTTATSSRAVGSTKRPTFFSSVSKTLGKL  544

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFKHGSKDTS+++D  VDI+KPRRRRFSIS
Sbjct  545  NPFKHGSKDTSHIED-VVDISKPRRRRFSIS  574



>ref|XP_004147730.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
 ref|XP_004164428.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
Length=582

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 181/214 (85%), Gaps = 7/214 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT+ ELSISKFNGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  373  VDAYLGEIATYGELSISKFNGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQ  415
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    AT  R Q
Sbjct  433  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAATMARTQ  492

Query  414  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
             QADV+LVKENEALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK L
Sbjct  493  AQADVSLVKENEALRSELMKMKLYISDMQKSSQGTSSIKVPTSRS---KGTFFSSVSKTL  549

Query  234  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            GKLNPF+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  550  GKLNPFRHGSKDTSNIDDG-IDITKPRRRRFSIS  582



>gb|KGN53487.1| hypothetical protein Csa_4G056750 [Cucumis sativus]
Length=572

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 181/214 (85%), Gaps = 7/214 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT+ ELSISKFNGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  363  VDAYLGEIATYGELSISKFNGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  422

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQ  415
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    AT  R Q
Sbjct  423  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAATMARTQ  482

Query  414  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
             QADV+LVKENEALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK L
Sbjct  483  AQADVSLVKENEALRSELMKMKLYISDMQKSSQGTSSIKVPTSRS---KGTFFSSVSKTL  539

Query  234  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            GKLNPF+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  540  GKLNPFRHGSKDTSNIDDG-IDITKPRRRRFSIS  572



>ref|XP_008451888.1| PREDICTED: root phototropism protein 2 isoform X2 [Cucumis melo]
Length=582

 Score =   312 bits (799),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 181/214 (85%), Gaps = 7/214 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT+ ELSISKFNGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  373  VDAYLGEIATYGELSISKFNGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQ  415
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    A+  R Q
Sbjct  433  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAASMARTQ  492

Query  414  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
             QADV+LVKENEALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK L
Sbjct  493  AQADVSLVKENEALRSELMKMKLYISDMQRSSQGTSSIKVPTSRS---KGTFFSSVSKTL  549

Query  234  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            GKLNPF+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  550  GKLNPFRHGSKDTSNIDDG-IDITKPRRRRFSIS  582



>ref|XP_002533880.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF28503.1| Root phototropism protein, putative [Ricinus communis]
Length=549

 Score =   309 bits (792),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 179/214 (84%), Gaps = 9/214 (4%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT+ EL ISKFNGIA LV KG+R VDDDLYRAIDIYLK+HP LDEIEREKVC
Sbjct  342  VDAYLGEIATYSELGISKFNGIAMLVPKGSRGVDDDLYRAIDIYLKSHPHLDEIEREKVC  401

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA--TRNQL  412
            SVMDPLKLSYEAR+HASQNKRLPVQIVLH LY+DQLK+RSG  D +STP A+A  T++QL
Sbjct  402  SVMDPLKLSYEARLHASQNKRLPVQIVLHCLYFDQLKLRSGVAD-RSTPEAMAPNTKSQL  460

Query  411  QADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  232
            Q DV+L++ENEALR+EL++MK++I DMQ       S    S+    RK TFFSSMSK LG
Sbjct  461  QTDVSLIRENEALRSELMKMKLYITDMQK-----SSQGTTSARGGPRKTTFFSSMSKTLG  515

Query  231  KLNPFKHGSKDTSNLDDGE-VDITKPRRRRFSIS  133
            KLNPFKHGSKDTS++DD   VDITKPRRRRFSIS
Sbjct  516  KLNPFKHGSKDTSHIDDSAGVDITKPRRRRFSIS  549



>gb|ADL36608.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 176/212 (83%), Gaps = 2/212 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT VELSISKFNGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIATCVELSISKFNGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+++Q 
Sbjct  427  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSRVQH  485

Query  405  DVTLVKENEALRTELLQMKMFIADMQNk-gssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+L +ENE LRTELL+MKM+I DMQ    +   ++  G      +K TFFSS+SKKLGK
Sbjct  486  DVSLARENEELRTELLKMKMYITDMQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGK  545

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPFK GSKDTSN+ D  VDI+KPRRRRFSIS
Sbjct  546  LNPFKQGSKDTSNIIDDGVDISKPRRRRFSIS  577



>ref|XP_010677799.1| PREDICTED: root phototropism protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   309 bits (792),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 157/211 (74%), Positives = 177/211 (84%), Gaps = 5/211 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIA +  LSISKFNGIANLV K AR+ DDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  376  VDAYLGEIANYASLSISKFNGIANLVPKDARRTDDDLYRAIDIYLKAHPNLDEIEREKVC  435

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S MDPLKLSYEARVHASQNKRLPVQ+VLHALYYDQLK+RSGA D    P+AIATR Q++A
Sbjct  436  SSMDPLKLSYEARVHASQNKRLPVQMVLHALYYDQLKLRSGAND-GPLPDAIATRGQVKA  494

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            D +L KENEAL++EL++MKM+I+DMQ   ++   +   +      K TFFSSMSK LGKL
Sbjct  495  DASLAKENEALKSELMKMKMYISDMQKNKATTSRTSTATGMP---KRTFFSSMSKTLGKL  551

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFKHGSKDTS+LDD EVD+TKPRRRRFSIS
Sbjct  552  NPFKHGSKDTSHLDD-EVDLTKPRRRRFSIS  581



>ref|XP_004294714.1| PREDICTED: root phototropism protein 2 [Fragaria vesca subsp. 
vesca]
Length=581

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 184/215 (86%), Gaps = 5/215 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT  ELSISKFNGIA LV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVC
Sbjct  368  VDAYLGEIATCTELSISKFNGIAVLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVC  427

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG E+ ++  +A +TRNQ+QA
Sbjct  428  SVMDALKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGEEENETQIDAASTRNQVQA  487

Query  405  DVTLVKENEALRTELLQMKMFIADMQN----kgssqgssvkgssasaVRKPTFFSSMSKK  238
            DV+L KENE LRTELL+MKM+I+D++      G+S  ++  G      RKPTFFSS+SKK
Sbjct  488  DVSLAKENEVLRTELLKMKMYISDIKKSGGGAGASAATTSSGKGGGGPRKPTFFSSVSKK  547

Query  237  LGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LGKLNPFK+GSKDTSN+DD  VD+TKPRRRRFSIS
Sbjct  548  LGKLNPFKNGSKDTSNIDDC-VDVTKPRRRRFSIS  581



>ref|XP_011011776.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=595

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 184/215 (86%), Gaps = 7/215 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YLGEIAT+ +L+ISKFNGIA LV KGARKVDDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  384  VDSYLGEIATYPDLTISKFNGIAILVPKGARKVDDDLYRAIDIFLKAHPNLDEIEREKVC  443

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG +D    P+A+ATR+QLQ+
Sbjct  444  SVMDPLKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGVDD---QPDAVATRSQLQS  500

Query  405  DVTLVKENEALRTELLQMKMFIADM---QNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
            DV+LV+ENEALR+EL++MK++I+DM   Q   +   ++    + +  RK +FFSSMSK L
Sbjct  501  DVSLVRENEALRSELMKMKLYISDMQKNQGSSTKGIAAAAAPTTTGSRKHSFFSSMSKTL  560

Query  234  GKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            GKLNPFKHGSKDT +++D   VDITKPRRRRFSIS
Sbjct  561  GKLNPFKHGSKDTLHINDNIGVDITKPRRRRFSIS  595



>ref|XP_011015900.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=579

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 185/218 (85%), Gaps = 10/218 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YLGEIAT+ EL+ISKFNGI+ LV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  365  VDSYLGEIATYPELTISKFNGISTLVRKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  424

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEAR+HASQNKRLP+QIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+
Sbjct  425  SVMDPLKLSYEARIHASQNKRLPLQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQS  481

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV------RKPTFFSSMS  244
            DV+LV ENEALR+EL +MK++I++MQ    S   S+  ++A+A       RK TFFSSMS
Sbjct  482  DVSLVSENEALRSELKKMKLYISEMQKNKGSSAKSISAAAAAAAAATSGPRKHTFFSSMS  541

Query  243  KKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            K LGKLNPFKHGSKDTS++DD   VDITKPRRRRFS+S
Sbjct  542  KTLGKLNPFKHGSKDTSHIDDNLAVDITKPRRRRFSVS  579



>ref|XP_008451887.1| PREDICTED: root phototropism protein 2 isoform X1 [Cucumis melo]
Length=666

 Score =   310 bits (794),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 181/214 (85%), Gaps = 7/214 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT+ ELSISKFNGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  457  VDAYLGEIATYGELSISKFNGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  516

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQ  415
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST    A+  R Q
Sbjct  517  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAASMARTQ  576

Query  414  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
             QADV+LVKENEALR+EL++MK++I+DMQ       S    +S S   K TFFSS+SK L
Sbjct  577  AQADVSLVKENEALRSELMKMKLYISDMQRSSQGTSSIKVPTSRS---KGTFFSSVSKTL  633

Query  234  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            GKLNPF+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  634  GKLNPFRHGSKDTSNIDDG-IDITKPRRRRFSIS  666



>ref|XP_007206420.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
 gb|EMJ07619.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
Length=583

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 176/217 (81%), Gaps = 6/217 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIA  V+LSISKFNGIANLV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIAPCVDLSISKFNGIANLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++     +A+ TR+Q+Q 
Sbjct  427  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENDMMQDAVTTRSQVQQ  486

Query  405  DVTLVKENEALRTELLQMKMFIADMQNk------gssqgssvkgssasaVRKPTFFSSMS  244
            DV+L +ENE+LRTELL+MKM+I D+Q             ++  G      RK TFFSS+S
Sbjct  487  DVSLARENESLRTELLRMKMYITDLQKSGPAAKGSLGSATTSSGKGGGGPRKGTFFSSVS  546

Query  243  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            KKLGKLNPFK GSKDTSN+ D  VDITKPRRRRFSIS
Sbjct  547  KKLGKLNPFKQGSKDTSNIMDEGVDITKPRRRRFSIS  583



>ref|XP_008239576.1| PREDICTED: root phototropism protein 2 isoform X1 [Prunus mume]
Length=584

 Score =   307 bits (787),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 179/218 (82%), Gaps = 7/218 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT V+LSISKFNGIANLV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIATCVDLSISKFNGIANLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +   +A+ TR+Q+Q 
Sbjct  427  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENEMMQDAVTTRSQVQQ  486

Query  405  DVTLVKENEALRTELLQMKMFIADMQNk------gssqgssvkgssasaVRKPTFFSSMS  244
            DV+L +ENE+LRTELL+MKM+I+D+Q             ++  G      RK TFFSS+S
Sbjct  487  DVSLARENESLRTELLRMKMYISDLQKSGPAAKGSLGAATTSSGKGGGGPRKGTFFSSVS  546

Query  243  KKLGKLNPFKHGSK-DTSNLDDGEVDITKPRRRRFSIS  133
            KKLGKLNPFK GSK DTSN+ D  VDITKPRRRRFSIS
Sbjct  547  KKLGKLNPFKQGSKDDTSNIMDEGVDITKPRRRRFSIS  584



>ref|XP_009374407.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   307 bits (786),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 174/212 (82%), Gaps = 2/212 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT VEL I KFNGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIATCVELGIPKFNGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +A+ TR+Q+Q 
Sbjct  427  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAVTTRSQVQH  485

Query  405  DVTLVKENEALRTELLQMKMFIADMQNk-gssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+L +ENE LRTELL+MKM+I D+Q    +   ++  G      +K TFFSS+SKKLGK
Sbjct  486  DVSLARENEELRTELLKMKMYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGK  545

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPFK GSKDTSN+ D  VDITKPRRRRFSIS
Sbjct  546  LNPFKQGSKDTSNIMDEGVDITKPRRRRFSIS  577



>ref|XP_008239637.1| PREDICTED: root phototropism protein 2 isoform X2 [Prunus mume]
Length=584

 Score =   307 bits (786),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 179/218 (82%), Gaps = 7/218 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT V+LSISKFNGIANLV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIATCVDLSISKFNGIANLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +   +A+ TR+Q+Q 
Sbjct  427  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENEMMQDAVTTRSQVQQ  486

Query  405  DVTLVKENEALRTELLQMKMFIADMQNk------gssqgssvkgssasaVRKPTFFSSMS  244
            DV+L +ENE+LRTELL+MKM+I+D+Q             ++  G      RK TFFSS+S
Sbjct  487  DVSLARENESLRTELLRMKMYISDLQKSGPAAKGSLGAATTSSGKGGGGPRKGTFFSSVS  546

Query  243  KKLGKLNPFKHGSK-DTSNLDDGEVDITKPRRRRFSIS  133
            KKLGKLNPFK GSK DTSN+ D  VDITKPRRRRFSIS
Sbjct  547  KKLGKLNPFKQGSKDDTSNIMDEGVDITKPRRRRFSIS  584



>ref|XP_008366216.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=577

 Score =   306 bits (785),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 175/212 (83%), Gaps = 2/212 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT VELSISKFNGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIATCVELSISKFNGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q 
Sbjct  427  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGX-DENDVQDAITTRSQVQH  485

Query  405  DVTLVKENEALRTELLQMKMFIADMQNk-gssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+L +ENE LRTELL+MK +I D+Q    +   ++  G      +K TFFSS+SKKLGK
Sbjct  486  DVSLARENEELRTELLKMKXYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGK  545

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPFK GSKDTSN+ D  VDI+KPRRRRFSIS
Sbjct  546  LNPFKXGSKDTSNIIDDGVDISKPRRRRFSIS  577



>ref|XP_002319980.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEE95903.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=578

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 183/215 (85%), Gaps = 7/215 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YLGEIA++ +L+ISKFNGIA LV KGARKVDDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  367  VDSYLGEIASYPDLTISKFNGIAILVPKGARKVDDDLYRAIDIFLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG  D    P+A+ATR+QLQ+
Sbjct  427  SVMDPLKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGVND---QPDAVATRSQLQS  483

Query  405  DVTLVKENEALRTELLQMKMFIADM---QNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
            DV+LV+ENEALR+EL++MK++I+DM   Q   +   ++    + +  RK +FFSSMSK L
Sbjct  484  DVSLVRENEALRSELMKMKLYISDMQKNQGSSTKGIAATAAPTTTGSRKHSFFSSMSKTL  543

Query  234  GKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            GKLNPFKHGSKDT +++D   VDITKPRRRRFSIS
Sbjct  544  GKLNPFKHGSKDTFHINDNIGVDITKPRRRRFSIS  578



>ref|XP_010023564.1| PREDICTED: root phototropism protein 2 [Eucalyptus grandis]
 gb|KCW59867.1| hypothetical protein EUGRSUZ_H02604 [Eucalyptus grandis]
Length=570

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 178/211 (84%), Gaps = 7/211 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT+ E+SI+KFNGIA +V KGARKVDDDLYRAIDIYLK+HP LDEIEREK C
Sbjct  367  VDAYLGEIATYSEVSITKFNGIATIVPKGARKVDDDLYRAIDIYLKSHPNLDEIEREKAC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S +DPLKLS EAR+HASQNKRLPVQIVLHALYYDQLK+RSG ED K  P+A+ TR+QLQA
Sbjct  427  SALDPLKLSPEARLHASQNKRLPVQIVLHALYYDQLKLRSGTEDHKG-PDAVTTRHQLQA  485

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            D +L+KENE LR+EL++MKM+I+D+Q       +    S+    ++ TFFSSMSK LGKL
Sbjct  486  DSSLIKENEDLRSELMKMKMYISDLQK-----TNHGTTSAKGGPKRHTFFSSMSKTLGKL  540

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPF+HGSKDTSN++D  VDITKPR+RRFSIS
Sbjct  541  NPFRHGSKDTSNIEDA-VDITKPRKRRFSIS  570



>ref|NP_001280895.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36607.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 175/212 (83%), Gaps = 2/212 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT V LSISKFNGIA+L+ KGARKVDDDLYRAIDIYLKAHP LDEIE+EKVC
Sbjct  367  VDAYLGEIATCVGLSISKFNGIASLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEKEKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q 
Sbjct  427  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSQVQH  485

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+L +ENE LRTELL+MKM+I D+   G ++  ++         +K  FFSSMSKKLG+
Sbjct  486  DVSLARENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGGGPKKAKFFSSMSKKLGR  545

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPFK GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct  546  LNPFKQGSKDTSNIMDEDVDITKPRRRRFSIS  577



>ref|XP_006591739.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=516

 Score =   300 bits (768),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 181/219 (83%), Gaps = 13/219 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYL EIA + +LSISKFNGIA L+ K ARK+DDDLYRA+DIYLKAHPQLDEIEREKVC
Sbjct  303  VDAYLSEIAAYGDLSISKFNGIATLIPKSARKIDDDLYRAVDIYLKAHPQLDEIEREKVC  362

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQ  409
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+ +     +AT +NQLQ
Sbjct  363  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNQLQ  417

Query  408  ADVTLVKENEALRTELLQMKMFIADMQNkgssqg-------ssvkgssasaVRKPTFFSS  250
             DVTLV+ENE LRTEL++MKM+I+D+Q   ++          +   ++    +K TFFSS
Sbjct  418  MDVTLVRENEELRTELMKMKMYISDLQQNKNTNNGANPQGHGTTSSAANPNPKKATFFSS  477

Query  249  MSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +SK LGKLNPF++GSKDT++L+DG VD+TKPRRRRFS+S
Sbjct  478  VSKTLGKLNPFRNGSKDTTHLEDGNVDLTKPRRRRFSVS  516



>ref|XP_009355145.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   301 bits (772),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 174/212 (82%), Gaps = 2/212 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT V LSISKFNGIA+L+ KGARKVDDDLYRAIDIYLKAHP LDEIE+EKVC
Sbjct  367  VDAYLGEIATCVGLSISKFNGIASLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEKEKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG E+     +A  TR Q+Q 
Sbjct  427  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVEE-NDVQDATMTRRQVQH  485

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+L +ENE LRTELL+MKM+I D+Q  G +   ++         +K TFFSS+SKKLG+
Sbjct  486  DVSLARENEELRTELLKMKMYITDLQKTGPAGVATTSSCKGGGGPKKATFFSSVSKKLGR  545

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPFK GSKDT N+ D +VD+TKPRRRRFSIS
Sbjct  546  LNPFKQGSKDTMNIVDEDVDLTKPRRRRFSIS  577



>ref|XP_008349518.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 2-like 
[Malus domestica]
Length=577

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 173/212 (82%), Gaps = 2/212 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT  ELSISKFNGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  367  VDAYLGEIATCXELSISKFNGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNK  PVQIVLHALYYDQLK+RSG  +     +AI TR+Q+Q 
Sbjct  427  SVMDALKLSYEARVHASQNKTTPVQIVLHALYYDQLKLRSGXXE-NDVQDAITTRSQVQH  485

Query  405  DVTLVKENEALRTELLQMKMFIADMQNk-gssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+L +ENE LRTELL+MKM+I D+Q    +   ++  G      +K TFFSS+SKKLGK
Sbjct  486  DVSLARENEELRTELLKMKMYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGK  545

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPFK GSKDTSN+ D  VDI+KPRRRRFSIS
Sbjct  546  LNPFKXGSKDTSNIIDDGVDISKPRRRRFSIS  577



>ref|XP_010557176.1| PREDICTED: root phototropism protein 2 [Tarenaya hassleriana]
Length=575

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 171/212 (81%), Gaps = 5/212 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYL EIAT+ ELSISKFNGIANLV K ARKVDDDLYRA+DI+LK+HP LDEIEREKVC
Sbjct  368  VDAYLAEIATYGELSISKFNGIANLVPKSARKVDDDLYRAVDIFLKSHPNLDEIEREKVC  427

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S +DPLKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +  P  +A R QLQ 
Sbjct  428  SSIDPLKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEE-RDAPEGLAIRGQLQT  486

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+L KENEALRTEL +MKM+I+DMQ        +   S  S     TFFSS+SK LGKL
Sbjct  487  DVSLAKENEALRTELTKMKMYISDMQKNQGGGVGASSSSKKSKH---TFFSSVSKTLGKL  543

Query  225  NPFKHGSKDTSNLDD-GEVDITKPRRRRFSIS  133
            NPF+ GSKDT NLDD G VDITKPRRRRFSIS
Sbjct  544  NPFRQGSKDTLNLDDAGGVDITKPRRRRFSIS  575



>ref|XP_006293884.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
 gb|EOA26782.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
Length=593

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 179/221 (81%), Gaps = 10/221 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATR  421
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +       P A+ TR
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDQEERAVVVLPEALKTR  492

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP---TFFSS  250
            +QLQAD TL KENEALR+EL++MKM+++DMQ   +  G+S   SS+    K    TFFSS
Sbjct  493  SQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSNKKSKNTFFSS  552

Query  249  MSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            +SKKLGKLNPFKHGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  553  VSKKLGKLNPFKHGSKDTSNIDEDLAGVDITKPRRRRFSIS  593



>ref|XP_003544940.2| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=579

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 173/211 (82%), Gaps = 2/211 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YL EIA + ELSISKFNGIA L+ KG+RK DDDLYRA+DIYLK HP LDEIE+EKVC
Sbjct  371  VDTYLAEIAAYGELSISKFNGIAILIPKGSRKSDDDLYRAVDIYLKVHPNLDEIEKEKVC  430

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SV+DPLKLSYEARVHAS+NKRLP+QIVLHALYYDQL IRSG  + K    A+A + QLQA
Sbjct  431  SVLDPLKLSYEARVHASKNKRLPLQIVLHALYYDQLHIRSGTAEEK-VALAVAEKKQLQA  489

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENE LR+EL++MKMFI+DMQ       SS    +    +KPTFFSSMSKKL KL
Sbjct  490  DVSLVRENEELRSELMKMKMFISDMQK-HGHGTSSSGRENIGLAKKPTFFSSMSKKLSKL  548

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFK+GSKDTS++DD  VD+TKPRRRRFSIS
Sbjct  549  NPFKNGSKDTSHIDDAPVDLTKPRRRRFSIS  579



>ref|NP_001280845.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36603.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 174/212 (82%), Gaps = 2/212 (1%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIAT V LSISKFNGIA+L+ KGARKVDDDLYRAIDIYLK+HP LDEIE+EKVC
Sbjct  367  VDAYLGEIATCVGLSISKFNGIASLIPKGARKVDDDLYRAIDIYLKSHPNLDEIEKEKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q 
Sbjct  427  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSQVQH  485

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGK  229
            DV+L +ENE LRTELL+MKM+I D+   G ++  ++         +K  FFS +SKKLG+
Sbjct  486  DVSLARENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGGGPKKAKFFSYVSKKLGR  545

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPFK GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct  546  LNPFKQGSKDTSNIVDEDVDITKPRRRRFSIS  577



>ref|XP_007146905.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
 gb|ESW18899.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
Length=573

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 183/215 (85%), Gaps = 9/215 (4%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +DAYL EIA H +L+ISKFNGIA LV K ARKVDDD+YRA+DIYLKAHP+LDEIEREKVC
Sbjct  364  IDAYLAEIAAHGDLNISKFNGIAILVPKSARKVDDDIYRAVDIYLKAHPKLDEIEREKVC  423

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQ  409
            SVMDPLKLSYEAR+HASQNKRLPVQIVLHALYYDQL++RSGAE+ +     +AT +N+L 
Sbjct  424  SVMDPLKLSYEARLHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNELH  478

Query  408  ADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv---kgssasaVRKPTFFSSMSKK  238
             DV+LV+ENE LRTELL+MKM+I+DMQNK  +   S      +S+ + +K TFFSS+SK 
Sbjct  479  MDVSLVRENEELRTELLKMKMYISDMQNKNVNNAESTHGNGTTSSGSTKKATFFSSVSKT  538

Query  237  LGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LG+LNPF++GSKDT++L+DG VD++KPRRRRFS+S
Sbjct  539  LGRLNPFRNGSKDTTHLEDGNVDLSKPRRRRFSMS  573



>ref|XP_010522018.1| PREDICTED: root phototropism protein 2-like [Tarenaya hassleriana]
Length=572

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 171/212 (81%), Gaps = 6/212 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YL EIAT+ ELSI KFNG ANLV K ARKVDDDLYRA+DIYLKAHP LDEIEREK C
Sbjct  366  VDIYLAEIATYGELSIPKFNGFANLVPKAARKVDDDLYRAVDIYLKAHPNLDEIEREKAC  425

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S MDPLKLSYEAR+HASQNKRLPV IVLHALYYD LK+RSG ED +  P A+  R QLQ 
Sbjct  426  SSMDPLKLSYEARLHASQNKRLPVNIVLHALYYDNLKLRSGKED-RDVPEAMEIRGQLQK  484

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+L KENEALRTEL++MKM+++DMQ    S G+S     +    K TFFSS+SK LGKL
Sbjct  485  DVSLEKENEALRTELMKMKMYVSDMQKNQGSVGASSLSKKS----KYTFFSSVSKTLGKL  540

Query  225  NPFKHGSKDTSNL-DDGEVDITKPRRRRFSIS  133
            NPF+HG+KDTSN+ DD  VDITKPRRRRFSIS
Sbjct  541  NPFRHGAKDTSNIDDDSGVDITKPRRRRFSIS  572



>gb|ACJ85866.1| unknown [Medicago truncatula]
Length=376

 Score =   290 bits (743),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 173/211 (82%), Gaps = 5/211 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYL EIA++ EL+ISKFNGIA L+ KGARK+DDDLYRA+DIYLK H  LDE+E+EKVC
Sbjct  171  VDAYLAEIASYGELTISKFNGIAILIPKGARKLDDDLYRAVDIYLKVHTNLDELEKEKVC  230

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ 
Sbjct  231  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQT  286

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DVTLV+ENE LRTEL++MKM+++D+Q      G++        V+  TFFSS+SKKLGKL
Sbjct  287  DVTLVRENEELRTELIRMKMYVSDLQK-NGHGGTTSSSEVGKEVKNSTFFSSVSKKLGKL  345

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFK+GSKDTS+++D  VD+TKPRRRRFSIS
Sbjct  346  NPFKNGSKDTSHIEDVGVDLTKPRRRRFSIS  376



>ref|XP_010469846.1| PREDICTED: root phototropism protein 2 isoform X1 [Camelina sativa]
 ref|XP_010469847.1| PREDICTED: root phototropism protein 2 isoform X2 [Camelina sativa]
Length=595

