BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF019K03

Length=688
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN35778.1|  Plasma membrane ATPase 4                                314   1e-102   Glycine soja [wild soybean]
emb|CAG28306.1|  proton-exporting ATPase                                311   2e-102   Cucumis sativus [cucumbers]
gb|KJB22049.1|  hypothetical protein B456_004G027300                    323   3e-102   Gossypium raimondii
gb|KHG28536.1|  Plasma membrane ATPase 4                                321   6e-102   Gossypium arboreum [tree cotton]
gb|KHG26452.1|  Plasma membrane ATPase 4                                320   1e-101   Gossypium arboreum [tree cotton]
gb|KJB22047.1|  hypothetical protein B456_004G027300                    322   3e-100   Gossypium raimondii
gb|KJB53771.1|  hypothetical protein B456_009G004200                    320   4e-100   Gossypium raimondii
gb|KJB22048.1|  hypothetical protein B456_004G027300                    323   5e-100   Gossypium raimondii
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 318   8e-99    
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   319   1e-98    Citrus sinensis [apfelsine]
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 318   2e-98    
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    318   2e-98    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                318   2e-98    Nicotiana tomentosiformis
gb|AFK46374.1|  unknown                                                 300   3e-98    Lotus japonicus
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             317   3e-98    
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                318   4e-98    Nicotiana sylvestris
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             317   6e-98    Citrus clementina [clementine]
gb|KGN62871.1|  hypothetical protein Csa_2G378530                       295   7e-98    Cucumis sativus [cucumbers]
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    317   1e-97    Populus euphratica
dbj|BAA37150.1|  p-type H+-ATPase                                       316   1e-97    Vicia faba [broad bean]
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                315   3e-97    Cucumis melo [Oriental melon]
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                315   3e-97    Vitis vinifera
dbj|BAC77531.1|  plasma membrane H+-ATPase                              315   4e-97    Sesbania rostrata
emb|CDP04837.1|  unnamed protein product                                295   4e-97    Coffea canephora [robusta coffee]
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           315   5e-97    Glycine max [soybeans]
emb|CAN64375.1|  hypothetical protein VITISV_014422                     315   5e-97    Vitis vinifera
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          314   9e-97    Medicago truncatula
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           314   1e-96    
gb|ACE77057.1|  plasma membrane proton pump                             314   1e-96    Cucumis sativus [cucumbers]
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            307   1e-96    Gossypium arboreum [tree cotton]
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           313   1e-96    
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                313   2e-96    Prunus mume [ume]
gb|KHN15309.1|  Plasma membrane ATPase 4                                313   3e-96    Glycine soja [wild soybean]
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    313   3e-96    Glycine max [soybeans]
gb|KHN22686.1|  Plasma membrane ATPase 4                                313   3e-96    Glycine soja [wild soybean]
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    312   4e-96    Ricinus communis
gb|AAB84202.2|  plasma membrane proton ATPase                           312   6e-96    Kosteletzkya pentacarpos [seashore mallow]
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             312   6e-96    Phaseolus vulgaris [French bean]
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                312   6e-96    Sesamum indicum [beniseed]
gb|KHN17608.1|  Plasma membrane ATPase 4                                312   7e-96    Glycine soja [wild soybean]
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    307   7e-96    
dbj|BAD16687.1|  plasma membrane H+-ATPase                              311   7e-96    Daucus carota [carrots]
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    311   7e-96    Glycine max [soybeans]
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           311   9e-96    Malus domestica [apple tree]
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                311   1e-95    
emb|CAA59799.1|  H(+)-transporting ATPase                               311   1e-95    Phaseolus vulgaris [French bean]
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             311   1e-95    Phaseolus vulgaris [French bean]
gb|AAB17186.1|  plasma membrane H+-ATPase                               311   1e-95    Solanum lycopersicum
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             310   1e-95    
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      311   1e-95    Solanum tuberosum [potatoes]
gb|AFW04239.1|  plasma membrane H+-ATPase                               311   1e-95    Sesuvium portulacastrum [sea-purslane]
gb|KHN16462.1|  Plasma membrane ATPase 4                                310   2e-95    Glycine soja [wild soybean]
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      310   2e-95    Glycine max [soybeans]
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    310   2e-95    Glycine max [soybeans]
emb|CAB69823.1|  plasma membrane H+ ATPase                              310   3e-95    Prunus persica
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             310   3e-95    
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         310   3e-95    Jatropha curcas
emb|CAD62443.1|  proton-exporting ATPase                                293   3e-95    Zea mays [maize]
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           310   3e-95    Cicer arietinum [garbanzo]
emb|CAD29579.1|  proton-exporting ATPase                                293   3e-95    Zea mays [maize]
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           310   4e-95    
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           310   4e-95    
emb|CAG28305.1|  proton-exporting ATPase                                293   4e-95    Cucumis sativus [cucumbers]
ref|XP_010094202.1|  Plasma membrane ATPase 4                           309   6e-95    Morus notabilis
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    309   7e-95    Prunus mume [ume]
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           309   7e-95    Sesamum indicum [beniseed]
ref|XP_006404985.1|  hypothetical protein EUTSA_v10000729mg             288   8e-95    