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 180/223 (81%), Gaps = 12/223 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIAT  424
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +      + P A+ T
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEHEERAVVVNLPEALKT  492

Query  423  RNQLQADVTLVKENEALRTELLQMKMFIADMQ----NkgssqgssvkgssasaVRKPTFF  256
            R+QLQAD TL KENEALR+EL++MKM+++DMQ      G+S  +S    S +   K TFF
Sbjct  493  RSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSTSLVSNNKKSKHTFF  552

Query  255  SSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            SS+SKKLGKLNPF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  553  SSVSKKLGKLNPFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  595



>ref|XP_003553189.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=573

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 179/214 (84%), Gaps = 7/214 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YL +IA + +LSISKFNGIA LV K ARKVDDDLYRA+DIYLKAHP+LDEIEREKVC
Sbjct  364  VDTYLSKIAAYGDLSISKFNGIAILVPKNARKVDDDLYRAVDIYLKAHPKLDEIEREKVC  423

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+    P     +NQLQ 
Sbjct  424  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERDVEPE----KNQLQM  479

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgs---sqgssvkgssasaVRKPTFFSSMSKKL  235
            DV+LV+ENE LRTEL++MKM+I+D+QNK +   +       +S++  +K TFFSS+SK L
Sbjct  480  DVSLVRENEELRTELMKMKMYISDLQNKNTNNDANPQVHGTTSSATPKKATFFSSVSKTL  539

Query  234  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            GKLNPF++GSKDT++L+D  VD+TKPRRRRFS+S
Sbjct  540  GKLNPFRNGSKDTTHLEDASVDLTKPRRRRFSMS  573



>ref|XP_003519296.1| PREDICTED: root phototropism protein 2 [Glycine max]
Length=580

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 172/211 (82%), Gaps = 1/211 (0%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIA + ELSISKFNGIA L+ KGARK DDDLYRA+DIYLK HP LDEIE+EKVC
Sbjct  371  VDSYLAEIAAYAELSISKFNGIAILIPKGARKSDDDLYRAVDIYLKVHPNLDEIEKEKVC  430

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SV+D LKLSYEARVHAS+NKRLP+QIVLHALYYDQL+IRSG    K    A A + QLQA
Sbjct  431  SVLDTLKLSYEARVHASKNKRLPLQIVLHALYYDQLQIRSGTAADKQAVVAAAEKKQLQA  490

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENE LR+EL++MKMFI+D+Q       SS    +    +KPTFFSSMSKKL KL
Sbjct  491  DVSLVRENEELRSELMKMKMFISDLQK-NVHGTSSSGRENIGPTKKPTFFSSMSKKLSKL  549

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFK+GSKDTS++DD  VD+TKPR+RRFSIS
Sbjct  550  NPFKNGSKDTSHIDDAPVDLTKPRKRRFSIS  580



>dbj|BAJ33924.1| unnamed protein product [Thellungiella halophila]
Length=597

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 177/225 (79%), Gaps = 14/225 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIA++ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIASYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----TPNAIATRN  418
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR 
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVMVPEALATRG  492

Query  417  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkg--------ssasaVRKPT  262
            Q++AD +L KENEALR+EL++MKM+++D+Q    S G              ++    KPT
Sbjct  493  QVKADTSLAKENEALRSELMKMKMYVSDLQKNKQSGGGGAGASSSNSSSLVNSKKSNKPT  552

Query  261  FFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            FFSS+SKKLGKLNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  553  FFSSVSKKLGKLNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  597



>ref|XP_007142019.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
 gb|ESW14013.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
Length=580

 Score =   295 bits (754),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 175/211 (83%), Gaps = 1/211 (0%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +DAYL EIA + EL ISKFNGI+ L+  GARK DDDLYRA+DIYLKAHP LDEIE+EKVC
Sbjct  371  IDAYLAEIAAYGELPISKFNGISILIPGGARKSDDDLYRAVDIYLKAHPNLDEIEKEKVC  430

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHAS+NKRLP+QIVLHALYYDQL +RSGA + K    A   + QLQA
Sbjct  431  SVMDPLKLSYEARVHASKNKRLPLQIVLHALYYDQLHLRSGAAEDKEAGAAAVEKKQLQA  490

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENE LR+EL++MKM+I DMQ  G+   SS K +SA A R PTF SSMSKKL KL
Sbjct  491  DVSLVRENEELRSELMKMKMYITDMQKNGNGTSSSGKETSAPAKR-PTFLSSMSKKLSKL  549

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFK+GSKDTS++DD  VD+TKPRRRRFSIS
Sbjct  550  NPFKNGSKDTSHIDDAPVDLTKPRRRRFSIS  580



>ref|XP_010414259.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=595

 Score =   295 bits (754),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 180/223 (81%), Gaps = 12/223 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIAT  424
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +      + P A+ T
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVNLPEALKT  492

Query  423  RNQLQADVTLVKENEALRTELLQMKMFIADMQ----NkgssqgssvkgssasaVRKPTFF  256
            R+QLQAD TL KENEALR+EL++MK++++DMQ      G+S  +S    S +   K TFF
Sbjct  493  RSQLQADTTLAKENEALRSELMKMKLYVSDMQKNKNGAGTSSSNSTSLVSNNKKSKHTFF  552

Query  255  SSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            SS+SKKLGKLNPF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  553  SSVSKKLGKLNPFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  595



>gb|KEH28209.1| root phototropism-like protein [Medicago truncatula]
Length=536

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 174/211 (82%), Gaps = 5/211 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYL EIA++ EL+ISKFNGIA L+ KGARK+DDDLYRA+DIYLK H  LDE+E+EKVC
Sbjct  331  VDAYLAEIASYGELTISKFNGIAILIPKGARKLDDDLYRAVDIYLKVHTNLDELEKEKVC  390

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ 
Sbjct  391  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQT  446

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DVTLV+ENE LRTEL++MKM+++D+Q      G++        V+K TFFSS+SKKLGKL
Sbjct  447  DVTLVRENEELRTELIRMKMYVSDLQK-NGHGGTTSSSEVGKEVKKSTFFSSVSKKLGKL  505

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFK+GSKDTS+++D  VD+TKPRRRRFSIS
Sbjct  506  NPFKNGSKDTSHIEDVGVDLTKPRRRRFSIS  536



>gb|AAB63086.1| unknown protein [Arabidopsis thaliana]
Length=415

 Score =   289 bits (740),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 178/221 (81%), Gaps = 10/221 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  195  VDSYLAEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  254

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATR  421
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR
Sbjct  255  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTR  314

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSS  250
            +QLQAD TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS
Sbjct  315  SQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSS  374

Query  249  MSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            +SKKLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  375  VSKKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  415



>ref|XP_006842585.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
 gb|ERN04260.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
Length=564

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 171/212 (81%), Gaps = 11/212 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YLGEIAT  +LSISKF  IANL+ K A+K DDDLYR++DIYLKAHP LDEIEREKVC
Sbjct  363  IDTYLGEIATDADLSISKFTSIANLIPKAAKKFDDDLYRSVDIYLKAHPNLDEIEREKVC  422

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG ED K+  +A  TRNQ+QA
Sbjct  423  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGKEDAKNF-DASFTRNQVQA  481

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            D++L+KENE+L++EL +MK ++  +Q        S          K TFFSSMSKKLG+L
Sbjct  482  DISLIKENESLKSELAKMKSYVDGLQKGKGIATKSS---------KKTFFSSMSKKLGRL  532

Query  225  NPFKHGSKDTSNLDDGE-VDITKPRRRRFSIS  133
            NPF+HGSKDT N++DG  VDITKPR+RRFSIS
Sbjct  533  NPFRHGSKDTLNVEDGNAVDITKPRKRRFSIS  564



>gb|ACJ85743.1| unknown [Medicago truncatula]
Length=257

 Score =   283 bits (725),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 173/211 (82%), Gaps = 6/211 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YL EIA + ELSISKFNGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVC
Sbjct  53   VDMYLAEIAAYGELSISKFNGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVC  112

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  
Sbjct  113  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGECD-GAATERNRLAT  171

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL
Sbjct  172  DVSLVGENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL  228

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              FK+G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  229  --FKNGAKDTAHLEDGPVDLTKPRRRRFSIS  257



>ref|XP_002881117.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57376.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
Length=593

 Score =   294 bits (752),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 178/221 (81%), Gaps = 10/221 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATR  421
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +       P A+ TR
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVLPEALKTR  492

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSS  250
            +QLQAD TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS
Sbjct  493  SQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKNKHTFFSS  552

Query  249  MSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            +SKKLGKLNPFK+GSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  553  VSKKLGKLNPFKNGSKDTSNIDEDLAGVDITKPRRRRFSIS  593



>ref|XP_010510344.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=596

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 179/224 (80%), Gaps = 13/224 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIAT  424
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +      + P A+ T
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVNLPEALKT  492

Query  423  RNQLQADVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKP--TF  259
            R+QLQAD TL KENEALR+EL++MKM+++DMQ   N   +  S+     ++  +K    F
Sbjct  493  RSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSTSLVSNNNKKSKHNF  552

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            FSS+SKKLGKLNPF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  553  FSSVSKKLGKLNPFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  596



>ref|XP_003616056.1| Root phototropism protein [Medicago truncatula]
 gb|AES99014.1| root phototropism-like protein [Medicago truncatula]
Length=579

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 174/211 (82%), Gaps = 5/211 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYL EIA++ EL+ISKFNGIA L+ KGARK+DDDLYRA+DIYLK H  LDE+E+EKVC
Sbjct  374  VDAYLAEIASYGELTISKFNGIAILIPKGARKLDDDLYRAVDIYLKVHTNLDELEKEKVC  433

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ 
Sbjct  434  SVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQT  489

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DVTLV+ENE LRTEL++MKM+++D+Q      G++        V+K TFFSS+SKKLGKL
Sbjct  490  DVTLVRENEELRTELIRMKMYVSDLQK-NGHGGTTSSSEVGKEVKKSTFFSSVSKKLGKL  548

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFK+GSKDTS+++D  VD+TKPRRRRFSIS
Sbjct  549  NPFKNGSKDTSHIEDVGVDLTKPRRRRFSIS  579



>ref|NP_001031446.1| Root phototropism protein 2 [Arabidopsis thaliana]
 ref|NP_001077982.1| Root phototropism protein 2 [Arabidopsis thaliana]
 dbj|BAD43060.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08402.1| Root phototropism protein 2 [Arabidopsis thaliana]
 gb|AEC08403.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=545

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 178/221 (81%), Gaps = 10/221 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  325  VDSYLAEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  384

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATR  421
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR
Sbjct  385  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTR  444

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSS  250
            +QLQAD TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS
Sbjct  445  SQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSS  504

Query  249  MSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            +SKKLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  505  VSKKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  545



>dbj|BAF01791.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01873.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01940.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 178/221 (81%), Gaps = 10/221 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATR  421
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTR  492

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSS  250
            +QLQAD TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS
Sbjct  493  SQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSS  552

Query  249  MSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            +SKKLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  553  VSKKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>dbj|BAF02185.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 178/221 (81%), Gaps = 10/221 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATR  421
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTR  492

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSS  250
            +QLQAD TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS
Sbjct  493  SQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSS  552

Query  249  MSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            +SKKLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  553  VSKKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>gb|EPS73802.1| hypothetical protein M569_00954 [Genlisea aurea]
Length=566

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 166/211 (79%), Gaps = 5/211 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIA + EL IS+F  +A LV + ARKVDDDLYRAIDIYLKAHP LDEIEREKVC
Sbjct  361  VDAYLGEIAIYEELGISRFKELAKLVPETARKVDDDLYRAIDIYLKAHPDLDEIEREKVC  420

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            + MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSG       PNA +TR Q QA
Sbjct  421  AAMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLQLRSGGGGDYEKPNAASTRFQAQA  480

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            D  LVKENE LRTELL+MKM++ ++Q        +   +S+ A +KPTFFSSMSK LGKL
Sbjct  481  DTDLVKENEKLRTELLKMKMYVQEIQE-----SKNQGTTSSKAAKKPTFFSSMSKTLGKL  535

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPF+ GSKDT  +DD   D+ KPRRRRFSIS
Sbjct  536  NPFRIGSKDTLQIDDAASDVRKPRRRRFSIS  566



>ref|NP_850147.1| Root phototropism protein 2 [Arabidopsis thaliana]
 sp|Q682S0.2|RPT2_ARATH RecName: Full=Root phototropism protein 2; AltName: Full=BTB/POZ 
domain-containing protein RPT2 [Arabidopsis thaliana]
 gb|AAK59568.1| unknown protein [Arabidopsis thaliana]
 gb|AAL07245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31821.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94074.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94572.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD95385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01595.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01673.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02233.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08401.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=593

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 178/221 (81%), Gaps = 10/221 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATR  421
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTR  492

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSS  250
            +QLQAD TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS
Sbjct  493  SQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSS  552

Query  249  MSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            +SKKLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  553  VSKKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>ref|XP_004490729.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=573

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 173/211 (82%), Gaps = 8/211 (4%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYL EIA++ EL+ISKFNGIA L+ KGARK+DDDLYRAIDIYLK H  LDE+E+EKVC
Sbjct  371  VDAYLAEIASYGELTISKFNGIAILIPKGARKLDDDLYRAIDIYLKVHTNLDELEKEKVC  430

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQNKRLPVQIVLHALY+DQLK+RSGA   +   +  A RNQLQ 
Sbjct  431  SVMDALKLSYEARVHASQNKRLPVQIVLHALYFDQLKLRSGAVVER---DVTAERNQLQT  487

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DVTLV+ENE LR+EL++MKM++ D++            SS+  V+K TFFSS+SKKLGKL
Sbjct  488  DVTLVRENEELRSELMRMKMYVTDLKK-----NVDGTTSSSREVKKSTFFSSVSKKLGKL  542

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFK+G+KDTS ++DG VD+ KPRRRRFSIS
Sbjct  543  NPFKNGAKDTSTIEDGPVDLIKPRRRRFSIS  573



>gb|AAF33112.1|AF181683_1 RPT2 [Arabidopsis thaliana]
Length=593

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 178/221 (81%), Gaps = 10/221 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ +L+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGDLTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATR  421
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +       P A+ TR
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTR  492

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSS  250
            +QLQAD TL KENEALR+EL++MKM+++DMQ   N   +  S+     +S   K TFFSS
Sbjct  493  SQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSS  552

Query  249  MSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            +S+KLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  553  VSRKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>gb|KFK22949.1| root phototropism protein 2 [Arabis alpina]
Length=596

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 179/224 (80%), Gaps = 13/224 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRN  418
            S MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ + T    P A+ATR 
Sbjct  433  SSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEKQGTVVIVPEALATRG  492

Query  417  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTF  259
            Q++AD +L KENEALR+EL++MKM+++D+Q    S G +   +S++ V        K  F
Sbjct  493  QVKADTSLAKENEALRSELMKMKMYVSDLQKNKQSGGGASSSNSSALVSSSNKKNIKQNF  552

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            FSS+SKKLGK NPF+HGSKDTS++D+    VDITKPRRRRFSIS
Sbjct  553  FSSVSKKLGKFNPFRHGSKDTSHIDEDLAGVDITKPRRRRFSIS  596



>ref|XP_003600551.1| Root phototropism protein [Medicago truncatula]
Length=513

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 174/211 (82%), Gaps = 6/211 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YL EIA + ELSISKFNGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVC
Sbjct  309  VDMYLAEIAAYGELSISKFNGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVC  368

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  
Sbjct  369  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLAT  427

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL
Sbjct  428  DVSLVRENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL  484

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              FK+G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  485  --FKNGAKDTAHLEDGPVDLTKPRRRRFSIS  513



>gb|AES70802.2| root phototropism-like protein [Medicago truncatula]
Length=526

 Score =   285 bits (728),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 174/211 (82%), Gaps = 6/211 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YL EIA + ELSISKFNGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVC
Sbjct  322  VDMYLAEIAAYGELSISKFNGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVC  381

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  
Sbjct  382  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLAT  440

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL
Sbjct  441  DVSLVRENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL  497

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              FK+G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  498  --FKNGAKDTAHLEDGPVDLTKPRRRRFSIS  526



>ref|XP_003600550.1| Root phototropism protein [Medicago truncatula]
 gb|AES70801.1| root phototropism-like protein [Medicago truncatula]
Length=568

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 174/211 (82%), Gaps = 6/211 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YL EIA + ELSISKFNGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVC
Sbjct  364  VDMYLAEIAAYGELSISKFNGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVC  423

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  
Sbjct  424  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLAT  482

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL
Sbjct  483  DVSLVRENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL  539

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              FK+G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  540  --FKNGAKDTAHLEDGPVDLTKPRRRRFSIS  568



>ref|XP_004500391.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=569

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 171/211 (81%), Gaps = 5/211 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YL EIA + EL+ISKFNGIA L+ K ARKVDDDLYRA+DIYLKAHP+LDEIEREKVC
Sbjct  364  VDVYLAEIAAYDELTISKFNGIAILIPKHARKVDDDLYRAVDIYLKAHPKLDEIEREKVC  423

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD LKLSYEARVHASQ KRLPVQIVLHALYYDQL++RSG++D  +   A   +N+L  
Sbjct  424  SVMDTLKLSYEARVHASQKKRLPVQIVLHALYYDQLRLRSGSDDGDT---AATKKNRLNT  480

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LV+ENE LR+EL +MKM+++DMQ    +       +S+ + +K  FFSS+SK LGKL
Sbjct  481  DVSLVRENEELRSELAKMKMYVSDMQQ--KNVSQVHGTTSSHSTKKTKFFSSVSKTLGKL  538

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFKH +KDT++LDDG VD+ KPRRRRFSIS
Sbjct  539  NPFKHEAKDTTHLDDGPVDLIKPRRRRFSIS  569



>ref|XP_010044625.1| PREDICTED: root phototropism protein 2-like [Eucalyptus grandis]
 gb|KCW86717.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=570

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 167/211 (79%), Gaps = 6/211 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDAYLGEIA   ELSISKFN IA L+ K ARKVDDDLYRAIDIYLKAHP LDE+EREK C
Sbjct  366  VDAYLGEIAIDSELSISKFNAIATLMPKAARKVDDDLYRAIDIYLKAHPNLDEVEREKAC  425

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPLKLS+EAR+HASQNKR P QIVLHALY DQLK+RSG  D +   + +ATR+Q+ A
Sbjct  426  SVMDPLKLSHEARIHASQNKRFPAQIVLHALYNDQLKLRSGM-DNRDVCDPMATRSQVLA  484

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+L++ENE LR+EL+ MK  I+DMQN      S    SS    +K TFFSSM+K LGKL
Sbjct  485  DVSLIRENETLRSELMMMKKNISDMQN----PKSQGTTSSKGGAKKTTFFSSMTKTLGKL  540

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPF+ GSKD SN+DD  VDITKPRRRRFSIS
Sbjct  541  NPFRQGSKDASNIDD-LVDITKPRRRRFSIS  570



>emb|CDY10743.1| BnaA05g11930D [Brassica napus]
Length=581

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 179/219 (82%), Gaps = 8/219 (4%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  363  VDSYLAEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  422

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRN  418
            S MDPLKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR 
Sbjct  423  SSMDPLKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVLPEAVATRG  482

Query  417  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs--sasaVRKPTFFSSMS  244
            Q++AD +L KENEALR+EL++MKM+++D+Q  G + G+S   +  S     K TFFSS+S
Sbjct  483  QVKADASLAKENEALRSELMKMKMYVSDLQKSGGAAGASSSNAPPSNKKSSKSTFFSSVS  542

Query  243  KKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            KKLGKLNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  543  KKLGKLNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  581



>emb|CDX84827.1| BnaA03g14030D [Brassica napus]
Length=565

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 169/214 (79%), Gaps = 5/214 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT +EL++SKFN IANLV K ARK +DDLYRA+DI+LKAHP L EIEREKVC
Sbjct  354  VDSYLAEIATCLELTVSKFNAIANLVPKSARKSEDDLYRAVDIFLKAHPSLGEIEREKVC  413

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S+MDPLKLSY+AR+HASQNKRLPV IVLH LYYDQLK+RS  ED + TP  I        
Sbjct  414  SLMDPLKLSYDARLHASQNKRLPVNIVLHTLYYDQLKLRSEVEDKEGTP-VIVPEGLGTR  472

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            D +L KENE LR+EL++MKM+++D+QN  ++  SS    S     K TFFSS+SKKLGKL
Sbjct  473  DSSLAKENEDLRSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKL  532

Query  225  NPFKHGSKDTSNLD---DGEVDITKPRRRRFSIS  133
            NPF+HGSKDTSN+D   DG VDITKPRRRRFSIS
Sbjct  533  NPFRHGSKDTSNIDEDLDG-VDITKPRRRRFSIS  565



>ref|XP_009144295.1| PREDICTED: root phototropism protein 2 [Brassica rapa]
Length=591

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 179/219 (82%), Gaps = 8/219 (4%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  373  VDSYLAEIATYGELTISKFNAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRN  418
            S MDPLKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR 
Sbjct  433  SSMDPLKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVLPEAVATRG  492

Query  417  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs--sasaVRKPTFFSSMS  244
            Q++AD +L KENEALR+EL++MKM+++D+Q  G + G+S   +  S     K TFFSS+S
Sbjct  493  QVKADASLAKENEALRSELMKMKMYVSDLQKSGGAAGASSSNAPPSNKKSSKSTFFSSVS  552

Query  243  KKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            KKLGKLNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  553  KKLGKLNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  591



>ref|XP_009132742.1| PREDICTED: root phototropism protein 2-like [Brassica rapa]
Length=575

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 169/214 (79%), Gaps = 5/214 (2%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT +EL++SKFN IANLV K ARK +DDLYRA+DI+LKAHP L EIEREKVC
Sbjct  364  VDSYLAEIATCLELTVSKFNAIANLVPKSARKSEDDLYRAVDIFLKAHPSLGEIEREKVC  423

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S+MDPLKLSY+AR+HASQNKRLPV IVLH LYYDQLK+RS  ED + TP  I        
Sbjct  424  SLMDPLKLSYDARLHASQNKRLPVNIVLHTLYYDQLKLRSEVEDKEGTP-VIVPEGLGTR  482

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            D +L KENE LR+EL++MKM+++D+QN  ++  SS    S     K TFFSS+SKKLGKL
Sbjct  483  DSSLAKENEDLRSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKL  542

Query  225  NPFKHGSKDTSNLD---DGEVDITKPRRRRFSIS  133
            NPF+HGSKDTSN+D   DG VDITKPRRRRFSIS
Sbjct  543  NPFRHGSKDTSNIDEDLDG-VDITKPRRRRFSIS  575



>emb|CDY23992.1| BnaC03g16990D [Brassica napus]
Length=565

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 171/218 (78%), Gaps = 13/218 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT +EL++SKFN IANLV K ARK +DDLYRA+DI+LKAHP L EIEREKVC
Sbjct  354  VDSYLAEIATCLELTVSKFNAIANLVPKSARKSEDDLYRAVDIFLKAHPSLGEIEREKVC  413

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRN  418
            S+MDPLKLS + R+HASQNKRLPV IVLHALYYDQLK+RS  ED + T    P A+ TR 
Sbjct  414  SLMDPLKLSCDPRLHASQNKRLPVNIVLHALYYDQLKLRSEVEDKEGTPVIVPEALGTR-  472

Query  417  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  238
                D +L KENE LR+EL++MKM+++D+QN  ++  SS    S     K TFFSS+SKK
Sbjct  473  ----DSSLAKENEDLRSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKK  528

Query  237  LGKLNPFKHGSKDTSNLD---DGEVDITKPRRRRFSIS  133
            LGKLNPF+HGSKDTSN+D   DG VDITKPRRRRFSIS
Sbjct  529  LGKLNPFRHGSKDTSNIDEDLDG-VDITKPRRRRFSIS  565



>gb|KCW86718.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=577

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 167/218 (77%), Gaps = 13/218 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLK-------AHPQLDE  607
            VDAYLGEIA   ELSISKFN IA L+ K ARKVDDDLYRAIDIYLK       AHP LDE
Sbjct  366  VDAYLGEIAIDSELSISKFNAIATLMPKAARKVDDDLYRAIDIYLKWAEPNLQAHPNLDE  425

Query  606  IEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA  427
            +EREK CSVMDPLKLS+EAR+HASQNKR P QIVLHALY DQLK+RSG  D +   + +A
Sbjct  426  VEREKACSVMDPLKLSHEARIHASQNKRFPAQIVLHALYNDQLKLRSGM-DNRDVCDPMA  484

Query  426  TRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSM  247
            TR+Q+ ADV+L++ENE LR+EL+ MK  I+DMQN      S    SS    +K TFFSSM
Sbjct  485  TRSQVLADVSLIRENETLRSELMMMKKNISDMQN----PKSQGTTSSKGGAKKTTFFSSM  540

Query  246  SKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +K LGKLNPF+ GSKD SN+DD  VDITKPRRRRFSIS
Sbjct  541  TKTLGKLNPFRQGSKDASNIDD-LVDITKPRRRRFSIS  577



>emb|CDY02075.1| BnaC04g14260D [Brassica napus]
Length=580

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 178/218 (82%), Gaps = 7/218 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIAT+ EL+ISKFN IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVC
Sbjct  363  VDSYLAEIATYGELTISKFNAIANLVQKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVC  422

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----TPNAIATRN  418
            S MDPLKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG ED +      P A+ATR 
Sbjct  423  SSMDPLKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVVPEAVATRG  482

Query  417  QLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkg-ssasaVRKPTFFSSMSK  241
            Q++AD +L KENEALR+EL++MKM+++D+Q  G++  SS     S     K TFFSS+SK
Sbjct  483  QVKADASLAKENEALRSELMKMKMYVSDLQKSGAAGASSSNAPPSNKKSSKSTFFSSVSK  542

Query  240  KLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  133
            KLGKLNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  543  KLGKLNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  580



>ref|XP_009402206.1| PREDICTED: root phototropism protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=540

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 170/216 (79%), Gaps = 7/216 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD ++GEIAT  ELS+SKF GIA  + K AR+ DDDLYRA+DIYLKAHP L EIEREKVC
Sbjct  327  VDGFVGEIATDEELSVSKFAGIAGALPKSARRFDDDLYRAVDIYLKAHPGLAEIEREKVC  386

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT---RNQ  415
            SVMDPLKLSYEAR+HASQNKRLP+QIVLHALYYDQLK+RSG  D ++   A+     R++
Sbjct  387  SVMDPLKLSYEARLHASQNKRLPLQIVLHALYYDQLKLRSGI-DGEAAAGALGVTLGRDE  445

Query  414  -LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  238
             L+ADV+L++ENE LR+EL +MKM+++++Q  G   G           +K +FFSS+S+ 
Sbjct  446  GLKADVSLIRENETLRSELAKMKMYVSELQR-GGGGGGGEGSGVKIGSKKTSFFSSVSRT  504

Query  237  LGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            LGKLNPFK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  505  LGKLNPFKQGSKDTSNIDDGVGVDVTKPRRRRFSIS  540



>ref|XP_009402205.1| PREDICTED: root phototropism protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 170/216 (79%), Gaps = 7/216 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD ++GEIAT  ELS+SKF GIA  + K AR+ DDDLYRA+DIYLKAHP L EIEREKVC
Sbjct  368  VDGFVGEIATDEELSVSKFAGIAGALPKSARRFDDDLYRAVDIYLKAHPGLAEIEREKVC  427

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT---RNQ  415
            SVMDPLKLSYEAR+HASQNKRLP+QIVLHALYYDQLK+RSG  D ++   A+     R++
Sbjct  428  SVMDPLKLSYEARLHASQNKRLPLQIVLHALYYDQLKLRSGI-DGEAAAGALGVTLGRDE  486

Query  414  -LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKK  238
             L+ADV+L++ENE LR+EL +MKM+++++Q  G   G           +K +FFSS+S+ 
Sbjct  487  GLKADVSLIRENETLRSELAKMKMYVSELQR-GGGGGGGEGSGVKIGSKKTSFFSSVSRT  545

Query  237  LGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            LGKLNPFK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  546  LGKLNPFKQGSKDTSNIDDGVGVDVTKPRRRRFSIS  581



>ref|XP_009384760.1| PREDICTED: root phototropism protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 166/215 (77%), Gaps = 6/215 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+++G+IA+  ELS+SKF GIA  + K AR+ DDDLYRA+DIYLKAHP LDEIEREK  
Sbjct  326  VDSFVGKIASDEELSVSKFTGIAGALPKSARRFDDDLYRAVDIYLKAHPGLDEIEREKAS  385

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS--TPNA-IATRNQ  415
            SV+DPLKLSYEAR+HASQNKRLP+QIVLHALYYDQLK RSG ED  +   P A +   + 
Sbjct  386  SVIDPLKLSYEARLHASQNKRLPLQIVLHALYYDQLKQRSGMEDEAAAGAPGATLGPDHG  445

Query  414  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
            L ADV+L++ENEALR+EL +MKM++++M       G        +  +K  FFSS+S+ L
Sbjct  446  LNADVSLIRENEALRSELARMKMYVSEMHR--GGGGGGQGSGVKARSKKAMFFSSVSRTL  503

Query  234  GKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            GKLNPFK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  504  GKLNPFKQGSKDTSNMDDGVVVDVTKPRRRRFSIS  538



>ref|XP_009384759.1| PREDICTED: root phototropism protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=582

 Score =   265 bits (678),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 166/215 (77%), Gaps = 6/215 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+++G+IA+  ELS+SKF GIA  + K AR+ DDDLYRA+DIYLKAHP LDEIEREK  
Sbjct  370  VDSFVGKIASDEELSVSKFTGIAGALPKSARRFDDDLYRAVDIYLKAHPGLDEIEREKAS  429

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS--TPNA-IATRNQ  415
            SV+DPLKLSYEAR+HASQNKRLP+QIVLHALYYDQLK RSG ED  +   P A +   + 
Sbjct  430  SVIDPLKLSYEARLHASQNKRLPLQIVLHALYYDQLKQRSGMEDEAAAGAPGATLGPDHG  489

Query  414  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
            L ADV+L++ENEALR+EL +MKM++++M       G        +  +K  FFSS+S+ L
Sbjct  490  LNADVSLIRENEALRSELARMKMYVSEMHR--GGGGGGQGSGVKARSKKAMFFSSVSRTL  547

Query  234  GKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            GKLNPFK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  548  GKLNPFKQGSKDTSNMDDGVVVDVTKPRRRRFSIS  582



>ref|XP_011080638.1| PREDICTED: root phototropism protein 2 [Sesamum indicum]
Length=570

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 157/211 (74%), Gaps = 7/211 (3%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YLG++A   ELSI+KFNGIAN V K ARK+DD LYRA+DIYLKAHP LDEI+R KVC
Sbjct  367  VDTYLGKVANCDELSIAKFNGIANSVPKAARKLDDHLYRAVDIYLKAHPYLDEIKRLKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMDPL+LS++ARVHASQN RLPVQIVLHAL+YDQLK+  G  D     +A   RN LQ 
Sbjct  427  SVMDPLRLSHQARVHASQNNRLPVQIVLHALHYDQLKLTRGIYDDHLLLDAPRARNYLQI  486

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKL  226
            DV+LVKENEALRTELL+M+M + DMQ               S V+K TFFSS+SK LG L
Sbjct  487  DVSLVKENEALRTELLRMRMCMRDMQR-------IQGTPYRSRVKKHTFFSSLSKTLGIL  539

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            NPFKH  KDTSN+DD  VD T  RR RFSIS
Sbjct  540  NPFKHARKDTSNVDDEMVDSTTLRRGRFSIS  570



>gb|KHG08105.1| Root phototropism 2 -like protein [Gossypium arboreum]
Length=507

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 5/168 (3%)
 Frame = -1

Query  633  LKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAED  454
            + +HP LDEIEREKVCS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D
Sbjct  344  MASHPNLDEIEREKVCSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGAD  403

Query  453  PKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV  274
             ++ P+A+ TRNQLQADV+LVKENEALRTELL+MKM+I+DMQ        +   S +   
Sbjct  404  DRNQPDAVTTRNQLQADVSLVKENEALRTELLKMKMYISDMQK----NNQTGTSSKSIGT  459

Query  273  RKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            RKPTFFSSMSK LGKLNPF+HGSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  460  RKPTFFSSMSKTLGKLNPFRHGSKDTSHIDDNLGVDVTKPRRRRFSIS  507



>ref|XP_010922790.1| PREDICTED: root phototropism protein 2 [Elaeis guineensis]
Length=577

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 164/215 (76%), Gaps = 10/215 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDA++GEIAT  +L++ KF  IA  + K AR+ DDDLYRA+DIYLKAHP L EIEREK+C
Sbjct  369  VDAFVGEIATDKDLTVHKFASIAGALPKSARRFDDDLYRAVDIYLKAHPGLHEIEREKLC  428

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA--EDPKSTPNA-IATRNQ  415
            SVMDPLKL+Y+AR+HASQN RLP+QIVL ALYYDQLK+RSGA  E+  + PN+  A R  
Sbjct  429  SVMDPLKLTYDARLHASQNNRLPLQIVLQALYYDQLKLRSGAEPENAVTPPNSAAAARAG  488

Query  414  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
              AD +L++ENEALR+EL +MK+ ++++Q       S       +  ++PTFFSS SK L
Sbjct  489  AMADASLMRENEALRSELTRMKLCLSELQR------SQGTSGLKAGPKRPTFFSSFSKTL  542

Query  234  GKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
             KLNPF+HGSKDT+++DDG  VD+TKPRRRRFSI 
Sbjct  543  EKLNPFRHGSKDTASIDDGVGVDLTKPRRRRFSIG  577



>gb|KHN18647.1| Root phototropism protein 2 [Glycine soja]
Length=312

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 143/193 (74%), Gaps = 29/193 (15%)
 Frame = -1

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            IA L+ K ARK+DDDLYRA+DIYLKAHP+LDEIEREKVCSVMDPLKLSYEARVHASQNKR
Sbjct  146  IATLIPKSARKIDDDLYRAVDIYLKAHPKLDEIEREKVCSVMDPLKLSYEARVHASQNKR  205

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTLVK--ENEALRTELLQM  352
            LPVQIVLHALYYDQL++RSGAE+       +AT +NQLQ DVTL K   N+A        
Sbjct  206  LPVQIVLHALYYDQLRLRSGAEE-----REVATEKNQLQMDVTLNKNTNNDA--------  252

Query  351  KMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  172
                                +S++  +K TFFSS+SK LGKLNPF++GSKDT++L+D  V
Sbjct  253  -------------NPQGHGTTSSATPKKATFFSSVSKTLGKLNPFRNGSKDTTHLEDASV  299

Query  171  DITKPRRRRFSIS  133
            D+TKPRRRRFS+S
Sbjct  300  DLTKPRRRRFSMS  312



>ref|XP_008803009.1| PREDICTED: root phototropism protein 2 [Phoenix dactylifera]
Length=583

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 158/221 (71%), Gaps = 19/221 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VDA++GEIAT  +L++ KF GIA ++ K AR+ DDDLYRA+DIYLKAH  L EIE+EK C
Sbjct  372  VDAFVGEIATDKDLTVHKFAGIAGVLPKSARRFDDDLYRAVDIYLKAHTGLHEIEKEKAC  431

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA---EDPKSTPNAIATRNQ  415
            SVMDPLKLS+EAR+HA++N RLP+QI+LHALY+DQLK+RSGA   +    + +A A R  
Sbjct  432  SVMDPLKLSHEARLHAARNNRLPLQIILHALYFDQLKLRSGAAAKDAVAPSNSAAAARAG  491

Query  414  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
              AD +L++ENEALR+EL +M++ ++++Q                  ++PTF SS SK L
Sbjct  492  AMADASLMRENEALRSELTRMQLCLSELQG---------GSGLKGRPKRPTFLSSFSKTL  542

Query  234  GKLNPFKHGSKDTSNLDDGEVDI-------TKPRRRRFSIS  133
            GKLNPF+HGS D S++D+G V +        KPRRRRFSIS
Sbjct  543  GKLNPFRHGSMDASSIDNGGVGVLGEALTKPKPRRRRFSIS  583



>gb|EMS47631.1| Root phototropism protein 2 [Triticum urartu]
Length=386

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 148/222 (67%), Gaps = 11/222 (5%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP+LDEIEREKVC
Sbjct  165  VDEVAAEIATDESLPISKFVGVAGAVPKDARATHDCLYRAVDIYLKAHPELDEIEREKVC  224

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATR  421
            SVMD LKLSY AR+HASQNKRLP+Q VL ALYYDQLK+RS       ED  +   A + R
Sbjct  225  SVMDTLKLSYTARIHASQNKRLPLQAVLSALYYDQLKLRSAGVGHDDEDSDARSEAGSAR  284

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSK  241
             Q +AD  L +ENEALR+EL +M+  ++    +    GS    ++    +K +FF SMS+
Sbjct  285  MQAKADAALARENEALRSELARMRAHLSSGVQQSKGSGSRTAATATVPGKKASFFGSMSR  344

Query  240  KLGKLNPFKHG---SKDTSNLDD---GEVDITKPRRRRFSIS  133
             L +LNPF+ G   SKDTS++ D   G +++ KP+RRR SIS
Sbjct  345  TLSRLNPFRAGGGWSKDTSSIRDSRGGAMNVVKPKRRRSSIS  386



>ref|XP_004978520.1| PREDICTED: root phototropism protein 2-like [Setaria italica]
Length=604

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 152/219 (69%), Gaps = 13/219 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L+ISKF G+A  V K AR   D LYRA+DIYLK HP+LDEIEREKVC
Sbjct  391  VDELAAEIATEESLAISKFVGVAGAVPKEARASHDCLYRAVDIYLKTHPELDEIEREKVC  450

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--GAEDPKSTPNAIATRNQL  412
            SVMDPLKLSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS  GA D  +   A   R Q 
Sbjct  451  SVMDPLKLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAAGAGDDDTQSAAGKARAQA  510

Query  411  QADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  232
            +AD +L +ENEALR+EL +M+ +++ MQ            S + A +K +F  S+S+ L 
Sbjct  511  RADASLARENEALRSELARMRAYLSGMQP-----SRGSGSSPSPAAKKTSFLGSVSRTLS  565

Query  231  KLNPFKHG-SKDTSNLDDG-----EVDITKPRRRRFSIS  133
            +LNPFK G +KDT+++ DG     E+ + +P+RRRFSIS
Sbjct  566  RLNPFKGGWAKDTASVADGRDGRKEMHVVRPKRRRFSIS  604



>ref|XP_004977394.1| PREDICTED: root phototropism protein 2-like [Setaria italica]
Length=560

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 151/219 (69%), Gaps = 13/219 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L+ISKF G+A  V K AR   D LYRA+DIYLK HP+LDEIEREKVC
Sbjct  347  VDELAAEIATEESLAISKFVGVAGAVPKEARASHDCLYRAVDIYLKTHPELDEIEREKVC  406

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--GAEDPKSTPNAIATRNQL  412
            SVMDPLKLSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS  GA D  +   A   R Q 
Sbjct  407  SVMDPLKLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAAGAGDDDTQSAAGKARAQA  466

Query  411  QADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLG  232
            +AD +L +ENEALR+EL +M+ +++ +Q            S + A +K +F  S+S+ L 
Sbjct  467  RADASLARENEALRSELARMRAYLSGVQP-----SKGSGSSPSPAAKKTSFLGSVSRTLS  521

Query  231  KLNPFKHG-SKDTSNLDDG-----EVDITKPRRRRFSIS  133
            +LNPFK G +KDT+++ DG     ++ + +P+RRR SIS
Sbjct  522  RLNPFKGGWAKDTASVADGRDGRKDMHVVRPKRRRSSIS  560



>ref|XP_008669932.1| PREDICTED: root phototropism protein 2-like [Zea mays]
 tpg|DAA39312.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=577

 Score =   215 bits (547),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 151/228 (66%), Gaps = 17/228 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    E+A+H  L ISKF G+A  V + AR   D LYRA+DIYLK HP LDEIEREKVC
Sbjct  350  VDEVAAEMASHESLPISKFVGVAGAVPRDARPSHDCLYRAVDIYLKTHPGLDEIEREKVC  409

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKSTPNAIA-T  424
            SVMDPL+LSY+AR+HASQNKRLP+Q VL  LYYDQLKIRS     G E+   T +A    
Sbjct  410  SVMDPLRLSYQARMHASQNKRLPLQAVLSVLYYDQLKIRSADGSGGTEEGWETQSAAGKA  469

Query  423  RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs------sasaVRKPT  262
            R Q +ADV+L +ENEALR EL +M+ +++ MQ      GS    S      + +  +K +
Sbjct  470  RAQARADVSLARENEALRLELARMRAYVSGMQQSSKGSGSRPSSSSLVPGPATATGKKAS  529

Query  261  FFSSMSKKLGKLNPFKHG-SKDTSNLDDG----EVDITKPRRRRFSIS  133
            F  S+S+ L +LNPFK G +KDT+++ DG     + + KP+RRRFSI 
Sbjct  530  FLGSVSRTLSRLNPFKGGWAKDTTSIADGRDRTSMHVVKPKRRRFSIG  577



>dbj|BAJ91259.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 149/222 (67%), Gaps = 15/222 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L IS+F G+A  V K AR   D LYRA+DIYLKAHP+LDEIEREKVC
Sbjct  351  VDEVAAEIATDESLPISRFVGVAGAVPKDARDTHDCLYRAVDIYLKAHPELDEIEREKVC  410

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATR  421
            SVMD LKLSY AR+HASQNKRLP+Q VL ALYYDQLK+RS A     ED  +   A + R
Sbjct  411  SVMDTLKLSYTARLHASQNKRLPLQAVLSALYYDQLKLRSAAVSHDDEDNDARSEAGSAR  470

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSK  241
             Q +AD  L +EN+ALR+EL +M+  +    + G  Q       +A+  +K +FF SMS+
Sbjct  471  MQAKADAALARENQALRSELARMRAHM----SSGVQQSKGSGSRTAATGKKASFFGSMSR  526

Query  240  KLGKLNPFKHG---SKDTSNLDD---GEVDITKPRRRRFSIS  133
             L +LNPF+ G   SKDTS++ D   G +++ KP+RRR SIS
Sbjct  527  TLSRLNPFRAGGGWSKDTSSIRDSRGGAMNVVKPKRRRSSIS  568



>dbj|BAJ92463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 149/222 (67%), Gaps = 15/222 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L IS+F G+A  V K AR   D LYRA+DIYLKAHP+LDEIEREKVC
Sbjct  351  VDEVAAEIATDESLPISRFVGVAGAVPKDARDTHDCLYRAVDIYLKAHPELDEIEREKVC  410

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATR  421
            SVMD LKLSY AR+HASQNKRLP+Q VL ALYYDQLK+RS A     ED  +   A + R
Sbjct  411  SVMDTLKLSYTARLHASQNKRLPLQAVLSALYYDQLKLRSAAVSHDDEDNDARSEAGSAR  470

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSK  241
             Q +AD  L +EN+ALR+EL +M+  +    + G  Q       +A+  +K +FF SMS+
Sbjct  471  MQAKADAALARENQALRSELARMRAHM----SSGVQQSKGSGSRTAATGKKASFFGSMSR  526

Query  240  KLGKLNPFKHG---SKDTSNLDD---GEVDITKPRRRRFSIS  133
             L +LNPF+ G   S+DTS++ D   G +++ KP+RRR SIS
Sbjct  527  TLSRLNPFRAGGGWSRDTSSIGDSRGGAMNVVKPKRRRSSIS  568



>ref|XP_002450159.1| hypothetical protein SORBIDRAFT_05g001300 [Sorghum bicolor]
 gb|EES09147.1| hypothetical protein SORBIDRAFT_05g001300 [Sorghum bicolor]
Length=587

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 152/232 (66%), Gaps = 23/232 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    E+AT   L ISKF G+A  V K AR   D LYRA+D+YLK HP LDEIEREKVC
Sbjct  358  VDEVAAEMATEESLGISKFVGVAGAVPKDARASHDCLYRAVDMYLKTHPGLDEIEREKVC  417

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE------------DPKST  442
            SVMDPL+LSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS               +P+S 
Sbjct  418  SVMDPLRLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSADGGGGDGAEGGAGWEPQSA  477

Query  441  PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs----sasaV  274
              A   R Q +AD +L +ENEALR+EL +M+ +++ MQ      GS    +    +++A 
Sbjct  478  --AGKARAQARADASLARENEALRSELARMRAYVSGMQQHSKGSGSRSSSASLVPASAAG  535

Query  273  RKPTFFSSMSKKLGKLNPFKHG-SKDTSNLDDGE----VDITKPRRRRFSIS  133
            +K +F  S+S+ L +LNPFK G +KDT+++ DG     + + KP+RRRFSI 
Sbjct  536  KKASFLGSVSRTLSRLNPFKGGWAKDTASIADGRDRSAMHVVKPKRRRFSIG  587



>gb|KHN24717.1| Root phototropism protein 2 [Glycine soja]
Length=152

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 124/157 (79%), Gaps = 13/157 (8%)
 Frame = -1

Query  579  MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQAD  403
            MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+       +AT +NQLQ D
Sbjct  1    MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEE-----REVATEKNQLQMD  55

Query  402  VTLVKENEALRTELLQMKMFIADMQNkgssqg-------ssvkgssasaVRKPTFFSSMS  244
            VTLV+ENE LRTEL++MKM+I+D+Q   ++          +   ++    +K TFFSS+S
Sbjct  56   VTLVRENEELRTELMKMKMYISDLQQNKNTNNGANPQGHGTTSSAANPNPKKATFFSSVS  115

Query  243  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            K LGKLNPF++GSKDT++L+DG VD+TKPRRRRFS+S
Sbjct  116  KTLGKLNPFRNGSKDTTHLEDGNVDLTKPRRRRFSVS  152



>ref|XP_006663162.1| PREDICTED: root phototropism protein 2-like [Oryza brachyantha]
Length=506

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 149/227 (66%), Gaps = 16/227 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP LDEIEREKVC
Sbjct  280  VDGVAAEIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALDEIEREKVC  339

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI--------  430
            SVMDPLKLSY+ R+HASQNKRLP+Q VL ALYYDQLK+RSG         +         
Sbjct  340  SVMDPLKLSYQGRLHASQNKRLPLQAVLSALYYDQLKLRSGNGGGVGGDESGGWDAYGGM  399

Query  429  --ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT--  262
              + R Q +A+ +L +ENE LR+EL +M+ +++ M  + S  G S   ++AS+ +K T  
Sbjct  400  MRSARMQAKAEASLARENEELRSELARMRAYMSGMGVQQSKGGGSSSRTTASSGKKGTTS  459

Query  261  --FFSSMSKKLGKLNPFKHG--SKDTSNLDDGEVDITKPRRRRFSIS  133
                 S+S+ L +LNPFK G  +KDTS++ D ++   KP+RRRFS+S
Sbjct  460  LWLLGSVSRTLSRLNPFKGGIWAKDTSSIGDKKIHSVKPKRRRFSVS  506



>ref|XP_003577852.1| PREDICTED: root phototropism protein 2 [Brachypodium distachyon]
Length=606

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 142/227 (63%), Gaps = 20/227 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGAR---KVDDDLYRAIDIYLKAHPQLDEIERE  595
            +D    EIAT   L ISKF  IA  + + +R      D +YRA+D+YLKAHP LDEIERE
Sbjct  384  IDEVAAEIATEETLPISKFVSIAGAIPRESRPGGAAHDCVYRAVDVYLKAHPGLDEIERE  443

Query  594  KVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----EDPKSTPNAIA  427
            KVCSVMDPLKLS  AR+HASQNKRLP+Q VL ALYYDQLK+RSG     ED +S   A +
Sbjct  444  KVCSVMDPLKLSPAARLHASQNKRLPLQAVLSALYYDQLKLRSGQLTGDEDDRS--EAGS  501

Query  426  TRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgss-----qgssvkgssasaVRKPT  262
             R Q +AD  L +ENEALR+EL +M+  ++   +            S   ++     K  
Sbjct  502  ARMQAKADAALARENEALRSELGRMRAHMSSSSSGSGRGQRSKGSGSRTPAAMKGKMKVG  561

Query  261  FFSSMSKKLGKLNPFKHG----SKDTSNLDDGEVDITKPRRRRFSIS  133
            FF SMS+ L +LNPF+ G    SKDTSN+ D    I KP+RRRFSI 
Sbjct  562  FFGSMSRTLSRLNPFRAGGGRWSKDTSNIADAA--IVKPKRRRFSIG  606



>gb|EEC68739.1| hypothetical protein OsI_37246 [Oryza sativa Indica Group]
Length=570

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 138/226 (61%), Gaps = 26/226 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVC
Sbjct  356  VDEVAAEIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVC  415

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPN  436
            SVMDPLKLSY+ R+HASQN RLP+Q VL ALYYDQLK+RSG E              +  
Sbjct  416  SVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDQLKLRSGDEGGGGWDAYGNGVMRSSA  475

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFF  256
            A + R Q + + +L +ENEALR+EL +M+ +++ MQ +     SS               
Sbjct  476  AGSARKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKK  524

Query  255  SSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  133
             S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  525  GSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  570



>gb|ABG22339.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
Length=539

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 138/226 (61%), Gaps = 26/226 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVC
Sbjct  325  VDEVAAEIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVC  384

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPN  436
            SVMDPLKLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  
Sbjct  385  SVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSA  444

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFF  256
            A + R Q + + +L +ENEALR+EL +M+ +++ MQ +     SS               
Sbjct  445  AGSARKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKK  493

Query  255  SSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  133
             S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  494  GSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  539



>gb|ABA95649.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
 gb|EEE52651.1| hypothetical protein OsJ_35014 [Oryza sativa Japonica Group]
Length=570

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 138/226 (61%), Gaps = 26/226 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVC
Sbjct  356  VDEVAAEIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVC  415

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPN  436
            SVMDPLKLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  
Sbjct  416  SVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSA  475

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFF  256
            A + R Q + + +L +ENEALR+EL +M+ +++ MQ +     SS               
Sbjct  476  AGSARKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKK  524

Query  255  SSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  133
             S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  525  GSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  570



>ref|NP_001065596.1| Os11g0118300 [Oryza sativa Japonica Group]
 gb|ABA91174.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27441.1| Os11g0118300 [Oryza sativa Japonica Group]
 dbj|BAG89308.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51536.1| hypothetical protein OsJ_32738 [Oryza sativa Japonica Group]
Length=571

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 138/226 (61%), Gaps = 26/226 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVC
Sbjct  357  VDEVAAEIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVC  416

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPN  436
            SVMDPLKLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  
Sbjct  417  SVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSA  476

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFF  256
            A + R Q + + +L +ENEALR+EL +M+ +++ MQ +     SS               
Sbjct  477  AGSARKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKK  525

Query  255  SSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  133
             S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  526  GSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  571



>ref|NP_001066000.1| Os12g0117400 [Oryza sativa Japonica Group]
 dbj|BAF29019.1| Os12g0117400, partial [Oryza sativa Japonica Group]
Length=591

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 138/226 (61%), Gaps = 26/226 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVC
Sbjct  377  VDEVAAEIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVC  436

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPN  436
            SVMDPLKLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E              +  
Sbjct  437  SVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSA  496

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFF  256
            A + R Q + + +L +ENEALR+EL +M+ +++ MQ +     SS               
Sbjct  497  AGSARKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKK  545

Query  255  SSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  133
             S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  546  GSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  591



>gb|EEC67555.1| hypothetical protein OsI_34888 [Oryza sativa Indica Group]
Length=571

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 137/226 (61%), Gaps = 26/226 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVC
Sbjct  357  VDEVAAEIATEESLPISKFVGLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVC  416

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----------TPN  436
            SVMDPLKLSY+ R+HASQN RLP+Q VL ALYYDQLK+RSG E              +  
Sbjct  417  SVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDQLKLRSGDEGGSGWDAYGNGVMRSSA  476

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFF  256
            A +   Q + + +L +ENEALR+EL +M+ +++ MQ +     SS               
Sbjct  477  AGSAWKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----------GKK  525

Query  255  SSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  133
             S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  526  GSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKAKRRRFSIS  571



>gb|AFW55920.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=621

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 138/227 (61%), Gaps = 17/227 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLK HP+LDEI+REKVC
Sbjct  396  VDEVAAEIATEEALPISKFVGVAGAVPKDARPSHDCLYRAVDIYLKTHPELDEIQREKVC  455

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATR  421
            SVMDPLKLSY+AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +S+    A  
Sbjct  456  SVMDPLKLSYQARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACA  515

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSK  241
                AD  L +ENEALR+EL +M+ +++ M+       S+   S +   +K +F  S+S+
Sbjct  516  QARAADAALARENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSR  574

Query  240  KLGKLNPFKHGSK----DTSNLDDGEVD-------ITKPRRRRFSIS  133
             + +LNPF+ G       TSN   G          +  P+RRR SIS
Sbjct  575  TMSRLNPFRSGGWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  621



>ref|XP_008661889.1| PREDICTED: LOC100281201 isoform X1 [Zea mays]
Length=636

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 138/227 (61%), Gaps = 17/227 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLK HP+LDEI+REKVC
Sbjct  411  VDEVAAEIATEEALPISKFVGVAGAVPKDARPSHDCLYRAVDIYLKTHPELDEIQREKVC  470

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATR  421
            SVMDPLKLSY+AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +S+    A  
Sbjct  471  SVMDPLKLSYQARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACA  530

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSK  241
                AD  L +ENEALR+EL +M+ +++ M+       S+   S +   +K +F  S+S+
Sbjct  531  QARAADAALARENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSR  589

Query  240  KLGKLNPFKHGSK----DTSNLDDGEVD-------ITKPRRRRFSIS  133
             + +LNPF+ G       TSN   G          +  P+RRR SIS
Sbjct  590  TMSRLNPFRSGGWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  636



>ref|NP_001147592.1| LOC100281201 [Zea mays]
 gb|ACG28024.1| RPT2-like protein [Zea mays]
Length=613

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 138/227 (61%), Gaps = 17/227 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLK HP+LDEI+REKVC
Sbjct  388  VDELAAEIATEEALPISKFVGVAGAVPKDARPSHDYLYRAVDIYLKTHPELDEIQREKVC  447

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATR  421
            SVMDPLKLSY+AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +S+    A  
Sbjct  448  SVMDPLKLSYQARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACA  507

Query  420  NQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSK  241
                AD  L +ENEALR+EL +M+ +++ M+       S+   S +   +K +F  S+S+
Sbjct  508  QARAADAALARENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSR  566

Query  240  KLGKLNPFKHGSK----DTSNLDDGEVD-------ITKPRRRRFSIS  133
             + +LNPF+ G       TSN   G          +  P+RRR SIS
Sbjct  567  TMSRLNPFRSGGWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  613



>ref|XP_002463481.1| hypothetical protein SORBIDRAFT_01g000540 [Sorghum bicolor]
 gb|EER90479.1| hypothetical protein SORBIDRAFT_01g000540 [Sorghum bicolor]
Length=264

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 18/189 (10%)
 Frame = -1

Query  648  AIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR  469
            A+DIYLK HP LDEIEREKVCSVMDPL+LSY+AR+HA QNKRLP+Q +L ALYYDQLK+R
Sbjct  75   AVDIYLKTHPGLDEIEREKVCSVMDPLRLSYQARLHAPQNKRLPLQALLDALYYDQLKLR  134

Query  468  SGAEDP-------KSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssq  310
            S            +S   A   R Q +AD +L +ENEALR+EL +M+ +++ MQ   +  
Sbjct  135  SADGGDGAEGGGWESQSAAGKARAQARADASLARENEALRSELARMRAYVSGMQQHSNGS  194

Query  309  gssvkgs------sasaVRKPTFFSSMSKKLGKLNPFKHG-SKDTSNLDDGE----VDIT  163
            GS    +      +++A +K +F  S+S+ L +LNPFK G +KD +++ DG     + + 
Sbjct  195  GSRSSLASASLVPASAAGKKASFLGSVSQTLSQLNPFKGGWAKDMASIADGRDRSAMHVV  254

Query  162  KPRRRRFSI  136
            KP+RRRFSI
Sbjct  255  KPKRRRFSI  263



>ref|XP_009374446.1| PREDICTED: putative disease resistance protein RGA3 [Pyrus x 
bretschneideri]
Length=1090

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = -1

Query  627   AHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK  448
             AHP LDEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQ K+RSG  D  
Sbjct  945   AHPNLDEIEREKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQPKLRSGV-DEN  1003

Query  447   STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNk-gssqgssvkgssasaVR  271
                +A+ TR+Q+Q DV+L +ENE LR ELL+MKM+I D+Q    +   ++  G      +
Sbjct  1004  DVQDAVTTRSQVQHDVSLARENEELRMELLKMKMYITDLQKTGSAGIATTSSGKGGGGPK  1063

Query  270   KPTFFSSMSKKLGKLNPFKHG  208
             K TFFSS+SKKLGKLNPFK G
Sbjct  1064  KATFFSSVSKKLGKLNPFKQG  1084



>ref|XP_002441790.1| hypothetical protein SORBIDRAFT_08g002330 [Sorghum bicolor]
 gb|AAO16688.1| RPT2-like protein [Sorghum bicolor]
 gb|EES15628.1| hypothetical protein SORBIDRAFT_08g002330 [Sorghum bicolor]
Length=665

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 140/271 (52%), Gaps = 61/271 (23%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD    EIAT   L ISKF G+A  V K AR   D LYRA+DIYLK HP LDEI+REKVC
Sbjct  394  VDEVAAEIATEEALPISKFVGVAGAVPKDARPSHDCLYRAVDIYLKTHPALDEIQREKVC  453

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA-TRNQLQ  409
            SVMDPLKLSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS A+   S  + +A T+ Q  
Sbjct  454  SVMDPLKLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAADAATSMGDVVADTQTQSS  513

Query  408  ADV-----------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT  262
            +              L +ENEALR EL +M+ +++     G  + SS   S +   +K T
Sbjct  514  SAAGRARAQAMADAALARENEALRVELARMRAYMSGTMQHGKGRESSTPASPSRTAKKAT  573

Query  261  F-----------------------------------------FSSMSKKLGKLNPFKHG-  208
            F                                           S+S+ L +LNPFK G 
Sbjct  574  FLGTELARMRAYMSGMHHSKGSGATPPASPSRTAAAKTKASLLGSVSRSLSRLNPFKGGW  633

Query  207  -SKDTSNLDDGEVD------ITKPRRRRFSI  136
             +  T ++  G         +  P+RRR SI
Sbjct  634  TTNHTGSIAAGGRPCKTMHHVVTPKRRRSSI  664



>ref|XP_010272171.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nelumbo 
nucifera]
Length=620

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 134/231 (58%), Gaps = 26/231 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   LS+S+F  +A L+ + AR  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  396  MESYLAEIASDRNLSVSRFIALAELIPEQARVTEDGMYRAIDIYLKAHPALTDMERKKVC  455

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--------GAEDPKSTPNAI  430
            S+MD  KLS EA  HA+QN RLPVQIV+  LYY+Q ++R         G E P S P  +
Sbjct  456  SLMDCQKLSREACAHAAQNDRLPVQIVVQVLYYEQQRLRDVMGGGNLMGGESP-SLPQKL  514

Query  429  ATRNQLQAD--------VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssa---  283
               N   AD        V+L +ENE L+ EL++M+M +  ++       S     SA   
Sbjct  515  ---NLYSADYHSAPDEVVSLRRENEDLKIELVKMRMRLKQLEKSAEIIPSGSTPPSADKP  571

Query  282  -saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
                 KP+F +S+SKKLG+L PF     D     DG+  I   R RR SIS
Sbjct  572  PLPRSKPSFINSVSKKLGRLYPFVRA--DGVKPSDGKGRIKPSRNRRHSIS  620



>ref|XP_010277089.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010277090.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
Length=605

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 135/228 (59%), Gaps = 20/228 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++++L EIA+   LS+SKF  +A L+ +  R ++D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  381  MESFLAEIASDRNLSVSKFTNLAELIPEQTRVIEDGMYRAIDIYLKAHPALTDMERKKVC  440

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
             +MD  KLS EA  HA+QN RLPVQIV+  LYY+Q ++R        GAE P      + 
Sbjct  441  RLMDCQKLSREACAHAAQNDRLPVQIVVQVLYYEQRRLRDAMSDNLMGAESPALQKMNLH  500

Query  426  TRNQLQAD---VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP---  265
            +++   A    ++L +ENE L+ EL++M+M + +++  G            S  + P   
Sbjct  501  SKDYHSAPDELLSLRRENEDLKMELVKMRMRLKELEKSGEINPPESTPPIPSVDKPPLAL  560

Query  264  ---TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
               +F SSMSKKLG+L PF  G    S+   G    TKP R RR S+S
Sbjct  561  PRKSFISSMSKKLGRLYPFMRGEGVKSSDGKGR---TKPSRNRRHSVS  605



>ref|XP_010277091.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nelumbo nucifera]
Length=594

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 135/228 (59%), Gaps = 20/228 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++++L EIA+   LS+SKF  +A L+ +  R ++D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  370  MESFLAEIASDRNLSVSKFTNLAELIPEQTRVIEDGMYRAIDIYLKAHPALTDMERKKVC  429

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
             +MD  KLS EA  HA+QN RLPVQIV+  LYY+Q ++R        GAE P      + 
Sbjct  430  RLMDCQKLSREACAHAAQNDRLPVQIVVQVLYYEQRRLRDAMSDNLMGAESPALQKMNLH  489

Query  426  TRNQLQAD---VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP---  265
            +++   A    ++L +ENE L+ EL++M+M + +++  G            S  + P   
Sbjct  490  SKDYHSAPDELLSLRRENEDLKMELVKMRMRLKELEKSGEINPPESTPPIPSVDKPPLAL  549

Query  264  ---TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
               +F SSMSKKLG+L PF  G    S+   G    TKP R RR S+S
Sbjct  550  PRKSFISSMSKKLGRLYPFMRGEGVKSSDGKGR---TKPSRNRRHSVS  594



>ref|XP_011006800.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Populus euphratica]
Length=546

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 133/220 (60%), Gaps = 16/220 (7%)
 Frame = -1

Query  756  YLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM  577
            YL EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+M
Sbjct  331  YLAEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLM  390

Query  576  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIAT  424
            D  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T
Sbjct  391  DCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFST  450

Query  423  RNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSS  250
              +  +D   +L +ENE L+ EL++MKM I +++       +S   +    + + +F +S
Sbjct  451  DIRPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINS  510

Query  249  MSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            +SKKLG++NPF       SN        T+P + RR SIS
Sbjct  511  VSKKLGRINPFVRADGPLSNTKAR----TRPSKDRRHSIS  546



>ref|XP_011012051.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Populus euphratica]
Length=599

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 135/223 (61%), Gaps = 16/223 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  381  MENYLAEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVC  440

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NA  433
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N 
Sbjct  441  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNI  500

Query  432  IATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF  259
             +T  +  +D   +L +ENE L+ EL++MKM I +++       +S   +    + + +F
Sbjct  501  FSTDIRPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSF  560

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
             +S+SKKLG++NPF       SN        T+P + RR SIS
Sbjct  561  INSVSKKLGRINPFVRADGPLSNTKAR----TRPSKDRRHSIS  599



>ref|XP_011012052.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Populus euphratica]
Length=546

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 133/220 (60%), Gaps = 16/220 (7%)
 Frame = -1

Query  756  YLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM  577
            YL EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+M
Sbjct  331  YLAEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLM  390

Query  576  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIAT  424
            D  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N  +T
Sbjct  391  DCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFST  450

Query  423  RNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSS  250
              +  +D   +L +ENE L+ EL++MKM I +++       +S   +    + + +F +S
Sbjct  451  DIRPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINS  510

Query  249  MSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            +SKKLG++NPF       SN        T+P + RR SIS
Sbjct  511  VSKKLGRINPFVRADGPLSNTKAR----TRPSKDRRHSIS  546



>ref|XP_011006799.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Populus euphratica]
Length=599

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 135/223 (61%), Gaps = 16/223 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  381  MENYLAEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVC  440

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NA  433
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N 
Sbjct  441  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNI  500

Query  432  IATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF  259
             +T  +  +D   +L +ENE L+ EL++MKM I +++       +S   +    + + +F
Sbjct  501  FSTDIRPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSF  560

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
             +S+SKKLG++NPF       SN        T+P + RR SIS
Sbjct  561  INSVSKKLGRINPFVRADGPLSNTKAR----TRPSKDRRHSIS  599



>gb|AFK45576.1| unknown [Medicago truncatula]
Length=468

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YL EIA + ELSISKFNGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVC
Sbjct  364  VDMYLAEIAAYGELSISKFNGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVC  423

Query  585  SVMDPLKLSYEARVHASQNKRLP  517
            SVMDPLKLSYEARVHASQNKRLP
Sbjct  424  SVMDPLKLSYEARVHASQNKRLP  446



>ref|XP_008787157.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Phoenix 
dactylifera]
Length=610

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 129/223 (58%), Gaps = 18/223 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L+I +F  +A L+ + AR ++D +YRAIDIYLKAHP L  +ER+KVC
Sbjct  394  MESYLAEIASDHNLTIERFISLAELIPEQARVIEDGMYRAIDIYLKAHPSLSVVERKKVC  453

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR--------SGAEDP----KST  442
            S+MD  +LS EA  HA+QN RLPVQ+V+  LYY+Q + R        SG E P    K+T
Sbjct  454  SLMDCQRLSREACAHAAQNDRLPVQLVVQVLYYEQQRHRDVMSTGNLSGGESPALSQKAT  513

Query  441  PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT  262
            P  I   N       L +EN  L+ EL +M+M + +++    +  S+ K        K +
Sbjct  514  PYGIGYHNAPDELSRLRRENADLKLELFRMRMQLQEIEKSSGNTTSAGKPPLP----KKS  569

Query  261  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            F +S+SKKLG+L PF     D      G+     P+ RR SIS
Sbjct  570  FINSVSKKLGRLYPFMR--SDNEKTLSGKTRKKPPKDRRHSIS  610



>ref|XP_006380639.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58436.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=601

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 134/222 (60%), Gaps = 13/222 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  382  MENYLAEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVC  441

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NA  433
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N 
Sbjct  442  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPDLPPKVNI  501

Query  432  IATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF  259
             +T  +  +D   +L +ENE L+ EL++MKM + +++       +S   +    + + +F
Sbjct  502  FSTDIRPVSDELSSLRRENEDLKIELVKMKMKMKEIERATVVSTTSSPSADKPPLPRKSF  561

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
             +S+SKKLG++NPF     D   L + +      + RR SIS
Sbjct  562  INSVSKKLGRINPFVRA--DGFPLSNTKARTRPSKDRRHSIS  601



>gb|EEC74727.1| hypothetical protein OsI_10455 [Oryza sativa Indica Group]
Length=626

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 130/238 (55%), Gaps = 32/238 (13%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D+YL EIA+   LS+ KF  +A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC
Sbjct  394  MDSYLAEIASDENLSVDKFTALAELIPERARFNEDGMYRAIDIYLKAHPSLAEGERKKVC  453

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT------  424
              MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R+ ++ P + P+          
Sbjct  454  RAMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYAGGESPALS  513

Query  423  -----------RNQLQADVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas  280
                       R  +  +V+ L +EN+ LR ELL+MKM + D  +   S G         
Sbjct  514  YRPTPSFNGRHRPGVPDEVSRLQRENDELRMELLRMKMRLRD-PSVAFSAGGVPPSGRPP  572

Query  279  aVRKPT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              +KP          F +SMSKKLG+LNPF      +  L  G V    P+ RR SIS
Sbjct  573  LPKKPGGGGGGSSGGFMNSMSKKLGRLNPFLR----SDVLGGGRVRTKPPKDRRHSIS  626



>ref|XP_006380638.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58435.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=643

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 134/222 (60%), Gaps = 13/222 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   L++SKF G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  424  MENYLAEIASDRNLTVSKFIGLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVC  483

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NA  433
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P   P  N 
Sbjct  484  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPDLPPKVNI  543

Query  432  IATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF  259
             +T  +  +D   +L +ENE L+ EL++MKM + +++       +S   +    + + +F
Sbjct  544  FSTDIRPVSDELSSLRRENEDLKIELVKMKMKMKEIERATVVSTTSSPSADKPPLPRKSF  603

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
             +S+SKKLG++NPF     D   L + +      + RR SIS
Sbjct  604  INSVSKKLGRINPFVRA--DGFPLSNTKARTRPSKDRRHSIS  643



>gb|AAN77296.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94554.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|EEE58548.1| hypothetical protein OsJ_09846 [Oryza sativa Japonica Group]
Length=626

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 130/238 (55%), Gaps = 32/238 (13%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D+YL EIA+   LS+ KF  +A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC
Sbjct  394  MDSYLAEIASDENLSVDKFTALAELIPERARFNEDGMYRAIDIYLKAHPSLAEGERKKVC  453

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT------  424
              MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R+ ++ P + P+          
Sbjct  454  RAMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYAGGESPALS  513

Query  423  -----------RNQLQADVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas  280
                       R  +  +V+ L +EN+ LR ELL+MKM + D  +   S G         
Sbjct  514  YRPTPSFNGRHRPGVPDEVSRLQRENDELRMELLRMKMRLRD-PSVAFSAGGVPPSGRPP  572

Query  279  aVRKPT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              +KP          F +SMSKKLG+LNPF      +  L  G V    P+ RR SIS
Sbjct  573  LPKKPGGGGGGSSGGFMNSMSKKLGRLNPFLR----SDVLGGGRVRTKPPKDRRHSIS  626



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 134/228 (59%), Gaps = 27/228 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A    L +SKF  +A L    AR VDD LYRA+DIYLKAHP L ++ER+K+C
Sbjct  386  MDGYLAEVAPDPNLKVSKFIALAELFPDHARLVDDSLYRAVDIYLKAHPALSDLERKKLC  445

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-----------------AE  457
             ++D  KLS EA  HA+QN+RLPVQ+V+  LYY+Q+++R+                  A 
Sbjct  446  KLLDVQKLSQEACQHAAQNERLPVQMVVQVLYYEQMRLRTAMTTSFVDGEQVGPYSQKAA  505

Query  456  DPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa  277
             P     AI+ R+      ++ +EN  L+ E+ +M+M + D++    +    ++ + +S+
Sbjct  506  GPGGLSAAISPRDHYS---SIRRENRELKLEVARMRMRLTDLEKDHVNMKEGIQKTGSSS  562

Query  276  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
                 F SS++K L KLNPF+   KD+SN+ + +  +   RRRR SIS
Sbjct  563  K----FLSSVTKTLSKLNPFRF--KDSSNVPNAKSGMNS-RRRRHSIS  603



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 134/228 (59%), Gaps = 27/228 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A    L +SKF  +A L    AR VDD LYRA+DIYLKAHP L ++ER+K+C
Sbjct  398  MDGYLAEVAPDPNLKVSKFIALAELFPDHARLVDDSLYRAVDIYLKAHPALSDLERKKLC  457

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-----------------AE  457
             ++D  KLS EA  HA+QN+RLPVQ+V+  LYY+Q+++R+                  A 
Sbjct  458  KLLDVQKLSQEACQHAAQNERLPVQMVVQVLYYEQMRLRTAMTTSFVDGEQVGPYSQKAA  517

Query  456  DPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa  277
             P     AI+ R+      ++ +EN  L+ E+ +M+M + D++    +    ++ + +S+
Sbjct  518  GPGGLSAAISPRDHYS---SIRRENRELKLEVARMRMRLTDLEKDHVNMKEGIQKTGSSS  574

Query  276  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
                 F SS++K L KLNPF+   KD+SN+ + +  +   RRRR SIS
Sbjct  575  K----FLSSVTKTLSKLNPFRF--KDSSNVPNAKSGMNN-RRRRHSIS  615



>gb|KHN36285.1| BTB/POZ domain-containing protein [Glycine soja]
Length=618

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 139/227 (61%), Gaps = 20/227 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIAT   L+++KF  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVC
Sbjct  396  MENYIAEIATDRNLAVTKFTSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVC  455

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQ  409
            SVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R+     +S  +++ ++ N   
Sbjct  456  SVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRNAMNGSRSGESSVDSKLNVYS  515

Query  408  ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP---  265
             D+        TL +ENE L+ EL+++KM + +++N       +    S++ +  KP   
Sbjct  516  TDLHPVSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPAVSASPSADKPPLP  575

Query  264  --TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
              +F SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  576  RRSFMSSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  618



>ref|XP_006579934.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN06007.1| BTB/POZ domain-containing protein [Glycine soja]
Length=590

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 142/231 (61%), Gaps = 27/231 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   L++SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVC
Sbjct  367  MENYLAEIATDRNLAVSKFITVAELIPEQSRPTEDGMYRAIDIYLKAHPVLSDMEKKKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR------SGAEDP------KST  442
            SVMD  KLS EA  HA+QN RLPVQ+V+  LYY+Q ++R      +G + P       S+
Sbjct  427  SVMDCQKLSREACAHAAQNDRLPVQMVVQVLYYEQQRLRDSMDGNAGWDSPNFRDKVNSS  486

Query  441  PNAI-ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRK  268
            PN +    N+L     L +ENE L+ E++++KM + +++       SS     ++ +  K
Sbjct  487  PNELNLVSNELS---ILRRENEDLKLEIVKLKMKLKEIERTSIRSASSSPVIFASPSADK  543

Query  267  P-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
            P     +F +S+SKKLG+L+PF  G+  T+ L  G V   KP + RR SIS
Sbjct  544  PPLPRKSFINSVSKKLGRLSPFSRGNAATTLL-KGHV---KPDKNRRHSIS  590



>ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
Length=618

 Score =   144 bits (363),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 90/231 (39%), Positives = 139/231 (60%), Gaps = 28/231 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIAT   L+++KF  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVC
Sbjct  396  MENYIAEIATDRNLAVTKFTSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVC  455

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQ  409
            SVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R+     +S  +++ ++ N   
Sbjct  456  SVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRNAMNGSRSGESSVDSKLNVYS  515

Query  408  ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP---  265
             D+        TL +ENE L+ EL+++KM + +++N       +    S++ +  KP   
Sbjct  516  TDLHPVSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPAVSASPSADKPPLP  575

Query  264  --TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDI----TKP-RRRRFSIS  133
              +F SS+SKKLG+L+PF           DG +      TKP + RR SIS
Sbjct  576  RRSFMSSVSKKLGRLSPFVRA--------DGVLPFPKGRTKPNKNRRHSIS  618



>ref|XP_008341358.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Malus domestica]
Length=568

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 133/234 (57%), Gaps = 31/234 (13%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   +S+SKF GIA L+ + +R+ +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  343  MENYLAEIATDRNVSVSKFIGIAELIPEQSRETEDGMYRAIDIYLKAHPALSDMERKKVC  402

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        GAE      + + 
Sbjct  403  SMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNSIGAES-----SVLP  457

Query  426  TRNQLQAD---------VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV  274
            ++  L +            L ++NE L+ EL++MKM + +++   +         +    
Sbjct  458  SKGSLYSTDIHPVPDELTILRRQNEELKMELVKMKMKLKELETSTTRTAMISPMGNTPTS  517

Query  273  R-KP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
              KP     +F +S+SKKLGKL+PF      T     G    TKP + RR SIS
Sbjct  518  XDKPPLPRKSFINSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  568



>ref|XP_008354715.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=626

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 137/234 (59%), Gaps = 31/234 (13%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   +S+SKF GIA L+ + +R+ +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  401  MENYLAEIATDRNVSVSKFIGIAELIPEQSRETEDGMYRAIDIYLKAHPALSDMERKKVC  460

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        GAE      + + 
Sbjct  461  SMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNSIGAES-----SVLP  515

Query  426  TRNQLQA--------DVTLV-KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV  274
            ++  L +        ++T++ ++NE L+ EL++MKM + +++   +         +    
Sbjct  516  SKGSLYSTDIHPVPDELTILRRQNEELKMELVKMKMKLKELETSTTRTAMISPMGNTPTS  575

Query  273  R-KP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
              KP     +F +S+SKKLGKL+PF      T     G    TKP + RR SIS
Sbjct  576  XDKPPLPRKSFINSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  626



>ref|XP_008238282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
 ref|XP_008238290.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
Length=624

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 132/226 (58%), Gaps = 17/226 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   +S+SKF GIA LV + +R  +D +YRA+DIYLKAHP L ++ER+KVC
Sbjct  399  MENYLAEIATDRNVSVSKFIGIAELVPEQSRATEDGMYRAVDIYLKAHPALSDMERKKVC  458

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP--KSTPNA  433
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       +G E     S  N 
Sbjct  459  SMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLTGGESSVLPSKGNL  518

Query  432  IATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-  265
             +T      D    L ++NE L+ EL++MKM + +++        S   G+ +++  KP 
Sbjct  519  YSTDIHPVPDELSILRRQNEELKIELVKMKMRLKELETSTMRTSMSSPMGNISTSADKPP  578

Query  264  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
                +F +S+SKKLG+L+PF      T ++  G     K RR   S
Sbjct  579  LPRKSFINSVSKKLGRLSPFVRTDGVTPSIPKGRTRAAKDRRHSIS  624



>ref|XP_002465671.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
 gb|EER92669.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
Length=598

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 126/224 (56%), Gaps = 22/224 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+ V+L I KF G+A ++ + AR  +D +YRAIDIYLKAHP L E  R+KVC
Sbjct  381  LESYLAEIASDVDLPIDKFTGLAEMIPERARFNEDGMYRAIDIYLKAHPHLSEAGRKKVC  440

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
             VMD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R   + P S P   A    LQ 
Sbjct  441  RVMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLREAPKAP-SPPYRPAPTPSLQG  499

Query  405  --------DVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT---  262
                    +V+ L +ENE L+ ELL+MKM + +          +         +K     
Sbjct  500  RHARTVLDEVSRLQRENEELKMELLRMKMHMREPPAALPQPSGAPPPGRRPPPKKAAGGS  559

Query  261  --FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSI  136
              F +++SKKLG+LNPF         LD    +  K RRRR SI
Sbjct  560  GGFMNNVSKKLGRLNPFLR-------LDAVGTEPPKDRRRRRSI  596



>ref|XP_010412681.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=243

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 89/234 (38%), Positives = 131/234 (56%), Gaps = 36/234 (15%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   ++++KF G A  + K +R  +D +YRAIDIYLK HP + E+E++KVC
Sbjct  23   MESYLAEIASDRNVNLAKFIGFAECIPKQSRITEDGMYRAIDIYLKTHPNISEMEKKKVC  82

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT------  424
            ++MD  KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A AT      
Sbjct  83   NLMDCQKLSREKCAHAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAAATVEDTHP  142

Query  423  -------RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgss-----vkgssas  280
                    N+L     L +EN+ L+ EL+++KM   +++    +   +         S +
Sbjct  143  PPELSSYNNELS---KLNRENQELKLELIKVKMKFKELEKNQKAFEVTSGSDCSSSVSIA  199

Query  279  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +V KP     +F SS+S++LGKLNPF  G K        +V    P+ RR SIS
Sbjct  200  SVVKPRLPRKSFMSSVSRQLGKLNPF--GQK--------QVQTKPPKGRRHSIS  243



>ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis]
Length=621

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 130/203 (64%), Gaps = 13/203 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   L++++F G+A L+ + +R  +D +YRAIDI+LKAHP + ++ER+KVC
Sbjct  402  MENYLAEIASDRNLTVARFIGLAELIPEQSRITEDGMYRAIDIFLKAHPAISDMERKKVC  461

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS---GAEDPK--STPNAIATR  421
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    G + P   +  N  AT 
Sbjct  462  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMIGGDSPTLPTKVNLYATN  521

Query  420  NQLQAD--VTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP-----  265
            N   +D   +L +ENE L+ EL++MKM + +++ + G    +S    ++ +  KP     
Sbjct  522  NHPVSDEISSLKRENEDLKLELVKMKMRLKEIEKSGGGRSVTSSPALNSPSADKPPLPRK  581

Query  264  TFFSSMSKKLGKLNPFKHGSKDT  196
            +F +S+SKKLG+L PF  G  D+
Sbjct  582  SFINSVSKKLGRLYPFVRGEGDS  604



>emb|CDP02580.1| unnamed protein product [Coffea canephora]
Length=620

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 133/226 (59%), Gaps = 17/226 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   LS+SKF G+A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  397  MENYLAEIASDRNLSVSKFVGLAELLPERSRITEDGMYRAIDIYLKAHPALSDMERKKVC  456

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-TPNAIATRNQLQ  409
            SVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +  +  TPN     NQ  
Sbjct  457  SVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGTEGETPNLALKVNQHP  516

Query  408  AD--------VTLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP---  265
            A          +L KEN+ L+ EL++M+  + +++ +   S  +S    +  +  KP   
Sbjct  517  AGSHTAPQELSSLRKENQDLKLELVKMRTRLRELEKSSDKSYAASPLVITLPSAEKPPLP  576

Query  264  --TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              +  SS+S+KLGK+NPF     D     + +V     + RR SIS
Sbjct  577  RKSLISSVSRKLGKINPFLRA--DALFPSNAKVRSKPSKDRRHSIS  620



>ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Glycine max]
Length=618

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 135/227 (59%), Gaps = 20/227 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIAT   L + KF  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVC
Sbjct  396  MENYIAEIATDRNLPVPKFTSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVC  455

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQ  409
            SVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N   
Sbjct  456  SVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYS  515

Query  408  ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP---  265
             D+        TL +ENE L+ EL+++KM + +++N       +    S++ +  KP   
Sbjct  516  TDLHPVSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLP  575

Query  264  --TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
              +F SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  576  RRSFMSSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  618



>ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=623

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 140/231 (61%), Gaps = 24/231 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   LS+SKF G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVC
Sbjct  397  MESYLAEIASDRNLSVSKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPTISDLERKKVC  456

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATR-N  418
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+     +P AI++R N
Sbjct  457  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSISSGDSP-AISSRVN  515

Query  417  QLQAD--------VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas--aVRK  268
               AD         +L +ENE L+ EL++MKM + +++   S + +          +  K
Sbjct  516  LYTADSHPVSDELSSLKRENEDLKLELVKMKMRLKEIEKSSSVKSAVSSPMGIILPSSDK  575

Query  267  P-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            P     +F +S+SKKLG+L PF      + +   G    T+P + RR SIS
Sbjct  576  PPLPRKSFMNSVSKKLGRLYPFVRSDGVSPSSAKGR---TRPSKDRRHSIS  623



>ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Glycine max]
Length=628

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 135/227 (59%), Gaps = 20/227 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIAT   L + KF  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVC
Sbjct  406  MENYIAEIATDRNLPVPKFTSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVC  465

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQ  409
            SVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N   
Sbjct  466  SVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYS  525

Query  408  ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP---  265
             D+        TL +ENE L+ EL+++KM + +++N       +    S++ +  KP   
Sbjct  526  TDLHPVSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLP  585

Query  264  --TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
              +F SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  586  RRSFMSSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  628



>gb|KHN12984.1| BTB/POZ domain-containing protein [Glycine soja]
Length=640

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 135/227 (59%), Gaps = 20/227 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIAT   L + KF  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVC
Sbjct  418  MENYIAEIATDRNLPVPKFTSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVC  477

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQ  409
            SVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N   
Sbjct  478  SVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYS  537

Query  408  ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP---  265
             D+        TL +ENE L+ EL+++KM + +++N       +    S++ +  KP   
Sbjct  538  TDLHPVSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLP  597

Query  264  --TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
              +F SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  598  RRSFMSSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  640



>gb|KJB48679.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=355

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 133/228 (58%), Gaps = 26/228 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L ISKF G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVC
Sbjct  137  MESYLVEIASDRNLPISKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPTITDMERKKVC  196

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQ  409
            S+MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R        +P  I ++ N   
Sbjct  197  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYP  256

Query  408  ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------  271
             DV        +L +EN+ L+ EL++MKM + +++   S++ +      +          
Sbjct  257  TDVHPVSGELSSLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPL  316

Query  270  -KPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
             K +F +S+SKKLG+L PF         +  G    T+P + RR SIS
Sbjct  317  PKKSFMNSVSKKLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  355



>ref|XP_009411062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Musa 
acuminata subsp. malaccensis]
Length=583

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/222 (40%), Positives = 126/222 (57%), Gaps = 17/222 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L+I++F  +  LV + AR  +D +YRAIDIYLKAHP   + ER+KVC
Sbjct  368  MESYLAEIASDPNLTIARFISLGELVSEQARVNEDGMYRAIDIYLKAHPSSTDEERKKVC  427

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP----KSTP  439
            S+MD  KLS EA  HA+QN+RLPVQ V+  L+ +Q + R       +G E P    +STP
Sbjct  428  SLMDCQKLSREACAHAAQNERLPVQTVVQVLFCEQQRFRDATSGSFTGGESPALSLRSTP  487

Query  438  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF  259
             +   R        L +EN+ LR +LL+M+M + +++       S+ K        K +F
Sbjct  488  CSTKHRGGTDELSRLQRENDDLRMQLLRMRMLLKEVEKPSGQIPSAQKPPLP----KKSF  543

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
             +S+SKKLG+L PF H          G      P+ RR SIS
Sbjct  544  INSLSKKLGRLYPFTHADGVKPFSSKGRTK--PPKDRRHSIS  583



>ref|XP_009342777.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Pyrus 
x bretschneideri]
Length=629

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 136/234 (58%), Gaps = 31/234 (13%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   +S+SKF GIA L+ + +R+ +D +YRAIDIYLKAH  L ++ER+KVC
Sbjct  404  MENYLAEIATDRNVSVSKFIGIAELIPEQSRETEDGMYRAIDIYLKAHSALSDMERKKVC  463

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        GAE      + + 
Sbjct  464  SMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNPIGAES-----SVLP  518

Query  426  TRNQLQAD---------VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasa  277
            ++  L +            L ++NE L+ EL++MKM + +++   +        G++ ++
Sbjct  519  SKGSLYSTDIHPVPDELTILRRQNEELKIELVKMKMKLKELETSTTRTTMISPMGNTPTS  578

Query  276  VRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
              KP     +F +S+SKKLGKL+PF      T     G    TKP + RR SIS
Sbjct  579  ADKPPLPRKSFMNSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  629



>ref|XP_010905283.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Elaeis guineensis]
Length=533

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 133/223 (60%), Gaps = 19/223 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   L+I++F  +A L+ + AR  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  318  MEGYLAEIASDHNLTIARFISLAELIPEQARVFEDGMYRAIDIYLKAHPSLSDMERKKVC  377

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP----KSTP  439
            S+M+  KLS EA  HA+QN RLPVQIV+  L+++Q + R       SG E P    K+TP
Sbjct  378  SLMECQKLSREACAHAAQNDRLPVQIVVQVLHHEQQRRRDVMSGNFSGGESPALSQKATP  437

Query  438  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF  259
              +   N       L +EN  L+ EL +M+M + +++    +  S+ K        K +F
Sbjct  438  FGVGYHNAPDELSRLRRENADLKLELFRMRMQLKEIEKSSGNITSAGKPPLP----KKSF  493

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
             +S+SKKLG+L PF     D+     G+  +TKP + RR SIS
Sbjct  494  INSVSKKLGRLYPFMRS--DSVKPPSGK-RMTKPHKDRRHSIS  533



>gb|ACL53070.1| unknown [Zea mays]
 tpg|DAA43884.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=500

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 115/196 (59%), Gaps = 13/196 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+ V+L + KF G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC
Sbjct  279  MESYLAEIASDVDLPVDKFTGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKTVC  338

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
             VMD  KLS EA  HA+QN RLPVQ V+  L+++Q ++R        G E P   P+   
Sbjct  339  RVMDCQKLSREACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQG  398

Query  426  TRNQLQAD--VTLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKP  265
               +   D    L +ENE L+ ELL++KM + D     Q+  +           +A    
Sbjct  399  RHGRSVPDEMSQLQRENEELKMELLRLKMNLRDPSAPPQHSDAPPSGRRPLPKKAAGGSG  458

Query  264  TFFSSMSKKLGKLNPF  217
             F +++SKKLG+LNPF
Sbjct  459  GFINNVSKKLGRLNPF  474



>ref|XP_010905282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Elaeis guineensis]
Length=609

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 133/223 (60%), Gaps = 19/223 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   L+I++F  +A L+ + AR  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  394  MEGYLAEIASDHNLTIARFISLAELIPEQARVFEDGMYRAIDIYLKAHPSLSDMERKKVC  453

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP----KSTP  439
            S+M+  KLS EA  HA+QN RLPVQIV+  L+++Q + R       SG E P    K+TP
Sbjct  454  SLMECQKLSREACAHAAQNDRLPVQIVVQVLHHEQQRRRDVMSGNFSGGESPALSQKATP  513

Query  438  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF  259
              +   N       L +EN  L+ EL +M+M + +++    +  S+ K        K +F
Sbjct  514  FGVGYHNAPDELSRLRRENADLKLELFRMRMQLKEIEKSSGNITSAGKPPLP----KKSF  569

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
             +S+SKKLG+L PF     D+     G+  +TKP + RR SIS
Sbjct  570  INSVSKKLGRLYPFMRS--DSVKPPSGK-RMTKPHKDRRHSIS  609



>ref|XP_010028107.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Eucalyptus grandis]
 gb|KCW54768.1| hypothetical protein EUGRSUZ_I00715 [Eucalyptus grandis]
Length=614

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 126/203 (62%), Gaps = 24/203 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   LS+S+F  +A LV + AR  +D +YRAIDIYLKAHP L E+ER+KVC
Sbjct  394  MENYLAEIASDRNLSVSRFISLAELVPEQARVTEDGIYRAIDIYLKAHPALSELERKKVC  453

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKSTPNAIAT  424
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       G E P + P  +  
Sbjct  454  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESP-AAPRKL--  510

Query  423  RNQLQADV--------TLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVR  271
             N    D+         L +ENE L+ EL++MKM + +++ +   S G S  GS+ S+  
Sbjct  511  -NVYSTDIHPVSDELSRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSAD  569

Query  270  KP-----TFFSSMSKKLGKLNPF  217
            KP     +F +SMSKKLG+L PF
Sbjct  570  KPPLPRKSFINSMSKKLGRLYPF  592



>ref|XP_010028106.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Eucalyptus grandis]
Length=615

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 126/203 (62%), Gaps = 24/203 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   LS+S+F  +A LV + AR  +D +YRAIDIYLKAHP L E+ER+KVC
Sbjct  395  MENYLAEIASDRNLSVSRFISLAELVPEQARVTEDGIYRAIDIYLKAHPALSELERKKVC  454

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKSTPNAIAT  424
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       G E P + P  +  
Sbjct  455  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESP-AAPRKL--  511

Query  423  RNQLQADV--------TLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVR  271
             N    D+         L +ENE L+ EL++MKM + +++ +   S G S  GS+ S+  
Sbjct  512  -NVYSTDIHPVSDELSRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSAD  570

Query  270  KP-----TFFSSMSKKLGKLNPF  217
            KP     +F +SMSKKLG+L PF
Sbjct  571  KPPLPRKSFINSMSKKLGRLYPF  593



>ref|XP_006600924.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN28330.1| BTB/POZ domain-containing protein [Glycine soja]
Length=583

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 123/199 (62%), Gaps = 15/199 (8%)
 Frame = -1

Query  756  YLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM  577
            YL EIAT   L++SKF  +A L+   +R+ +D +YRAIDIYLKAHP L ++E++KVCSVM
Sbjct  370  YLAEIATDRNLAVSKFITVAELIPDQSRETEDGMYRAIDIYLKAHPILSDMEKKKVCSVM  429

Query  576  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR------SGAEDPKSTPNAIATRNQ  415
            D  KLS EA  HA+QN RLPVQ+V+  LYY+Q ++R      +G + P       ++ N+
Sbjct  430  DCQKLSREACAHAAQNDRLPVQMVVQVLYYEQQRLRDSMDSSAGWDSPNFLDKVNSSPNE  489

Query  414  LQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFS  253
            L     L +EN+ L+ E++++KM + + +       SS     ++ +  KP     +F +
Sbjct  490  LS---ILRRENQDLKLEIVKLKMRLKEFERTSIRSASSSPVIYASRSADKPPLPRKSFIN  546

Query  252  SMSKKLGKLNPFKHGSKDT  196
            S+SKKLG+L+PF  G   T
Sbjct  547  SVSKKLGRLSPFSRGDAAT  565



>ref|XP_010028108.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Eucalyptus grandis]
Length=597

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 135/229 (59%), Gaps = 28/229 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   LS+S+F  +A LV + AR  +D +YRAIDIYLKAHP L E+ER+KVC
Sbjct  377  MENYLAEIASDRNLSVSRFISLAELVPEQARVTEDGIYRAIDIYLKAHPALSELERKKVC  436

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKSTPNAIAT  424
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       G E P + P  +  
Sbjct  437  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESP-AAPRKL--  493

Query  423  RNQLQADV--------TLVKENEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVR  271
             N    D+         L +ENE L+ EL++MKM + +++ +   S G S  GS+ S+  
Sbjct  494  -NVYSTDIHPVSDELSRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSAD  552

Query  270  KP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
            KP     +F +SMSKKLG+L PF     +      G++  +K RR   S
Sbjct  553  KPPLPRKSFINSMSKKLGRLYPFGVAPPNA----KGKMKPSKDRRHSIS  597



>ref|XP_007208165.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
 gb|EMJ09364.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
Length=624

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 130/226 (58%), Gaps = 17/226 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   +S+SKF GIA LV + +R  +D +YRA+DIYLKAHP L ++ER+KVC
Sbjct  399  MENYLAEIATDRNVSVSKFIGIAELVPEQSRATEDGMYRAVDIYLKAHPALSDMERKKVC  458

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP--KSTPNA  433
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E     S  N 
Sbjct  459  SMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLIGGESSVLPSKGNL  518

Query  432  IATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-  265
             +T      D    L ++NE L+ EL++MK  + +++        S   G+ +++  KP 
Sbjct  519  YSTDIHPVPDELSILRRQNEELKIELVKMKKRLKELETSTVRTSISSPMGNISTSADKPP  578

Query  264  ----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
                +F +S+SKKLG+L+PF      T ++  G     K RR   S
Sbjct  579  LPRKSFINSVSKKLGRLSPFVRTDGVTPSIPKGRTRAAKDRRHSIS  624



>ref|XP_010559030.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Tarenaya hassleriana]
Length=588

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 129/227 (57%), Gaps = 26/227 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   +++ KF G+A L+ + +R  +D +YRAIDIYLKAHP + E+ER+KVC
Sbjct  372  MESYLAEIASDRNVNVPKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPNISEVERKKVC  431

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q +IR   ++    P           
Sbjct  432  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRIRDVMKE-TDIPTDPPPSILPPP  490

Query  405  DVT--------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP-----  265
              T        L +EN+ L+ ELL+MKM + + +       +S    SA ++ KP     
Sbjct  491  KPTSYNEELSKLKRENQDLKLELLKMKMKLKEYEKSEMGSSNSNSPVSAVSMGKPPLPKK  550

Query  264  TFFSSMSKKLGKLNPFK---HGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +F SS+SKKLG+L PF    H ++  +           P+ RR SIS
Sbjct  551  SFMSSVSKKLGRLYPFGISPHNARGRTK---------PPKDRRHSIS  588



>tpg|DAA43883.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=597

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 115/196 (59%), Gaps = 13/196 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+ V+L + KF G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC
Sbjct  376  MESYLAEIASDVDLPVDKFTGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKTVC  435

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
             VMD  KLS EA  HA+QN RLPVQ V+  L+++Q ++R        G E P   P+   
Sbjct  436  RVMDCQKLSREACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQG  495

Query  426  TRNQLQAD--VTLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKP  265
               +   D    L +ENE L+ ELL++KM + D     Q+  +           +A    
Sbjct  496  RHGRSVPDEMSQLQRENEELKMELLRLKMNLRDPSAPPQHSDAPPSGRRPLPKKAAGGSG  555

Query  264  TFFSSMSKKLGKLNPF  217
             F +++SKKLG+LNPF
Sbjct  556  GFINNVSKKLGRLNPF  571



>ref|XP_010559028.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Tarenaya hassleriana]
Length=589

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 129/227 (57%), Gaps = 26/227 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   +++ KF G+A L+ + +R  +D +YRAIDIYLKAHP + E+ER+KVC
Sbjct  373  MESYLAEIASDRNVNVPKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPNISEVERKKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q +IR   ++    P           
Sbjct  433  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRIRDVMKE-TDIPTDPPPSILPPP  491

Query  405  DVT--------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP-----  265
              T        L +EN+ L+ ELL+MKM + + +       +S    SA ++ KP     
Sbjct  492  KPTSYNEELSKLKRENQDLKLELLKMKMKLKEYEKSEMGSSNSNSPVSAVSMGKPPLPKK  551

Query  264  TFFSSMSKKLGKLNPFK---HGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +F SS+SKKLG+L PF    H ++  +           P+ RR SIS
Sbjct  552  SFMSSVSKKLGRLYPFGISPHNARGRTK---------PPKDRRHSIS  589



>gb|ACL52494.1| unknown [Zea mays]
Length=597

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 114/196 (58%), Gaps = 13/196 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+ V+L + KF G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC
Sbjct  376  MESYLAEIASDVDLPVDKFTGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKTVC  435

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
             VMD  KLS EA  HA+QN RLPVQ V+  L+++Q ++R        G E P   P+   
Sbjct  436  RVMDCQKLSREACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQG  495

Query  426  TRNQLQAD--VTLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKP  265
               +   D    L +ENE L+ ELL++KM + D     Q   +           +A    
Sbjct  496  RHGRSVPDEMSQLQRENEELKMELLRLKMNLRDPSAPPQPSDAPPSGRRPLPKKAAGGSG  555

Query  264  TFFSSMSKKLGKLNPF  217
             F +++SKKLG+LNPF
Sbjct  556  GFINNVSKKLGRLNPF  571



>gb|KJB48678.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=501

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 133/228 (58%), Gaps = 26/228 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L ISKF G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVC
Sbjct  283  MESYLVEIASDRNLPISKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPTITDMERKKVC  342

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQ  409
            S+MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R        +P  I ++ N   
Sbjct  343  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYP  402

Query  408  ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------  271
             DV        +L +EN+ L+ EL++MKM + +++   S++ +      +          
Sbjct  403  TDVHPVSGELSSLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPL  462

Query  270  -KPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
             K +F +S+SKKLG+L PF         +  G    T+P + RR SIS
Sbjct  463  PKKSFMNSVSKKLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  501



>ref|XP_002989054.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
 gb|EFJ09848.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
Length=607

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/245 (36%), Positives = 133/245 (54%), Gaps = 38/245 (16%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D+YL E+A    L +SKF  +A L+ + +R V+D LYRA+DI+LKAHP L E +R+++C
Sbjct  367  MDSYLAEVAPDANLKVSKFIALAELLPEHSRMVEDGLYRAVDIFLKAHPLLVEADRKRIC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKS----TPNA  433
             +MDP +LS EA  HA+QN+RLP   ++  LY++QL+I++       E PK     TP A
Sbjct  427  KLMDPQRLSQEACSHAAQNERLPAHFIIQVLYFEQLRIKTALANYAIEMPKGDHGPTPIA  486

Query  432  IATRNQLQADV----------------TLVKENEALRTELLQMKMFIADMQNkgssqgss  301
             A R+   A                   L +EN+ L+ EL +MK+ ++D++ + S   S 
Sbjct  487  AALRSSTAAANAAAAAAAAAADANPQSALRRENKELKIELTRMKIRLSDLEKEQSPGVSR  546

Query  300  vkgssasaVRKPT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRR  148
                   +    +         FF ++S++LGKLNPF   S           ++ KPRRR
Sbjct  547  ASEEKRLSSPTSSAASSPGSGRFFHTVSRRLGKLNPFGKSSLKPP----ATPELQKPRRR  602

Query  147  RFSIS  133
            R SIS
Sbjct  603  RHSIS  607



>ref|XP_010086959.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=624

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 134/235 (57%), Gaps = 31/235 (13%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIA+   LS+SKF G+A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  397  MENYIAEIASDRNLSVSKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPVLSDMERKKVC  456

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKST-PNAI  430
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P S  P+ +
Sbjct  457  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLVGGESPASALPSKL  516

Query  429  ATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV  274
               N    D+         L +ENE L+ EL++MKM + +++   + + +     S    
Sbjct  517  ---NLYSTDIHPVSDELSGLRRENEDLKIELVKMKMKMKEIERSTAVKSAVNSPQSVIMS  573

Query  273  R--KP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
               KP     +F +S+SK+LG+L PF      T +        TKP + RR SIS
Sbjct  574  SADKPPRPRKSFMNSVSKRLGRLYPFVRSDGVTPSYKGR----TKPSKDRRHSIS  624



>gb|KJB48677.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=614

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 133/228 (58%), Gaps = 26/228 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L ISKF G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVC
Sbjct  396  MESYLVEIASDRNLPISKFIGLAELIPEQSRVTEDGMYRAIDIYLKAHPTITDMERKKVC  455

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQ  409
            S+MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R        +P  I ++ N   
Sbjct  456  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYP  515

Query  408  ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------  271
             DV        +L +EN+ L+ EL++MKM + +++   S++ +      +          
Sbjct  516  TDVHPVSGELSSLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPL  575

Query  270  -KPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
             K +F +S+SKKLG+L PF         +  G    T+P + RR SIS
Sbjct  576  PKKSFMNSVSKKLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  614



>ref|XP_002983725.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
 gb|EFJ15221.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
Length=604

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/242 (36%), Positives = 133/242 (55%), Gaps = 35/242 (14%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D+YL E+A    L +SKF  +A ++ + +R V+D LYRA+DI+LKAHP L E +R+++C
Sbjct  367  MDSYLAEVAPDANLKVSKFIALAEVLPEHSRMVEDGLYRAVDIFLKAHPLLVEADRKRIC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKS----TPNA  433
             +MDP +LS EA  HA+QN+RLP   ++  LY++QL+I++       E PK     TP A
Sbjct  427  KLMDPQRLSQEACSHAAQNERLPAHFIIQVLYFEQLRIKTALANYAIEMPKGDHGPTPIA  486

Query  432  IATRNQLQADV-------------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkg  292
             A R+   A                L +EN+ L+ EL +MK+ ++D++ + S   S    
Sbjct  487  AALRSSTAAANAAAAAAADANPQSALRRENKELKIELTRMKIRLSDLEKEQSPGVSRASE  546

Query  291  ssasaVRKPT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
                +    +         FF ++S++LGKLNPF   S           ++ KPRRRR S
Sbjct  547  EKRLSSPTSSAASSPGSGRFFYTVSRRLGKLNPFGKSSLKPP----ATPELQKPRRRRHS  602

Query  138  IS  133
            IS
Sbjct  603  IS  604



>ref|XP_004149698.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=621

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 127/229 (55%), Gaps = 23/229 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   +S+SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  396  MENYLAEIASDRNVSVSKFINLAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVC  455

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P   A  N 
Sbjct  456  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPAVPAKLNI  515

Query  414  LQADVT-------------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV  274
              A+               L +EN+ L+ EL++MKM + + +    S   +      +A 
Sbjct  516  YSAETAAAAAHPVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTNTQLQPNAE  575

Query  273  RKP----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
            + P    +F +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  576  KPPLPKKSFINSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  621



>ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
Length=617

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 134/224 (60%), Gaps = 20/224 (9%)
 Frame = -1

Query  756  YLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM  577
            YL EIAT   L + KF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCSVM
Sbjct  398  YLAEIATDRNLPVPKFTCLAELIPEQSRPTEDGMYRAIDIYLKAHPALSDMERKKVCSVM  457

Query  576  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV  400
            D  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++ ++ N   +D+
Sbjct  458  DCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNGSGESSVDSKLNVYSSDL  517

Query  399  --------TLVKENEALRTELLQMKMFIADMQNkg-ssqgssvkgssasaVRKP-----T  262
                    TL +EN+ L+ EL+++K  + +++     S  +S   S++ +  KP     +
Sbjct  518  QPASNELSTLRRENQDLKLELVKLKRRLKEIETTTPKSAVNSPAVSASPSADKPPLPRRS  577

Query  261  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
            F SS+SKKLG+L+PF   +   +    G    TKP + RR SIS
Sbjct  578  FMSSVSKKLGRLSPFVR-ADGVAPFAKGR---TKPNKNRRHSIS  617



>dbj|BAK07863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=613

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 95/246 (39%), Positives = 131/246 (53%), Gaps = 40/246 (16%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL E+++ V L + KF G+A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC
Sbjct  373  MESYLAEVSSDVNLPVDKFTGLAELIPERARFNEDGMYRAIDIYLKAHPSLGEGERKKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR--------------SGAEDP-  451
             VMD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R              +G E P 
Sbjct  433  GVMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRVPPPSQAPSGAPSYAGGESPA  492

Query  450  ---KSTPNAIA-TRNQLQADVT-LVKENEALRTELLQMKMFIAD---MQNkgssqgssvk  295
               K TP+     R+   ++V+ L +EN+ LR EL+QMKM + D        +   ++  
Sbjct  493  LSYKPTPSFNGRERSAPSSEVSRLQRENDELRMELMQMKMRLRDPSGAAPAAAPPLAAGA  552

Query  294  gssasaVRKPTF------------FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR  151
              S+ A  KP                   KKLG+LNPF         L  G+V    P+ 
Sbjct  553  TRSSPASGKPPLPKKQGGASGGGGGGGFMKKLGRLNPFVR-----DPLAGGKVRTKPPKD  607

Query  150  RRFSIS  133
            RR SIS
Sbjct  608  RRHSIS  613



>ref|XP_006466487.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Citrus 
sinensis]
Length=623

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 137/233 (59%), Gaps = 28/233 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   LS++KF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  397  MENYLAEIATDRNLSVAKFISLAELIPEQSRITEDGMYRAIDIYLKAHPTLSDMERKKVC  456

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIA  427
            S+MD  KLS EA  HA+QN RLPVQ V+  LY++Q +IR       +G + P + P+ I 
Sbjct  457  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI-  514

Query  426  TRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasa  277
              N   AD+        +L +ENE L+ ELL+MKM + +++   +   ++     ++  +
Sbjct  515  --NLYSADLHPVSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYS  572

Query  276  VRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              KP     +F +S+SKKLG+L PF     D  +  + +      + RR SIS
Sbjct  573  ADKPPLPRKSFINSVSKKLGRLYPFVRA--DVVSPSNPKTRTKPNKNRRHSIS  623



>gb|KDO78972.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=623

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 137/233 (59%), Gaps = 28/233 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   LS++KF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  397  MENYLAEIATDRNLSVAKFISLAELIPEQSRITEDGMYRAIDIYLKAHPTLSDMERKKVC  456

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIA  427
            S+MD  KLS EA  HA+QN RLPVQ V+  LY++Q +IR       +G + P + P+ I 
Sbjct  457  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI-  514

Query  426  TRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasa  277
              N   AD+        +L +ENE L+ ELL+MKM + +++   +   ++     ++  +
Sbjct  515  --NLYSADLHPVSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYS  572

Query  276  VRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              KP     +F +S+SKKLG+L PF     D  +  + +      + RR SIS
Sbjct  573  ADKPPLPRKSFINSVSKKLGRLYPFVRA--DVVSPSNPKTRTKPNKNRRHSIS  623



>ref|XP_009782405.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
sylvestris]
Length=620

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 121/201 (60%), Gaps = 21/201 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   LS+SKF  +A ++ + A+  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  396  MENYLAEIASDRNLSVSKFISLAEVIPEQAKITEDGMYRAIDIYLKAHPALSDMERKKVC  455

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS---GAEDPKSTPNAI--ATR  421
             VMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    G++   + P A+  +  
Sbjct  456  GVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGSQLVATEPPALIPSKT  515

Query  420  NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV---  274
            NQ   D+        +L +EN+ L+ ELL+MKM + +++   +   +S            
Sbjct  516  NQFSTDIRPISDEVSSLKRENQELKFELLKMKMRLKEIEKPSNKSATSSPLVITHPSADK  575

Query  273  ----RKPT-FFSSMSKKLGKL  226
                RKP+ F SS+SKKLGK 
Sbjct  576  PPLPRKPSNFISSVSKKLGKF  596



>ref|NP_001152299.1| transposon protein Mutator sub-class [Zea mays]
 gb|ACG46890.1| transposon protein Mutator sub-class [Zea mays]
Length=597

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 113/196 (58%), Gaps = 13/196 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+ V+L + KF G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC
Sbjct  376  MESYLAEIASDVDLPVDKFTGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKAVC  435

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
             VMD  KLS EA  HA+ N RLPVQ V+  L+++Q ++R        G E P   P+   
Sbjct  436  RVMDCQKLSREACAHAAHNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQG  495

Query  426  TRNQLQAD--VTLVKENEALRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKP  265
               +   D    L +ENE L+ ELL++KM + D     Q   +           +A    
Sbjct  496  RHGRSVPDEMSQLQRENEELKMELLRLKMNLRDPSAPPQPSDAPPSGRRPLPKKAAGGSG  555

Query  264  TFFSSMSKKLGKLNPF  217
             F +++SKKLG+LNPF
Sbjct  556  GFINNVSKKLGRLNPF  571



>ref|XP_006426057.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
 gb|ESR39297.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
Length=623

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 137/233 (59%), Gaps = 28/233 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   LS++KF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  397  MENYLAEIATDRNLSVAKFISLAELIPEQSRITEDGMYRAIDIYLKAHPTLSDMERKKVC  456

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIA  427
            S+MD  KLS EA  HA+QN RLPVQ V+  LY++Q +IR       +G + P + P+ I 
Sbjct  457  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI-  514

Query  426  TRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasa  277
              N   AD+        +L +ENE L+ ELL+MKM + +++   +   ++     ++  +
Sbjct  515  --NLYSADLHPVSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYS  572

Query  276  VRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              KP     +F +S+SKKLG+L PF     D  +  + +      + RR SIS
Sbjct  573  ADKPPLPRKSFINSVSKKLGRLYPFVRA--DVVSPSNPKTRTKPNKNRRHSIS  623



>ref|XP_008368005.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=232

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 127/228 (56%), Gaps = 20/228 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   +S+SKF GIA L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  8    MENYLAEIATDRNISVSKFIGIAELIPEQSRATEDGMYRAIDIYLKAHPALSDMERKKVC  67

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAED----PKSTPN  436
            S+MD   LS EA  HA+QN RLPV  V+  LYY+Q ++R       G E      K + +
Sbjct  68   SMMDCQXLSREACXHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVH  127

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP--  265
            +            L ++N  L+ EL++MKM + +++        S   G++  +  KP  
Sbjct  128  STDIHTVPDELTILRRQNAELKIELVKMKMKLKELETSTMRTAMSSPMGNTPISADKPPL  187

Query  264  ---TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
               +F + +SK+LG L+PF      T     G    TKP + RR SIS
Sbjct  188  PRKSFMNLVSKRLGXLSPFVRADGVTPTGTKGR---TKPSKDRRHSIS  232



>ref|XP_010412682.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 89/234 (38%), Positives = 131/234 (56%), Gaps = 36/234 (15%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   ++++KF G A  + K +R  +D +YRAIDIYLK HP + E+E++KVC
Sbjct  351  MESYLAEIASDRNVNLAKFIGFAECIPKQSRITEDGMYRAIDIYLKTHPNISEMEKKKVC  410

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT------  424
            ++MD  KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A AT      
Sbjct  411  NLMDCQKLSREKCAHAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAAATVEDTHP  470

Query  423  -------RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgss-----vkgssas  280
                    N+L     L +EN+ L+ EL+++KM   +++    +   +         S +
Sbjct  471  PPELSSYNNELS---KLNRENQELKLELIKVKMKFKELEKNQKAFEVTSGSDCSSSVSIA  527

Query  279  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +V KP     +F SS+S++LGKLNPF  G K        +V    P+ RR SIS
Sbjct  528  SVVKPRLPRKSFMSSVSRQLGKLNPF--GQK--------QVQTKPPKGRRHSIS  571



>ref|XP_009379312.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Pyrus x bretschneideri]
Length=505

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 126/225 (56%), Gaps = 16/225 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA    +S+SKF GIA L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  281  MENYLAEIAIDRNISVSKFIGIAELIPEQSRATEDGMYRAIDIYLKAHPALSDMERKKVC  340

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDP--KSTPNAI  430
            S+MD  KLS EA  HA+QN RLPV  V+  LYY+Q ++R       G E     S  +  
Sbjct  341  SMMDCQKLSREASAHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVY  400

Query  429  ATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP--  265
            +T   +  D    L ++NE L+ EL +MKM + +++   +    S   G++  +  KP  
Sbjct  401  STDVHMVPDELTILRRQNEELKIELGKMKMKLKELETSTARTAMSSPMGNTPISADKPPL  460

Query  264  ---TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
               +F + +SK+LGKL+PF      T     G     K RR   S
Sbjct  461  PRKSFMNLVSKRLGKLSPFVRADGVTPTGTKGRTKSAKDRRHSIS  505



>emb|CDY37857.1| BnaAnng05180D [Brassica napus]
Length=600

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 85/239 (36%), Positives = 132/239 (55%), Gaps = 39/239 (16%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  373  METYLAEIASDRNVSLQKFTGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST------------  442
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +            
Sbjct  433  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPTATV  492

Query  441  --PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRK  268
              P  +++ N   + V   +EN+ L+ ELL+MKM + + + + + + SS   + +S    
Sbjct  493  LPPPKLSSYNDELSKVK--RENQDLKLELLKMKMKLKEFEKENNEKKSSTTTTMSSNHSS  550

Query  267  P--------------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            P              +F +S+SKKLGKLNPF    +  +           P+ RR SIS
Sbjct  551  PRSTASMDKPPLPRKSFINSVSKKLGKLNPFGIPPRGRTK---------PPKDRRHSIS  600



>ref|XP_004509079.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509080.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=598

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 133/230 (58%), Gaps = 22/230 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIAT   LS+ KF  +A L+ + +R  +D +YRAIDIYLKAHP L + +R+KVC
Sbjct  372  LESYLTEIATDRNLSVPKFISLAELIPEQSRTTEDGMYRAIDIYLKAHPFLSDTDRKKVC  431

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--------GAEDPKSTPNAI  430
            S+MD  KLS EAR HA+QN RLPVQ V   LYYDQ + R+        G+E P +  N  
Sbjct  432  SMMDCQKLSREARAHAAQNNRLPVQSVAQVLYYDQQRRRNDMDGIGSVGSESPLTPENRN  491

Query  429  ATRNQL---QADVT-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa-----  277
               ++L     +V+ L +ENE L+ E+ ++ M I + +        S    + ++     
Sbjct  492  VYSSELYPVSNEVSKLRRENEELKLEIAKLTMKIKESEKCKLESAVSSPLLNVTSPSADK  551

Query  276  --VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              + K +F +S+S+KLG+L+PF       ++  D    + + + RRFSIS
Sbjct  552  PPLHKKSFLNSVSRKLGRLSPFSRQDPVITHPKD---PVKQDKIRRFSIS  598



>emb|CAN71562.1| hypothetical protein VITISV_007563 [Vitis vinifera]
Length=621

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 135/243 (56%), Gaps = 35/243 (14%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L++SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVC
Sbjct  382  MESYLAEIASDRNLNVSKFISLAELLPEQSRVKEDGMYRAIDIYLKAHPSLSDMEKKKVC  441

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P   P +  
Sbjct  442  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNL  501

Query  426  TRNQLQ--AD--VTLVKENEALRTELLQMKMFIAD---------------------MQNk  322
              N L   +D  ++L +ENE L+ EL++MKM + +                     +Q+ 
Sbjct  502  FSNDLHPVSDELLSLRRENEDLKLELMKMKMRLKEIEKSAVPSGVPTSLPSAYSSILQSA  561

Query  321  gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRF  142
             SS  ++   +    + + +F +S+SK+LG+L PF           DG+      R RR 
Sbjct  562  ASSPRNTPPSADKPPLPRKSFMNSVSKRLGRLYPFVRADGVAP---DGKARTKPSRDRRH  618

Query  141  SIS  133
            SIS
Sbjct  619  SIS  621



>ref|XP_004985270.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Setaria 
italica]
Length=614

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 131/241 (54%), Gaps = 35/241 (15%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++AYL EIA+   L I KF G+A ++ + AR  +D +YRAIDIYLKAHP L E ER+KVC
Sbjct  378  MEAYLAEIASDANLPIDKFTGLAEMIPERARFNEDGMYRAIDIYLKAHPHLSEPERKKVC  437

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------------GAEDP--  451
              MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R              G E P  
Sbjct  438  KAMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLREAPTHAPSGASSFYGGESPPP  497

Query  450  ----KSTPNAIATRNQLQA----DVT-LVKENEALRTELLQMKMFIADMQN-kgssqgss  301
                K TP+ +    +  A    +V+ L +EN+ L+ ELL++KM + D       +  + 
Sbjct  498  SLPYKPTPSLMGRHARGGAAPAEEVSQLQRENDELKMELLRLKMRLRDPSAPLPPTGAAP  557

Query  300  vkgssasaVRKP----TFFSSMSKKLGKLNPF-KHGSKDTSNLDDGEVDITKPRRRRFSI  136
                  S  +KP     F +++SKKLGKLNPF +H +         +V    P+ RR SI
Sbjct  558  PPSGRHSMPKKPGAGGGFMNNVSKKLGKLNPFVRHDAMGVP-----KVRTKPPKDRRHSI  612

Query  135  S  133
             
Sbjct  613  G  613



>gb|EPS72379.1| hypothetical protein M569_02379, partial [Genlisea aurea]
Length=583

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 116/189 (61%), Gaps = 18/189 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   LS+SKF  ++ L+   +R  +D +YRAIDIYLKAHP L + ER+ VC
Sbjct  377  MENYLAEIASDRNLSVSKFISLSELIPDRSRATEDGMYRAIDIYLKAHPGLSDTERKTVC  436

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            SVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +  +S+P A A   +   
Sbjct  437  SVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGGESSPAAAAAAAKGSP  496

Query  405  D----VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP-----TFFS  253
            D      L +EN  L+ E+L++KM + + +            ++AS VRKP     +F S
Sbjct  497  DSEEVAFLRRENRELKMEVLRLKMKLKEWET---------PAAAASVVRKPPLPKKSFMS  547

Query  252  SMSKKLGKL  226
            S+S+KLGKL
Sbjct  548  SVSQKLGKL  556



>ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Vitis 
vinifera]
Length=636

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 135/243 (56%), Gaps = 35/243 (14%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L++SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVC
Sbjct  397  MESYLAEIASDRNLNVSKFISLAELLPEQSRVKEDGMYRAIDIYLKAHPSLSDMEKKKVC  456

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P   P +  
Sbjct  457  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNL  516

Query  426  TRNQLQ--AD--VTLVKENEALRTELLQMKMFIAD---------------------MQNk  322
              N L   +D  ++L +ENE L+ EL++MKM + +                     +Q+ 
Sbjct  517  FSNDLHPVSDELLSLRRENEDLKLELMKMKMRLKEIEKSAVPSGVPTSLPSAYSSILQSA  576

Query  321  gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRF  142
             SS  ++   +    + + +F +S+SK+LG+L PF           DG+      R RR 
Sbjct  577  ASSPRNTPPSADKPPLPRKSFMNSVSKRLGRLYPFVRADGVAP---DGKARTKPSRDRRH  633

Query  141  SIS  133
            SIS
Sbjct  634  SIS  636



>ref|XP_009115683.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Brassica rapa]
Length=567

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 123/211 (58%), Gaps = 24/211 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL E+A+   +++ KF GIA  + + +R  DD +YRAID+YLK HP + E+E++K+C
Sbjct  349  MESYLAEVASDRNINLVKFMGIAECIPEQSRITDDGIYRAIDMYLKVHPNISEVEKKKIC  408

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-----------SGAEDPKSTP  439
            S+M+  KLS EA  HA+QNKRLPV IV   L+ +Q  +R           + A  P+S P
Sbjct  409  SLMNSQKLSQEACAHAAQNKRLPVHIVAQVLHQEQQSLRQVLCDSDSPVAATAIAPESPP  468

Query  438  NAIAT--RNQLQADVTLVKENEALRTELLQMKMFIADMQ--------Nkgssqgssvkgs  289
                +   N+L     L +EN+ L+ ELL++KM + +++        +       S    
Sbjct  469  PPTLSSYNNELS---KLNRENQDLKLELLKVKMTLKELEREKDFEIKSCSDCSSVSTASV  525

Query  288  sasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  196
              S +R+ +F SS+S+KLGKLNPF H  + T
Sbjct  526  VKSPLRRKSFISSVSRKLGKLNPFGHTQRRT  556



>ref|XP_009379310.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Pyrus x bretschneideri]
Length=625

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 126/225 (56%), Gaps = 16/225 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA    +S+SKF GIA L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  401  MENYLAEIAIDRNISVSKFIGIAELIPEQSRATEDGMYRAIDIYLKAHPALSDMERKKVC  460

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDP--KSTPNAI  430
            S+MD  KLS EA  HA+QN RLPV  V+  LYY+Q ++R       G E     S  +  
Sbjct  461  SMMDCQKLSREASAHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVY  520

Query  429  ATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP--  265
            +T   +  D    L ++NE L+ EL +MKM + +++   +    S   G++  +  KP  
Sbjct  521  STDVHMVPDELTILRRQNEELKIELGKMKMKLKELETSTARTAMSSPMGNTPISADKPPL  580

Query  264  ---TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
               +F + +SK+LGKL+PF      T     G     K RR   S
Sbjct  581  PRKSFMNLVSKRLGKLSPFVRADGVTPTGTKGRTKSAKDRRHSIS  625



>ref|XP_009115684.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Brassica rapa]
Length=566

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 123/211 (58%), Gaps = 24/211 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL E+A+   +++ KF GIA  + + +R  DD +YRAID+YLK HP + E+E++K+C
Sbjct  348  MESYLAEVASDRNINLVKFMGIAECIPEQSRITDDGIYRAIDMYLKVHPNISEVEKKKIC  407

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-----------SGAEDPKSTP  439
            S+M+  KLS EA  HA+QNKRLPV IV   L+ +Q  +R           + A  P+S P
Sbjct  408  SLMNSQKLSQEACAHAAQNKRLPVHIVAQVLHQEQQSLRQVLCDSDSPVAATAIAPESPP  467

Query  438  NAIAT--RNQLQADVTLVKENEALRTELLQMKMFIADMQ--------Nkgssqgssvkgs  289
                +   N+L     L +EN+ L+ ELL++KM + +++        +       S    
Sbjct  468  PPTLSSYNNELS---KLNRENQDLKLELLKVKMTLKELEREKDFEIKSCSDCSSVSTASV  524

Query  288  sasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  196
              S +R+ +F SS+S+KLGKLNPF H  + T
Sbjct  525  VKSPLRRKSFISSVSRKLGKLNPFGHTQRRT  555



>ref|XP_004511860.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X4 [Cicer arietinum]
 ref|XP_004511861.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X5 [Cicer arietinum]
Length=628

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 125/207 (60%), Gaps = 25/207 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   LS++KF  +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVC
Sbjct  398  MENYLAEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVC  457

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N 
Sbjct  458  SMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNV  516

Query  414  LQADVT----------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR--  271
               D            L +ENE L+ EL+++KM + +++       ++V  S +      
Sbjct  517  YSGDTQFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPS  576

Query  270  ----KP-----TFFSSMSKKLGKLNPF  217
                KP     +F SS+SKKLGKL+PF
Sbjct  577  GSADKPPLPRRSFISSVSKKLGKLSPF  603



>ref|XP_004511862.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X6 [Cicer arietinum]
Length=627

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 125/207 (60%), Gaps = 25/207 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   LS++KF  +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVC
Sbjct  397  MENYLAEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVC  456

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N 
Sbjct  457  SMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNV  515

Query  414  LQADVT----------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR--  271
               D            L +ENE L+ EL+++KM + +++       ++V  S +      
Sbjct  516  YSGDTQFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPS  575

Query  270  ----KP-----TFFSSMSKKLGKLNPF  217
                KP     +F SS+SKKLGKL+PF
Sbjct  576  GSADKPPLPRRSFISSVSKKLGKLSPF  602



>gb|KEH27511.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=516

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 123/211 (58%), Gaps = 29/211 (14%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   LS++KF  +A L+ + ++  +D +YRA+DIYLKAHP L ++ER+KVC
Sbjct  283  MENYLAEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRALDIYLKAHPNLSDMERKKVC  342

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
            S+MD  +LS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+E  +S P+     N 
Sbjct  343  SIMDCQRLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSETAES-PSIHTKLNV  401

Query  414  LQADV-------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas--------  280
               D+       +L +ENE L+ E++++KM + +++             S          
Sbjct  402  YSGDIQVSNELTSLRRENEDLKLEVVKLKMKLKEIEISTLKSTVKSTVKSTVNSPIANAS  461

Query  279  -----aVRKP-----TFFSSMSKKLGKLNPF  217
                 +  KP     +F SS+SKKLGKL+PF
Sbjct  462  PSHSHSADKPPLPRKSFISSVSKKLGKLSPF  492



>ref|XP_004511859.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X3 [Cicer arietinum]
Length=678

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 125/207 (60%), Gaps = 25/207 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   LS++KF  +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVC
Sbjct  448  MENYLAEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVC  507

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N 
Sbjct  508  SMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNV  566

Query  414  LQADVT----------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR--  271
               D            L +ENE L+ EL+++KM + +++       ++V  S +      
Sbjct  567  YSGDTQFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPS  626

Query  270  ----KP-----TFFSSMSKKLGKLNPF  217
                KP     +F SS+SKKLGKL+PF
Sbjct  627  GSADKPPLPRRSFISSVSKKLGKLSPF  653



>ref|XP_004511857.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511858.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=679

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 125/207 (60%), Gaps = 25/207 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   LS++KF  +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVC
Sbjct  449  MENYLAEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVC  508

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N 
Sbjct  509  SMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNV  567

Query  414  LQADVT----------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR--  271
               D            L +ENE L+ EL+++KM + +++       ++V  S +      
Sbjct  568  YSGDTQFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPS  627

Query  270  ----KP-----TFFSSMSKKLGKLNPF  217
                KP     +F SS+SKKLGKL+PF
Sbjct  628  GSADKPPLPRRSFISSVSKKLGKLSPF  654



>ref|XP_003597110.1| Root phototropism protein [Medicago truncatula]
 ref|XP_003611625.1| Root phototropism protein [Medicago truncatula]
 gb|AES94583.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 123/211 (58%), Gaps = 29/211 (14%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIAT   LS++KF  +A L+ + ++  +D +YRA+DIYLKAHP L ++ER+KVC
Sbjct  397  MENYLAEIATDRNLSVAKFISLAELIPEQSKPTEDGMYRALDIYLKAHPNLSDMERKKVC  456

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
            S+MD  +LS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+E  +S P+     N 
Sbjct  457  SIMDCQRLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSETAES-PSIHTKLNV  515

Query  414  LQADV-------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas--------  280
               D+       +L +ENE L+ E++++KM + +++             S          
Sbjct  516  YSGDIQVSNELTSLRRENEDLKLEVVKLKMKLKEIEISTLKSTVKSTVKSTVNSPIANAS  575

Query  279  -----aVRKP-----TFFSSMSKKLGKLNPF  217
                 +  KP     +F SS+SKKLGKL+PF
Sbjct  576  PSHSHSADKPPLPRKSFISSVSKKLGKLSPF  606



>ref|XP_006339816.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=596

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 117/197 (59%), Gaps = 17/197 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   LS++ F  +A ++ + AR  +D +YRAIDIYLKAHP L +IER+KVC
Sbjct  376  MENYLAEIASDRNLSVTNFINLAEVIPEQARITEDGMYRAIDIYLKAHPVLSDIERKKVC  435

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA-------  427
             VMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++  G++   + P A+        
Sbjct  436  GVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLHDGSQLVATEPPALVPSKRDHQ  495

Query  426  -TRNQLQADV-TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas--------a  277
             + N +  +V +L +EN+ L+ ELL+MK  + D++    +  ++      +         
Sbjct  496  FSTNPVSDEVSSLKRENQELKFELLKMKTRLIDIEKPNLNTSATSSPLVITHPSAGKPPL  555

Query  276  VRKPTFFSSMSKKLGKL  226
             RK  F SS+SKKLG+ 
Sbjct  556  PRKSNFMSSVSKKLGRF  572



>ref|XP_008457767.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis melo]
Length=620

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 129/231 (56%), Gaps = 25/231 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   +S+SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  393  MENYLAEIASDRNVSVSKFINLAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVC  452

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P   A  + 
Sbjct  453  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPTVPAKLSI  512

Query  414  LQADVT-------------LVKENEALRTELLQMKMFIADMQN-kgssqgssvkgssasa  277
              A+               L +EN+ L+ EL++MKM + + +    SS  ++ +    + 
Sbjct  513  YSAETAAAAAHPVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTNTRLQPTTT  572

Query  276  VRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
              KP     +F +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  573  AEKPPLPKKSFINSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  620



>ref|XP_008457766.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis melo]
Length=621

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 129/231 (56%), Gaps = 25/231 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   +S+SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  394  MENYLAEIASDRNVSVSKFINLAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVC  453

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P   A  + 
Sbjct  454  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPTVPAKLSI  513

Query  414  LQADVT-------------LVKENEALRTELLQMKMFIADMQN-kgssqgssvkgssasa  277
              A+               L +EN+ L+ EL++MKM + + +    SS  ++ +    + 
Sbjct  514  YSAETAAAAAHPVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTNTRLQPTTT  573

Query  276  VRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
              KP     +F +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  574  AEKPPLPKKSFINSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  621



>gb|KFK28391.1| hypothetical protein AALP_AA8G509000 [Arabis alpina]
Length=604

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 87/238 (37%), Positives = 134/238 (56%), Gaps = 36/238 (15%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIA+   +++ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  376  MENYMAEIASDRNVTLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  435

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR--------SGAEDPKSTPNAI  430
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R        S A  P     A+
Sbjct  436  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSESSAPQPPQQATAV  495

Query  429  ------ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgs-------  289
                  +  ++L     L +EN+ L+ ELL+MKM + + + +   +  S   S       
Sbjct  496  LPPKLSSYNDELS---KLKRENQDLKLELLKMKMKLKEFEKESDKKSVSTTMSSIPGSPM  552

Query  288  sasaVRKP------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            S +++ KP      +F +S+SKKLGKLNPF   + +             P+ RR SIS
Sbjct  553  STASMDKPPLPPKKSFINSVSKKLGKLNPFGIPAYNARG------RTKPPKDRRHSIS  604



>ref|XP_004231910.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
lycopersicum]
Length=596

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 122/206 (59%), Gaps = 20/206 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   LS++ F  +A ++ + AR  +D +YRAIDIYLKAHP L +IER+KVC
Sbjct  376  MENYLAEIASDRNLSVTNFINLAEVIPEQARITEDGMYRAIDIYLKAHPALSDIERKKVC  435

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-----  421
             +MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++ +G++   + P A+ +      
Sbjct  436  GIMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLHNGSQLVATEPPALVSSKRDDQ  495

Query  420  ---NQLQADV-TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa--------  277
               N +  +V +L +EN+ L+ ELL+MK  + +++   S+  +S      +         
Sbjct  496  FSTNPVSDEVSSLKRENQELKFELLKMKTRLIEIEKPKSNTSASSSPLVITQPSAGKPPL  555

Query  276  VRKPTFFSSMSKKLGKL---NPFKHG  208
             RK  F SS+SKKLG+    +   HG
Sbjct  556  PRKSNFMSSVSKKLGRFIRADGLTHG  581



>gb|AES90666.2| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=595

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 133/235 (57%), Gaps = 32/235 (14%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIAT   LS+ KF  +A L+ + +R  +D +YRAIDIYLKAHP + + +R+KVC
Sbjct  369  LESYLAEIATDRNLSVPKFICLAELMPEKSRTTEDGMYRAIDIYLKAHPFVSDTDRKKVC  428

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIA  427
            S+MD  KLS EAR HA+QN RLP Q V   LYY+Q ++R       S   D  STP+   
Sbjct  429  SMMDFQKLSREARTHAAQNNRLPAQNVAQILYYEQQRLRDNMDGTGSVGSDSPSTPD---  485

Query  426  TRNQLQADV--------TLVKENEALRTELLQMKMFIADMQ---------Nkgssqgssv  298
             RN   +++         L +ENE L+ E++++K+ I +M+         N      SS 
Sbjct  486  KRNVYSSELYPATNEVSKLRRENEELKLEIVKLKIKIKEMEKSTVLESPINSPLLNVSSP  545

Query  297  kgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
                    RK +F +S+S+KLG+L+PF+         D  ++D    + RR+SIS
Sbjct  546  SADKPPLPRK-SFLNSVSRKLGRLSPFQRAHPVIRPKDRIQLD----KIRRYSIS  595



>ref|XP_009628088.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
tomentosiformis]
Length=620

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 119/201 (59%), Gaps = 21/201 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   LS+SKF  +A ++ + A+  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  396  MENYLAEIASDRNLSVSKFISLAEVIPEQAKITEDGMYRAIDIYLKAHPALSDMERKKVC  455

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS---GAEDPKSTPNAI--ATR  421
             VMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    G++   + P  +  +  
Sbjct  456  GVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGSQLVATEPPTLIPSKT  515

Query  420  NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV---  274
            N    D+        +L +EN+ L+ ELL+MKM + +++   +   +S            
Sbjct  516  NHFSIDIPPVSDEVSSLKRENQELKFELLKMKMRLKEIEKPSNKSAASSPLVITHPSADK  575

Query  273  ----RKPT-FFSSMSKKLGKL  226
                RKP+ F SS+SKKLGK 
Sbjct  576  PPLPRKPSNFISSVSKKLGKF  596



>ref|XP_006393938.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
 gb|ESQ31224.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
Length=603

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 120/206 (58%), Gaps = 26/206 (13%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  379  MENYLAEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  438

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST-----------P  439
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +           P
Sbjct  439  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPPPPPPPATVLP  498

Query  438  NAIATRNQLQADVTLVKENEALRTELLQMKMFI------------ADMQNkgssqgssvk  295
              +++ N   +   L +EN+ L+ ELL+MKM +              M +  SS  S+  
Sbjct  499  PKLSSYNDELSK--LKRENQDLKLELLKMKMKLKEFEKESEKKSSTTMSSNPSSPISTAS  556

Query  294  gssasaVRKPTFFSSMSKKLGKLNPF  217
                   RK TF +S+S+KLGKLNPF
Sbjct  557  MDKPPLPRK-TFINSVSRKLGKLNPF  581



>gb|KFK34271.1| hypothetical protein AALP_AA5G123300 [Arabis alpina]
Length=551

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 128/217 (59%), Gaps = 20/217 (9%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   ++++KF G+A  + + +R  +D +YRAIDIYLKAHP + E+E++KVC
Sbjct  349  METYLAEIASDRNINLAKFIGLAECIPEQSRITEDGMYRAIDIYLKAHPNISEVEKKKVC  408

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S+MD  KLS EA  HA+QN RL VQ V+  L+Y+Q  +R    D  S P A    ++L  
Sbjct  409  SLMDCNKLSQEASAHAAQNDRLHVQTVVKVLHYEQQSLRQILRDTDS-PAAYNNDDELS-  466

Query  405  DVTLVKENEALRTELLQMKMFIADMQNkgssqgssv------kgssasaVRKPTFFSSMS  244
               L +EN+ L+ ELL++KM   + + + + +  S         +S    R+ +F S +S
Sbjct  467  --QLNRENQELKLELLKVKMNFKEFEEEKTFEVMSSSDYSLVSIASVVKPRRKSFISYVS  524

Query  243  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +KLGKLNPF        ++  G   I  P+ RR SIS
Sbjct  525  RKLGKLNPF--------SMTQGR--IIPPKGRRHSIS  551



>dbj|BAJ34215.1| unnamed protein product [Thellungiella halophila]
Length=603

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 120/206 (58%), Gaps = 26/206 (13%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  379  MENYLAEIASDRNVSLQKFIGLAELIPEQSRITEDGMYRAVDIYLKAHPNMSDVERKKVC  438

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST-----------P  439
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +           P
Sbjct  439  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPPPPPPPATVLP  498

Query  438  NAIATRNQLQADVTLVKENEALRTELLQMKMFI------------ADMQNkgssqgssvk  295
              +++ N   +   L +EN+ L+ ELL+MKM +              M +  SS  S+  
Sbjct  499  PKLSSYNDELSK--LKRENQDLKLELLKMKMKLKEFEKESEKKSSTTMSSNPSSPISTAS  556

Query  294  gssasaVRKPTFFSSMSKKLGKLNPF  217
                   RK TF +S+S+KLGKLNPF
Sbjct  557  MDKPPLPRK-TFINSVSRKLGKLNPF  581



>ref|XP_011099322.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Sesamum 
indicum]
Length=616

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 132/230 (57%), Gaps = 25/230 (11%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   LS+SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVC
Sbjct  393  MENYLAEIASDRNLSVSKFISLAELIPEQSRLTEDGMYRAIDIYLKAHPALSDMERKKVC  452

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-----SGAEDP------KSTP  439
            SVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R     + +E P      K +P
Sbjct  453  SVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGNLSEAPALPAPSKLSP  512

Query  438  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR--KP  265
             +I          TL +EN+ L+ EL++MKM + +M+   S+  +    ++A      KP
Sbjct  513  YSINVHPVNDEVSTLRRENQDLKLELVKMKMRLKEMEKPLSASSTPSPLAAARPTSLDKP  572

Query  264  -----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
                 +F SS+ KKLG+   F      +     G    TKP + RR SIS
Sbjct  573  PLPRKSFISSVGKKLGR---FIRADGISPQSSKGR---TKPAKDRRHSIS  616



>ref|XP_007155848.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 ref|XP_007155849.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27842.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27843.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
Length=591

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 129/229 (56%), Gaps = 24/229 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL E+AT   L +SKF  +A L+ +  R  +D +YRAIDIYLKAHP L + E++KVC
Sbjct  367  MENYLAEVATDRNLPVSKFITLAELIPQLYRSTEDGMYRAIDIYLKAHPILSDTEKKKVC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKS-------  445
            SVMD  KLS +A  HA+QN RLPVQ V+  LYY+Q ++R       G + P +       
Sbjct  427  SVMDCQKLSRDACAHAAQNDRLPVQTVVQVLYYEQQRLRDSVDGSVGWDSPNNFRDKANL  486

Query  444  TPNAI-ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVR  271
            +PN +    N+      L +ENE L+ E++++KM + +++       SS     ++ +  
Sbjct  487  SPNGLNPVSNEFS---NLRRENEELKLEIVKLKMKLKEIERSSLISASSSPVIYASPSAD  543

Query  270  KP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
            KP     +F +S+SKKLG+L+PF      T N   G V   K RR   S
Sbjct  544  KPPLPRKSFMNSVSKKLGRLSPFSRAGAAT-NPVKGRVKPDKNRRHSIS  591



>gb|KDP32052.1| hypothetical protein JCGZ_12513 [Jatropha curcas]
Length=622

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 135/230 (59%), Gaps = 24/230 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   L++S+F  +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVC
Sbjct  398  MENYLAEIASDRNLTVSRFINLAELIPEQSRITEDGMYRAIDIFLKAHPALSDMDRKKVC  457

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G      +P      N 
Sbjct  458  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNIIGGDSPALPQKMNL  517

Query  414  LQADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP  265
              A +         L +ENE L+ EL++MKM + +++    S+ ++     +S  +  KP
Sbjct  518  YSAGIPPVSDEISNLKRENEDLKIELVKMKMRLKEIEKSAGSRSATNSPLSNSTPSADKP  577

Query  264  -----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
                 +F +S+SK+LG+L PF     D+  +  G    TKP + RR SIS
Sbjct  578  PLPRKSFINSVSKRLGRLYPFVRAEGDS--IPKGR---TKPSKNRRHSIS  622



>ref|XP_010939121.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Elaeis 
guineensis]
Length=606

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 127/222 (57%), Gaps = 17/222 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L+I++F  +A+L+ + +R ++D +YRAIDIYLK+HP L ++ER K+C
Sbjct  391  MESYLAEIASDHNLTIARFISLADLIPEQSRVIEDGMYRAIDIYLKSHPSLSDMERRKIC  450

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP----KSTP  439
            S+MD  KLS EA  H ++N RLPV IV+  LYY+Q ++R        G E P    K+T 
Sbjct  451  SLMDSQKLSREACAHVARNDRLPVPIVVQVLYYEQQRLRDVTSGNLIGGESPALSQKATS  510

Query  438  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF  259
              I   N       L +EN+ L+ EL++++M + +++    +  ++ K        K +F
Sbjct  511  YGIGYHNAPDELSRLRRENDDLKLELVRLRMQLKEIEKSSGNIAAADKPPLP----KKSF  566

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              S+S KLG L  F H   DT  L   +     P+  R SIS
Sbjct  567  IHSISNKLGHLFAFMHS--DTVKLLSDKTRRKPPKVLRHSIS  606



>gb|AAU05485.1| At5g67385 [Arabidopsis thaliana]
 gb|AAU95431.1| At5g67385 [Arabidopsis thaliana]
Length=604

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 128/233 (55%), Gaps = 28/233 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  378  LENYMAEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  437

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +P     +     
Sbjct  438  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPAAVL  497

Query  405  DVTLV----------KENEALRTELLQMKMFIADMQ-------Nkgssqgssvkgssasa  277
               L           +EN+ L+ ELL+MKM + + +       +  +   +     S ++
Sbjct  498  PPKLSSYTDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKTSSSTISTNPSSPISTAS  557

Query  276  VRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              KP     +F +S+SKKLGKLNPF      +    +G      P+ RR SIS
Sbjct  558  TGKPPLPRKSFINSVSKKLGKLNPF------SITPYNGRGRTKPPKDRRHSIS  604



>ref|NP_680473.2| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
 sp|Q66GP0.2|Y5738_ARATH RecName: Full=BTB/POZ domain-containing protein At5g67385 [Arabidopsis 
thaliana]
 gb|AED98336.1| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
Length=604

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 128/233 (55%), Gaps = 28/233 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  378  LENYMAEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  437

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +P     +     
Sbjct  438  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPAAVL  497

Query  405  DVTLV----------KENEALRTELLQMKMFIADMQ-------Nkgssqgssvkgssasa  277
               L           +EN+ L+ ELL+MKM + + +       +  +   +     S ++
Sbjct  498  PPKLSSYTDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKTSSSTISTNPSSPISTAS  557

Query  276  VRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              KP     +F +S+SKKLGKLNPF      +    +G      P+ RR SIS
Sbjct  558  TGKPPLPRKSFINSVSKKLGKLNPF------SITPYNGRGRTKPPKDRRHSIS  604



>ref|XP_009130549.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Brassica rapa]
Length=600

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/239 (35%), Positives = 130/239 (54%), Gaps = 39/239 (16%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   +S+ KF  +A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  373  METYLAEIASDRNVSLQKFTCLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  432

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST------------  442
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +            
Sbjct  433  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPTATV  492

Query  441  --PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRK  268
              P  +++ N   + V   +EN+ L+ ELL+MKM + + + + + + SS   + +S    
Sbjct  493  LPPPKLSSYNDELSKVK--RENQDLKLELLKMKMKLKEFEKENNEKKSSTTTTMSSNHSS  550

Query  267  P--------------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            P              +F +S+SKKLGKL PF    +  +           P+ RR SIS
Sbjct  551  PRSTASMDKPPLPRKSFINSVSKKLGKLXPFGIPPRGRTK---------PPKDRRHSIS  600



>ref|XP_010484509.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Camelina sativa]
Length=548

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 132/232 (57%), Gaps = 27/232 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  323  LENYMAEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  382

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQ  409
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R     D  S          L 
Sbjct  383  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLP  442

Query  408  ADVT--------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaV  274
              ++        L +EN+ L+ ELL+MKM + + + +   + SS   S+        +++
Sbjct  443  PKLSSYNDELSKLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTASM  502

Query  273  RKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
             KP     +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  503  DKPPLPRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  548



>ref|XP_010426528.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 130/235 (55%), Gaps = 38/235 (16%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   ++++KF G A  + K +R  +D +Y AIDIYLK HP + E+E++KVC
Sbjct  351  MESYLAEIASDRNVNLAKFIGFAECIPKQSRITEDGMYLAIDIYLKTHPNISEMEKKKVC  410

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT------  424
             +MD  KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A AT      
Sbjct  411  KLMDSQKLSREKCAHAAQNDRLPVQTVVQVLYYEQKSLREILSDSDSPPAAAATVEDTLP  470

Query  423  -------RNQLQADVTLVKENEALRTELLQMKMFIADMQNkg-----ssqgssvkgssas  280
                    N+L     L +EN+ L+ EL+++KM   +++ +      +S        S +
Sbjct  471  PPELRTYNNELS---KLNRENQDLKLELIKVKMKFKELEKEQKDFEVTSGSDCSSSVSIA  527

Query  279  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            +V KP     +F SS+S++LGKLNPF  G K            TKP + RR SIS
Sbjct  528  SVVKPRLPRKSFMSSVSRQLGKLNPF--GLKQVQ---------TKPAKGRRHSIS  571



>emb|CBI33715.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 104/157 (66%), Gaps = 11/157 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L++SKF  +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVC
Sbjct  360  MESYLAEIASDRNLNVSKFISLAELLPEQSRVKEDGMYRAIDIYLKAHPSLSDMEKKKVC  419

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIA  427
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P   P +  
Sbjct  420  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNL  479

Query  426  TRNQLQ--AD--VTLVKENEALRTELLQMKMFIADMQ  328
              N L   +D  ++L +ENE L+ EL++MKM + +++
Sbjct  480  FSNDLHPVSDELLSLRRENEDLKLELMKMKMRLKEIE  516



>ref|XP_010464139.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Camelina 
sativa]
Length=603

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 132/232 (57%), Gaps = 27/232 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  378  LENYMAEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  437

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQ  409
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R     D  S          L 
Sbjct  438  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLP  497

Query  408  ADVT--------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaV  274
              ++        L +EN+ L+ ELL+MKM + + + +   + SS   S+        +++
Sbjct  498  PKLSSYNDELSKLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTTSM  557

Query  273  RKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
             KP     +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  558  DKPPLPRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  603



>ref|XP_010484507.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
 ref|XP_010484508.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
Length=603

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 132/232 (57%), Gaps = 27/232 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  378  LENYMAEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  437

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQ  409
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R     D  S          L 
Sbjct  438  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLP  497

Query  408  ADVT--------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asaV  274
              ++        L +EN+ L+ ELL+MKM + + + +   + SS   S+        +++
Sbjct  498  PKLSSYNDELSKLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTASM  557

Query  273  RKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
             KP     +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  558  DKPPLPRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  603



>gb|KJB43883.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=375

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 123/203 (61%), Gaps = 20/203 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L +SKF G+  L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVC
Sbjct  151  MESYLAEIASDRNLPVSKFIGLTELIPEQSRITEDGMYRAIDIYLKAHPTITDLERKKVC  210

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQ-  409
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S+  + +  +++  
Sbjct  211  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSPSISSRVNL  270

Query  408  ---ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgss---asaVR  271
                D+        +L +ENE L+ EL++MKM + +++   S+  S+          +  
Sbjct  271  YPPTDIHPVSDELSSLKRENEDLKLELVKMKMRLKEIERPSSAVPSAASSPMGIIVPSSD  330

Query  270  KP-----TFFSSMSKKLGKLNPF  217
            KP     +F +S+SKKLG+L PF
Sbjct  331  KPPLPRKSFMNSVSKKLGRLYPF  353



>ref|XP_001769248.1| predicted protein [Physcomitrella patens]
 gb|EDQ65960.1| predicted protein, partial [Physcomitrella patens]
Length=586

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 134/239 (56%), Gaps = 34/239 (14%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL EIA    L+ISKF  +A ++ + AR+VDD LYRA+D++LKAHP + E ER+ +C
Sbjct  354  LDTYLAEIAPDANLTISKFMALAEVLPEHARRVDDGLYRAVDVFLKAHPAIIEAERKTLC  413

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-----AEDP--------KS  445
             ++D  KLS +A  HA+QN+RLPVQ+V+  LY++QL++R+        DP        + 
Sbjct  414  KIIDCQKLSQDACTHAAQNERLPVQVVVQVLYFEQLRLRNAMSTINTRDPVLRLQLSQRM  473

Query  444  TPNAIATRNQLQADVTLV-KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRK  268
            T   +AT      +   V +EN  L+ E+ +M+M + +++   ++    +  +   +   
Sbjct  474  TVGNVATGQPPNENYESVRRENRDLKLEIARMRMRMTELERDQNNLKVDIVKNGGGSR--  531

Query  267  PTFFSSMSKKLGKLNPF-KHGSKDTSNLDDGEVDI-------------TKPRRRRFSIS  133
              F  SMSKKL KLNPF +  S+D  N   GE+                KPRRRR S+S
Sbjct  532  --FIDSMSKKLSKLNPFQRRESRDFKN--SGELGTNSSGTPLTPDTRSAKPRRRRHSVS  586



>ref|XP_006290338.1| hypothetical protein CARUB_v10016995mg [Capsella rubella]
 gb|EOA23236.1| hypothetical protein CARUB_v10016995mg [Capsella rubella]
Length=532

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 133/233 (57%), Gaps = 34/233 (15%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   ++++KF G A  + K +R  +D LY+AIDIYLK HP + E+E++KVC
Sbjct  312  MESYLAEIASDRNINLAKFIGFAECIPKQSRITEDGLYQAIDIYLKTHPNISEMEKKKVC  371

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR------------SGAEDPKST  442
            S++D  KLS E   HA+QN RLPVQ ++  LYY+Q  +R            + A D    
Sbjct  372  SLIDCQKLSREKCAHAAQNDRLPVQTMVQVLYYEQQHLREILSESDSPAVAATARDTLPP  431

Query  441  PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV----  274
            P+ +++ N   + +   +EN+ L+ EL+++KM   +++ + + +  +     +S+V    
Sbjct  432  PDELSSYNNELSKLN--RENQDLKLELIKVKMKFKELEKEKAFEVLTSGSDCSSSVSTAS  489

Query  273  ------RKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
                  ++ +F SS+S+KLGKLNPF         L  G+     P+ RR SIS
Sbjct  490  VVKPRLQRKSFISSISRKLGKLNPF--------GLKQGQTK--PPKGRRHSIS  532



>ref|XP_006650337.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Oryza 
brachyantha]
Length=624

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C
Sbjct  395  IDGYLAEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLC  454

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPN  436
             +MD  KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   +
Sbjct  455  RLMDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRS  514

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  328
             IAT  +     T V+EN+ L+  +  M+M +++++
Sbjct  515  GIATSGEAGGWATAVRENQVLKVGMDNMRMRLSELE  550



>ref|XP_006364419.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=602

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 127/222 (57%), Gaps = 28/222 (13%)
 Frame = -1

Query  756  YLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM  577
            YL EIA+   LS+S+F  +A +V +  R  +D +Y+AID+YLKAHP L ++ER+KVCSVM
Sbjct  379  YLAEIASDSNLSVSEFISVAEVVPEQLRITEDMMYKAIDMYLKAHPALSDVERKKVCSVM  438

Query  576  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRN  418
            +  KL+ EA  HA+QN+RLPVQIV+  LYY+Q ++R        GA DP S P      +
Sbjct  439  NCQKLTREACAHAAQNERLPVQIVVQVLYYEQQRLREVMDVSLVGA-DPPSRPPKFNWFS  497

Query  417  QLQADVT-----LVKENEALRTELLQMKMFIADMQ----NkgssqgssvkgssasaVRKP  265
               + VT     L +EN+ L+ EL+++KM   +++       +S    +    +   R P
Sbjct  498  SGISPVTDEVSSLKRENQDLKFELMKLKMKCREIEKRDDKSAASTPLGITTPPSDKPRLP  557

Query  264  --TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRR  145
              +F +++S+KLGKL P         +    EV I  P +R+
Sbjct  558  RKSFITAVSRKLGKLYP---------SFGTDEVTIPSPSKRK  590



>ref|XP_010503666.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 86/234 (37%), Positives = 129/234 (55%), Gaps = 36/234 (15%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   ++++KF G A  + K +R  +D +Y+AIDIYLK HP + E+E++KVC
Sbjct  351  MESYLAEIASDRNVNLAKFIGFAECIPKQSRITEDGMYQAIDIYLKTHPNISEMEKKKVC  410

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT------  424
            S+MD  KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A  T      
Sbjct  411  SLMDCQKLSREKCAHAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAAVTVEDTLT  470

Query  423  -------RNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgss-----vkgssas  280
                    N L     L +EN+ L+ EL+++KM   +++ +  +   +         S +
Sbjct  471  PPELRTYNNDLS---KLNRENQDLKLELIKVKMKFKELEKEQKAFEVTSGSDCSSSVSIA  527

Query  279  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +V KP     +F SS+S++LGKLN F  G +        +V    P+ RR SIS
Sbjct  528  SVVKPRLPRKSFMSSVSRQLGKLNLF--GQR--------QVQTKPPKGRRHSIS  571



>ref|XP_006841959.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
 gb|ERN03634.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
Length=609

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 113/194 (58%), Gaps = 21/194 (11%)
 Frame = -1

Query  756  YLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM  577
            YL EIA+   LS+SKF G+  L+ + ++  +D +YRAIDIYLKAH  L EIER+KVCS+M
Sbjct  399  YLAEIASDPNLSVSKFIGLVELIPEQSKANEDGIYRAIDIYLKAHASLIEIERKKVCSLM  458

Query  576  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR--------------SGAEDPKSTP  439
            D  KLS EA  HA+QN RLPVQ V+  LYY+Q  +R              S +    +  
Sbjct  459  DCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQSLRDAMNGNLTEKEEWLSQSHKANAHS  518

Query  438  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF  259
              ++  N+L   + L +ENE L+ E+++++M + +++        + K        K + 
Sbjct  519  KDLSPHNEL---LLLRRENEDLKLEMVKLRMRLKELEKLEKPPNRANKPPLP----KKSL  571

Query  258  FSSMSKKLGKLNPF  217
             +SMSKKLGKL PF
Sbjct  572  LNSMSKKLGKLYPF  585



>gb|KJB43882.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
 gb|KJB43884.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=487

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 123/203 (61%), Gaps = 20/203 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L +SKF G+  L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVC
Sbjct  263  MESYLAEIASDRNLPVSKFIGLTELIPEQSRITEDGMYRAIDIYLKAHPTITDLERKKVC  322

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQ-  409
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S+  + +  +++  
Sbjct  323  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSPSISSRVNL  382

Query  408  ---ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas---aVR  271
                D+        +L +ENE L+ EL++MKM + +++   S+  S+          +  
Sbjct  383  YPPTDIHPVSDELSSLKRENEDLKLELVKMKMRLKEIERPSSAVPSAASSPMGIIVPSSD  442

Query  270  KP-----TFFSSMSKKLGKLNPF  217
            KP     +F +S+SKKLG+L PF
Sbjct  443  KPPLPRKSFMNSVSKKLGRLYPF  465



>gb|EEE59569.1| hypothetical protein OsJ_11863 [Oryza sativa Japonica Group]
Length=513

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C
Sbjct  284  IDGYLAEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLC  343

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPN  436
             +MD  KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   +
Sbjct  344  RLMDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRS  403

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  328
            +I T  +     T V+EN+ L+  +  M+M +++++
Sbjct  404  SITTSGEAGGWATAVRENQVLKVGMDNMRMRLSELE  439



>ref|XP_009780159.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nicotiana 
sylvestris]
Length=621

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 128/219 (58%), Gaps = 12/219 (5%)
 Frame = -1

Query  756  YLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM  577
            YL +IA+   LS+S+F  IA ++ + +R  +D +Y+AID YLKAHP L +IER++VCSVM
Sbjct  404  YLAKIASDNNLSVSQFISIAEVIPEKSRITEDRMYKAIDTYLKAHPALSDIERKRVCSVM  463

Query  576  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD--  403
            +  KL+ EA  HA+QN+RLPVQ V+  LY++Q ++R   +      +  +T N    D  
Sbjct  464  NCQKLTREACAHAAQNERLPVQTVVQVLYFEQQRLRQVMDGSLDGADESSTDNNPVTDEV  523

Query  402  VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas-------aVRKPTFFSSMS  244
             +L +EN+ L+ EL++MK  + +++  G    +S      +        +R+ +F SS+S
Sbjct  524  SSLKRENQDLKFELVKMKTRLNEIEKCGDISATSTPVEITTPISSDKPRLRRKSFISSVS  583

Query  243  KKLGKLNPFKHGSKDTSNLDDGEVDITKP--RRRRFSIS  133
            + LGKL P   G+ D   +        KP  R RR+SIS
Sbjct  584  ETLGKLYPISFGA-DHVIMPSASKGRYKPISRDRRYSIS  621



>gb|ABR25380.1| transposon protein [Oryza sativa Indica Group]
Length=279

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 96/157 (61%), Gaps = 11/157 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  V L + KF  +A  +   AR +DD LYRAIDIYLKAHP L E E+E++C
Sbjct  45   IDGYLAEVAPDVNLKLPKFRSLAAAIPDYARPIDDGLYRAIDIYLKAHPHLSESEKEELC  104

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQ  409
             VMD  KLS EA  HA+QN+RLP+++++  L+++QL++RS  AE    + N      QL 
Sbjct  105  RVMDCQKLSLEACTHAAQNERLPLRVIVQVLFFEQLQLRSSIAECLMVSENLEGGSRQLI  164

Query  408  ADVT----------LVKENEALRTELLQMKMFIADMQ  328
              ++            +EN+ALR  +  MK  +AD++
Sbjct  165  PTISGEQYRPGWPLASRENQALREGMDNMKQRVADLE  201



>gb|KJB43880.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=611

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 123/203 (61%), Gaps = 20/203 (10%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EIA+   L +SKF G+  L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVC
Sbjct  387  MESYLAEIASDRNLPVSKFIGLTELIPEQSRITEDGMYRAIDIYLKAHPTITDLERKKVC  446

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQ-  409
            S+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S+  + +  +++  
Sbjct  447  SLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSPSISSRVNL  506

Query  408  ---ADV--------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssas---aVR  271
                D+        +L +ENE L+ EL++MKM + +++   S+  S+          +  
Sbjct  507  YPPTDIHPVSDELSSLKRENEDLKLELVKMKMRLKEIERPSSAVPSAASSPMGIIVPSSD  566

Query  270  KP-----TFFSSMSKKLGKLNPF  217
            KP     +F +S+SKKLG+L PF
Sbjct  567  KPPLPRKSFMNSVSKKLGRLYPF  589



>gb|EYU44474.1| hypothetical protein MIMGU_mgv1a027075mg [Erythranthe guttata]
Length=577

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 126/232 (54%), Gaps = 30/232 (13%)
 Frame = -1

Query  756  YLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM  577
            ++ EIA+   LS+SKF  IA L  +  R  +D +YRAIDIYLKAHP L ++ER+KVCSVM
Sbjct  352  FIAEIASDRNLSVSKFISIAELTPEQYRMTEDGMYRAIDIYLKAHPALSDMERKKVCSVM  411

Query  576  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS---TPNAIATRNQLQA  406
            D  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +   S   T    A       
Sbjct  412  DCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGSSSLNDTSAIPAKPGPYSG  471

Query  405  DVTLV--------KENEALRTELLQMKMFIADMQNkgssqgssvkgssasa---------  277
            DV +V        KEN+ L+ EL++MKM + +++    +   S   ++  +         
Sbjct  472  DVHIVTDEVSSLRKENQDLKLELVKMKMRLNEIEKPSPTAFGSPSPATTVSRPGSADKPP  531

Query  276  ---VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
               + K +F SS+SKKLG+   F      ++    G    TKP + RR SIS
Sbjct  532  LPPLPKKSFISSVSKKLGR---FIRADGLSAQGSRGR---TKPAKDRRHSIS  577



>ref|XP_010687037.1| PREDICTED: BTB/POZ domain-containing protein At1g30440 [Beta 
vulgaris subsp. vulgaris]
Length=633

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  + L + KF  +A  V + AR +DD LYRAIDIYLK+HP L E ERE++C
Sbjct  406  IDGYLAEVAPDINLKLPKFQALAAAVPEFARPLDDGLYRAIDIYLKSHPWLSESEREQLC  465

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPN  436
             +MD  KLS EA  HA+QN+RLP++I++  L+++QL++R+            E  +   +
Sbjct  466  RLMDCQKLSLEACTHAAQNERLPLRIIVQVLFFEQLQLRNSIAGCFLVSENLEGSRQLRS  525

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  328
             +   N+    VT V+EN+ L+  +  M+M +++++
Sbjct  526  GMVGSNEGGGWVTAVRENQVLKVGMDNMRMRVSELE  561



>gb|ABF97836.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
Length=615

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C
Sbjct  386  IDGYLAEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLC  445

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPN  436
             +MD  KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   +
Sbjct  446  RLMDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRS  505

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  328
            +I T  +     T V+EN+ L+  +  M+M +++++
Sbjct  506  SITTSGEAGGWATAVRENQVLKVGMDNMRMRLSELE  541



>gb|ABF97835.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|EEC75816.1| hypothetical protein OsI_12774 [Oryza sativa Indica Group]
Length=624

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C
Sbjct  395  IDGYLAEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLC  454

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPN  436
             +MD  KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   +
Sbjct  455  RLMDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRS  514

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  328
            +I T  +     T V+EN+ L+  +  M+M +++++
Sbjct  515  SITTSGEAGGWATAVRENQVLKVGMDNMRMRLSELE  550



>ref|XP_003561994.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Brachypodium 
distachyon]
Length=624

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A+ V L   KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C
Sbjct  395  IDGYLAEVASDVNLKPPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLC  454

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPN  436
             +MD  KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   +
Sbjct  455  RLMDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLERSRPLRS  514

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  328
             IAT  +     T V+EN+ L+  +  M++ +A+++
Sbjct  515  GIATSGEAGGWTTAVRENQVLKVGMDNMRIRLAELE  550



>gb|AAT85278.1| NPH3 family protein [Oryza sativa Japonica Group]
Length=650

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C
Sbjct  421  IDGYLAEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLC  480

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPN  436
             +MD  KLS EA  HA+QN+RLP+++V+  L+++QL++R+            E  +   +
Sbjct  481  RLMDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRS  540

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  328
            +I T  +     T V+EN+ L+  +  M+M +++++
Sbjct  541  SITTSGEAGGWATAVRENQVLKVGMDNMRMRLSELE  576



>ref|XP_003558544.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brachypodium 
distachyon]
Length=625

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/242 (36%), Positives = 120/242 (50%), Gaps = 36/242 (15%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +++YL EI++   L + KF  +A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC
Sbjct  389  MESYLAEISSDANLPVDKFVALATLIPERARFNEDGMYRAIDIYLKAHPGLGEGERKKVC  448

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS---------------GAEDP  451
             VMD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R+               G E P
Sbjct  449  GVMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRASQTPSHSQAPSYAGGGGESP  508

Query  450  K-STPNAIATRNQLQADVT-------LVKENEALRTELLQMKMFIADMQNkgssqgssvk  295
              S   +   R++     +       L +EN+ LR EL+QMKM + D             
Sbjct  509  ALSYKPSFNGRDRSAPSPSSSSEMSRLQRENDELRLELMQMKMRLRDPSAAPPVAAGRGG  568

Query  294  gssasaVRKP--------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
              ++     P               KKLG+LNPF   S     +   +V    P+ RR S
Sbjct  569  APASGKPPLPKKQGGAGGGGGGGFMKKLGRLNPFVRDS-----VGGAKVRAKPPKDRRHS  623

Query  138  IS  133
            IS
Sbjct  624  IS  625



>ref|XP_004294000.1| PREDICTED: BTB/POZ domain-containing protein At1g30440 [Fragaria 
vesca subsp. vesca]
Length=638

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 99/159 (62%), Gaps = 13/159 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  V L + KF  +A  V + AR +DD LYRAIDIYLK+HP L E +RE++C
Sbjct  407  IDGYLAEVAPDVNLKLPKFQALAAAVPEYARHLDDGLYRAIDIYLKSHPWLAEADREQLC  466

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------------GAEDPKS  445
             +MD  KLS EA  HA+QN+RLP++IV+  L+++QL++RS             G+   ++
Sbjct  467  RLMDCQKLSLEACTHAAQNERLPLRIVVQVLFFEQLQLRSSIAGCFLVSDNLDGSRQIRN  526

Query  444  TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  328
              +  +  N+     T V+EN+ L+  +  M+M +++++
Sbjct  527  GFSGFSGSNEGGGWATTVRENQVLKVGMDSMRMRVSELE  565



>ref|XP_006280202.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
 gb|EOA13100.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
Length=605

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 130/234 (56%), Gaps = 29/234 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  378  MENYMAEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  437

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQ  409
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +D  S            
Sbjct  438  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTKDADSPAPPPPAVAAAV  497

Query  408  ADVTLV----------KENEALRTELLQMKMFIADMQNkgssqgssvkgss-------as  280
                L           +EN+ L+ ELL+MKM + + + +   + SS   S+        +
Sbjct  498  LPPKLSSYNDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKSSSSTISTNPNSPISTA  557

Query  279  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            ++ KP     +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  558  SMDKPPLPRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  605



>ref|XP_002866705.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42964.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
Length=604

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 128/233 (55%), Gaps = 28/233 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ Y+ EIA+   +S+ KF  +A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVC
Sbjct  378  LENYMAEIASDRNVSLQKFISLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVC  437

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +P           
Sbjct  438  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPPPAAVL  497

Query  405  DVTLV----------KENEALRTELLQMKMFIADMQNkgssqgssvkgss-------asa  277
               L           +EN+ L+ ELL+MKM + + + +   + SS   S+        ++
Sbjct  498  PPKLSSYTDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKSSSSTISTNPSSPISTAS  557

Query  276  VRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            + KP     +F +S+SKKLGKLNPF           +G      P+ RR SIS
Sbjct  558  MGKPPLPRKSFINSVSKKLGKLNPFGITPY------NGRGRTKPPKDRRHSIS  604



>ref|XP_006845260.1| hypothetical protein AMTR_s00005p00262560 [Amborella trichopoda]
 gb|ERN06935.1| hypothetical protein AMTR_s00005p00262560 [Amborella trichopoda]
Length=615

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 116/200 (58%), Gaps = 25/200 (13%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIA    L ++KF  IA ++   AR +DD LYRAIDIYLKAH  L ++ER K+C
Sbjct  392  VDSYLAEIAPDANLRLTKFMAIAEILPGDARMLDDGLYRAIDIYLKAHQGLSDLERRKLC  451

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPK--------  448
             ++D  KLS EA  HA+QN+RLPVQ V+  LY++QL++R+        +DPK        
Sbjct  452  KLIDFQKLSQEAGAHAAQNERLPVQAVVQVLYFEQLRLRNALCGSFPDDDPKLAFQSRRI  511

Query  447  ---STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa  277
               +   A++ R+      +L +EN  L+ EL +M+M + D++         ++ SS+  
Sbjct  512  SSGALSAAMSPRDNY---ASLRRENRELKLELARMRMRLNDLEKDHVCMKQDLEKSSSHK  568

Query  276  VRKPTFFSSMSKKLGKLNPF  217
                 F  + S+K+G++N F
Sbjct  569  -----FMGTFSRKIGRMNLF  583



>ref|XP_011096666.1| PREDICTED: BTB/POZ domain-containing protein At1g30440 [Sesamum 
indicum]
Length=633

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 125/220 (57%), Gaps = 18/220 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  V L + KF  +A  V + AR +DD LYRAIDIYLK+HP L E +RE++C
Sbjct  406  IDGYLAEVAPDVNLKLPKFQSLAAAVPEYARPLDDGLYRAIDIYLKSHPWLAESDREQLC  465

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
             +MD  KLS EA  HA+QN+RLP+++++  L+++QL++R+         + +    QL++
Sbjct  466  RLMDCQKLSLEACTHAAQNERLPLRVIVQVLFFEQLQLRTSIAGCFLVSDNLDGSRQLRS  525

Query  405  DV---------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFS  253
             +         T V+EN+ L+  +  M+M +++++          +      V+ P+ + 
Sbjct  526  GLMGPNDGGWATAVRENQVLKVGMDNMRMRVSELEK--ECSNMRQEIEKLGKVKGPSTWG  583

Query  252  SMSKKLG-----KLNPFKHGSKDTSNLDDGEVDITKPRRR  148
            ++SKKLG     ++   + GS   S  ++G V I K + +
Sbjct  584  NVSKKLGFRLKSQMCSAQEGS--VSKQNNGNVKIEKAKEK  621



>ref|XP_001763717.1| predicted protein [Physcomitrella patens]
 gb|EDQ71359.1| predicted protein [Physcomitrella patens]
Length=599

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 133/238 (56%), Gaps = 32/238 (13%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD+YL EIA    L +SKF  +A ++   AR VDD LYRAIDIYLKAHP L E++R+K+C
Sbjct  367  VDSYLAEIAPDANLKLSKFLALAEILPDYARVVDDGLYRAIDIYLKAHPALSEVDRKKLC  426

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------------SGAEDPK-  448
             +MD  KLS EA  HA+QN+RLPVQ+V+  LY++QL++R             +G  + + 
Sbjct  427  KLMDCQKLSQEACTHAAQNERLPVQVVVQVLYFEQLRMRNALAAGAFADATDTGGGNYQH  486

Query  447  --STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV  274
                 N  A  +   +   + +EN  L+ EL +M+M + D++N  +     ++     + 
Sbjct  487  RLGNENLSAAHSPKDSYSLIRRENRELKLELARMRMRLTDLENDHALMKQDMQEKPVKSS  546

Query  273  RKPTFFSSMSKKLGKLNPF-KHGSKD--TSNLDDGEVDITKP--------RRRRFSIS  133
            +     S++ +KL +LNPF +  SKD  +SN     V +T+         R RR SIS
Sbjct  547  K-----STVGRKLSRLNPFARRDSKDLSSSNGSANPVQVTESNSRSGFGRRPRRHSIS  599



>ref|XP_009103425.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brassica 
rapa]
Length=601

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 82/236 (35%), Positives = 124/236 (53%), Gaps = 35/236 (15%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            ++ YL EIA+   +S+ KF G+A L+ + +R  +D +YRA+DIYLKAHP ++++E++KVC
Sbjct  376  MENYLAEIASDRNVSLQKFIGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMNDVEKKKVC  435

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
            S+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +               A
Sbjct  436  SLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSEALPPQPPPPAAAA  495

Query  405  DVT-------------LVKENEALRTELLQMKM-------FIADMQNkgssqgssvkgss  286
             V              L +EN+ L+ E+L+MKM             +  +   +     S
Sbjct  496  TVLPPKLSSYNDELSKLKRENQDLKLEILKMKMKLKEFEKENEKKSSSTAMSSNHSSPIS  555

Query  285  asaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
             +++ KP     +F +S+S+KLGKLNPF      T            P+ RR SIS
Sbjct  556  TASMDKPPLPRKSFMNSVSRKLGKLNPFGITPGRTK----------PPKDRRHSIS  601



>ref|XP_010234279.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like isoform 
X2 [Brachypodium distachyon]
Length=546

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 121/217 (56%), Gaps = 17/217 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  V L + KF  +A  +   AR +DD LYRA+DIYLKAHP L E E+E++C
Sbjct  312  IDGYLAEVAPDVNLKLQKFRSLAAAIPDYARPIDDGLYRAVDIYLKAHPHLPESEKEELC  371

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQ  409
             VMD  KLS EA  HA+QN+RLP+++++  L+++QL++RS  AE    + N      QL 
Sbjct  372  RVMDCQKLSLEACTHAAQNERLPLRVIVQVLFFEQLQLRSSIAECLMISENLEGGSRQLG  431

Query  408  ADVT-----------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT  262
              ++             +EN+ALR  +  MK  +A+++ + S+    ++    S     +
Sbjct  432  LPISAEQHRGVGWPLATRENQALREGMDGMKQRVAELEKECSTMREEIERLGRSRNASKS  491

Query  261  FFSSMSKKLGKLNPFKHGSKD---TSNLDDGEVDITK  160
            + SS+   LG   P    +KD   T+  DD ++ + K
Sbjct  492  WLSSLG--LGGTKPQICSTKDAAPTTASDDNKLAVVK  526



>ref|XP_008383422.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Malus 
domestica]
Length=633

 Score =   124 bits (312),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 97/155 (63%), Gaps = 9/155 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  V L + KF  +A  V + AR +DD LYRA+DIYLK+HP L E ERE++C
Sbjct  406  IDGYLAEVAPDVNLKLPKFQALAAAVPEYARPLDDGLYRAMDIYLKSHPWLVESEREQLC  465

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
             +MD  KLS EA  HA+QN+RLP++IV+  L+++QL++RS   D       +    QL++
Sbjct  466  RLMDCQKLSLEACTHAAQNERLPLRIVVQVLFFEQLQLRSSIADCFLVSENLDGSRQLRS  525

Query  405  D---------VTLVKENEALRTELLQMKMFIADMQ  328
                       T V+EN+ L+  +  M+M +++++
Sbjct  526  GFAMSNEGGWATTVRENQVLKVGMDNMRMRVSELE  560



>ref|XP_004982336.1| PREDICTED: uncharacterized protein LOC101754459 [Setaria italica]
Length=1185

 Score =   126 bits (316),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 63/156 (40%), Positives = 97/156 (62%), Gaps = 10/156 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL EIA  + L + KF  +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C
Sbjct  394  IDGYLAEIAPDINLKLPKFQALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLC  453

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------EDPKSTPN  436
             ++D  KLS EA  HA+QN+RLP+++V+  L+++QL +R+            E  +   +
Sbjct  454  RLLDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLHLRTSIAGCLLVSDNLEGSRPLRS  513

Query  435  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  328
             IAT  +     T V+EN+ L+  +  M+M +A+++
Sbjct  514  GIATSGEAGGWATAVRENQVLKVGMDNMRMRLAELE  549



>ref|XP_009344395.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Pyrus 
x bretschneideri]
Length=633

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 97/155 (63%), Gaps = 9/155 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  V L + KF  +A  V + AR +DD LYRAIDIYLK+HP L E +RE++C
Sbjct  406  IDGYLAEVAPDVNLKLPKFQALAAAVPEYARPLDDGLYRAIDIYLKSHPWLVESDREQLC  465

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
             +MD  KLS EA  HA+QN+RLP++IV+  L+++QL++RS   D       +    QL++
Sbjct  466  RLMDCQKLSLEACTHAAQNERLPLRIVVQVLFFEQLQLRSSIADCFLVTENLDGSRQLRS  525

Query  405  D---------VTLVKENEALRTELLQMKMFIADMQ  328
                       T V+EN+ L+  +  M+M +++++
Sbjct  526  GFAMSNEGGWATTVRENQVLKVGMDNMRMRVSELE  560



>ref|XP_009410501.1| PREDICTED: BTB/POZ domain-containing protein At3g08570 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=545

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 125/219 (57%), Gaps = 13/219 (6%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL EIA    LS+SKF  I  L+   AR +DD LYRA+DIYLKAHP L E E +K+C
Sbjct  323  IDGYLAEIAPDPHLSLSKFMAIIELLPDYARIIDDGLYRAVDIYLKAHPSLTESECKKLC  382

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQ  415
             ++D  K+S EA  HA+QN RLPVQ+V+  LY++QL+++   SG     S    I + + 
Sbjct  383  KLIDCQKISQEAANHAAQNDRLPVQMVVGVLYFEQLRLKSALSGNSGDGSFSQRIISSSG  442

Query  414  LQAD--------VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF  259
            +Q+          +L +EN  L+ E+ +M++ +++++ + +     ++ + +    K  F
Sbjct  443  VQSAAVSPRDNYASLRRENRELKLEIARMRVRLSELEKEQAFMKQGMRDNRSQEHSK-AF  501

Query  258  FSSMSKKLGKLNPFKHGS-KDTSNLDDGEVDITKPRRRR  145
             SS+S+ +G++  F     K   +    +V   K RRR+
Sbjct  502  LSSISRGIGRIAMFSPSQRKHQKSTKKAQVSDAKSRRRQ  540



>ref|XP_003573346.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like isoform 
X1 [Brachypodium distachyon]
Length=641

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 121/217 (56%), Gaps = 17/217 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  V L + KF  +A  +   AR +DD LYRA+DIYLKAHP L E E+E++C
Sbjct  407  IDGYLAEVAPDVNLKLQKFRSLAAAIPDYARPIDDGLYRAVDIYLKAHPHLPESEKEELC  466

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQ  409
             VMD  KLS EA  HA+QN+RLP+++++  L+++QL++RS  AE    + N      QL 
Sbjct  467  RVMDCQKLSLEACTHAAQNERLPLRVIVQVLFFEQLQLRSSIAECLMISENLEGGSRQLG  526

Query  408  ADVT-----------LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT  262
              ++             +EN+ALR  +  MK  +A+++ + S+    ++    S     +
Sbjct  527  LPISAEQHRGVGWPLATRENQALREGMDGMKQRVAELEKECSTMREEIERLGRSRNASKS  586

Query  261  FFSSMSKKLGKLNPFKHGSKD---TSNLDDGEVDITK  160
            + SS+   LG   P    +KD   T+  DD ++ + K
Sbjct  587  WLSSLG--LGGTKPQICSTKDAAPTTASDDNKLAVVK  621



>ref|NP_001060924.1| Os08g0130600 [Oryza sativa Japonica Group]
 dbj|BAD09643.1| putative non-phototropic hypocotyl 3 (NPH3)/phototropic response 
protein [Oryza sativa Japonica Group]
 dbj|BAD33364.1| putative non-phototropic hypocotyl 3 (NPH3)/phototropic response 
protein [Oryza sativa Japonica Group]
 dbj|BAF22838.1| Os08g0130600 [Oryza sativa Japonica Group]
Length=641

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 96/157 (61%), Gaps = 11/157 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  V L + KF  +A  +   AR +DD LYRAIDIYLKAHP L E E+E++C
Sbjct  407  IDGYLAEVAPDVNLKLPKFRSLAAAIPDYARPIDDGLYRAIDIYLKAHPHLSESEKEELC  466

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQ  409
             VMD  KLS EA  HA+QN+RLP+++++  L+++QL++RS  AE    + N      QL 
Sbjct  467  RVMDCQKLSLEACTHAAQNERLPLRVIVQVLFFEQLQLRSSIAECLMVSENLEGGSRQLI  526

Query  408  ADVT----------LVKENEALRTELLQMKMFIADMQ  328
              ++            +EN+ALR  +  MK  +AD++
Sbjct  527  PTISGEQYRPGWPLASRENQALREGMDNMKQRVADLE  563



>gb|KDP34960.1| hypothetical protein JCGZ_09248 [Jatropha curcas]
Length=632

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/220 (34%), Positives = 121/220 (55%), Gaps = 18/220 (8%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  V L + KF  +A  V   AR +DD LYRAIDIYLK+HP L E +RE++C
Sbjct  405  IDGYLAEVAPDVNLKLPKFQALAAAVPDYARPLDDGLYRAIDIYLKSHPWLAESDREQLC  464

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA  406
             +MD  KLS EA  HA+QN+RLP++IV+  L+++QL++R+         + +    QL++
Sbjct  465  RLMDCQKLSLEACTHAAQNERLPLRIVVQVLFFEQLQLRTSIAGCFLVSDNLDGSRQLRS  524

Query  405  D---------VTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFS  253
                       T V+EN+ L+  +  M+M +++++          +       +  + + 
Sbjct  525  GFAGSAEGGWATAVRENQVLKVGMDNMRMRVSELEK--ECSNMRQEIEKLGRPKGSSAWG  582

Query  252  SMSKKLG-----KLNPFKHGSKDTSNLDDGEVDITKPRRR  148
            ++SKK G     ++   + GS   SN ++G V   KP+ R
Sbjct  583  NVSKKFGFKIKSQMCSAQEGS--VSNQNNGSVKNEKPKVR  620



>ref|XP_003520918.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
 gb|KHN29840.1| BTB/POZ domain-containing protein [Glycine soja]
Length=612

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 117/202 (58%), Gaps = 25/202 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL EIA    L +SKF  IA  +   AR + D LYRAIDIYLKAH  L +++++K+C
Sbjct  390  MDNYLAEIAPDANLKLSKFMVIAETLPAHARTIHDGLYRAIDIYLKAHQGLTDLDKKKLC  449

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK--------  448
             ++D  KLS EA  HA+QN+RLPVQ ++  LY++QL++R+      G +DPK        
Sbjct  450  KLIDFQKLSQEAGAHAAQNERLPVQSIVQVLYFEQLRLRNSLSCSYGEDDPKPIHQSWRI  509

Query  447  ---STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa  277
               +   A++ R+      +L +EN  L+ EL +++M + D++          +  + S 
Sbjct  510  SSGALSAAMSPRDNY---ASLRRENRELKLELARLRMRLNDLER---EHVCMKRDMAKSG  563

Query  276  VRKPTFFSSMSKKLGKLNPFKH  211
             RK  F SS SKK+GKL+ F H
Sbjct  564  SRK--FMSSFSKKIGKLSLFGH  583



>ref|XP_007133999.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
 gb|ESW05993.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
Length=610

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 117/202 (58%), Gaps = 25/202 (12%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            VD YL EIA    L +SKF  IA  +   AR V D LYRAIDIYLKAH  L +++++K+C
Sbjct  388  VDNYLAEIAPDANLKLSKFLVIAETLPAHARTVHDALYRAIDIYLKAHQGLSDLDKKKLC  447

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK--------  448
             ++D  KLS EA  HA+QN+RLP+Q ++  LY++QL++R+      G +DPK        
Sbjct  448  RLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQLRLRNSLSCSFGEDDPKPIHQSWRI  507

Query  447  ---STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasa  277
               +   A++ R+      +L +EN  L+ EL +++M + D++          +  + S 
Sbjct  508  SSGALSAAMSPRDNY---ASLRRENRELKLELARLRMRLNDLER---EHACMKRDMAKSG  561

Query  276  VRKPTFFSSMSKKLGKLNPFKH  211
             RK  F SS SKK+GKL+ F H
Sbjct  562  SRK--FMSSFSKKIGKLSLFGH  581



>gb|EEC82855.1| hypothetical protein OsI_27703 [Oryza sativa Indica Group]
Length=641

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 96/157 (61%), Gaps = 11/157 (7%)
 Frame = -1

Query  765  VDAYLGEIATHVELSISKFNGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVC  586
            +D YL E+A  V L + KF  +A  +   AR +DD LYRAIDIYLKAHP L E E+E++C
Sbjct  407  IDGYLAEVAPDVNLKLPKFRSLAAAIPDYARPIDDGLYRAIDIYLKAHPHLSESEKEELC  466

Query  585  SVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQ  409
             VMD  KLS EA  HA+QN+RLP+++++  L+++QL++RS  AE    + N      QL 
Sbjct  467  RVMDCQKLSLEACTHAAQNERLPLRVIVQVLFFEQLQLRSSIAECLMVSENLEGGSRQLI  526

Query  408  ADVT----------LVKENEALRTELLQMKMFIADMQ  328
              ++            +EN+ALR  +  MK  +AD++
Sbjct  527  PTISGEQYRPGWPLASRENQALREGMDNMKQRVADLE  563



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890