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    308   1e-94    Glycine max [soybeans]
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           308   1e-94    Pyrus x bretschneideri [bai li]
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  308   1e-94    Elaeis guineensis
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          308   1e-94    Glycine soja [wild soybean]
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             308   1e-94    Prunus persica
dbj|BAD16684.1|  plasma membrane H+-ATPase                              308   2e-94    Daucus carota [carrots]
gb|KJB55190.1|  hypothetical protein B456_009G068100                    308   2e-94    Gossypium raimondii
gb|KJB55189.1|  hypothetical protein B456_009G068100                    308   2e-94    Gossypium raimondii
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  308   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH39758.1|  plasma membrane H+-ATPase                               307   3e-94    Medicago truncatula
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                307   4e-94    Erythranthe guttata [common monkey flower]
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                307   4e-94    Eucalyptus grandis [rose gum]
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    307   4e-94    Eucalyptus grandis [rose gum]
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           307   4e-94    Sesamum indicum [beniseed]
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                307   4e-94    Phoenix dactylifera
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                306   4e-94    
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           306   7e-94    Phoenix dactylifera
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    306   8e-94    Glycine max [soybeans]
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                306   9e-94    
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         306   9e-94    Jatropha curcas
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                306   1e-93    Nelumbo nucifera [Indian lotus]
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   304   1e-93    Citrus sinensis [apfelsine]
gb|AAY42948.1|  plasma membrane H+ ATPase                               305   1e-93    Lupinus albus
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     305   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                305   2e-93    
ref|XP_006382164.1|  H+-ATPase family protein                           305   2e-93    
gb|KHF98166.1|  Plasma membrane ATPase 4                                299   3e-93    Gossypium arboreum [tree cotton]
emb|CDP02997.1|  unnamed protein product                                305   4e-93    Coffea canephora [robusta coffee]
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           305   4e-93    Populus euphratica
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             304   4e-93    Phaseolus vulgaris [French bean]
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             304   4e-93    Citrus sinensis [apfelsine]
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             304   4e-93    Citrus clementina [clementine]
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           304   4e-93    Cicer arietinum [garbanzo]
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          304   5e-93    Amborella trichopoda
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     304   6e-93    Pyrus x bretschneideri [bai li]
gb|AFM52333.1|  plasma membrane H+-ATPase                               304   7e-93    Malus baccata var. xiaojinensis
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 303   8e-93    
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             303   8e-93    Elaeis guineensis
dbj|BAD16688.1|  plasma membrane H+-ATPase                              303   8e-93    Daucus carota [carrots]
dbj|BAO45902.1|  plasma membrane H+-ATPase                              303   9e-93    Acacia mangium
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             303   1e-92    Phaseolus vulgaris [French bean]
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           303   1e-92    Cicer arietinum [garbanzo]
gb|AAY42950.1|  plasma membrane H+ ATPase                               303   2e-92    Lupinus albus
dbj|BAD16685.1|  plasma membrane H+-ATPase                              302   2e-92    Daucus carota [carrots]
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    303   2e-92    Fragaria vesca subsp. vesca
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           302   3e-92    
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           302   3e-92    Cicer arietinum [garbanzo]
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    302   3e-92    Fragaria vesca subsp. vesca
gb|AEQ27822.1|  PM H+-ATPase R                                          302   4e-92    Eichhornia crassipes
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   301   6e-92    Vicia faba [broad bean]
gb|EPS65442.1|  hypothetical protein M569_09334                         301   7e-92    Genlisea aurea
ref|XP_003594954.1|  Plasma membrane ATPase                             301   8e-92    Medicago truncatula
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             301   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    300   1e-91    Populus euphratica
gb|KHN01287.1|  Plasma membrane ATPase 4                                299   1e-91    Glycine soja [wild soybean]
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             300   2e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                300   2e-91    Erythranthe guttata [common monkey flower]
emb|CBW30173.1|  Plasma membrane ATPase 4                               300   2e-91    Musa balbisiana [starchy banana]
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                300   2e-91    Fragaria vesca subsp. vesca
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           300   2e-91    Cucumis melo [Oriental melon]
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             300   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    300   3e-91    
gb|KJB65971.1|  hypothetical protein B456_010G123000                    299   3e-91    Gossypium raimondii
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    299   3e-91    
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    299   3e-91    
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           299   3e-91    Glycine max [soybeans]
emb|CAC29436.1|  P-type H+-ATPase                                       299   4e-91    Vicia faba [broad bean]
gb|KJB82763.1|  hypothetical protein B456_013G212200                    299   4e-91    Gossypium raimondii
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     299   4e-91    Eucalyptus grandis [rose gum]
gb|ABM68570.1|  plasma membrane H+ ATPase                               278   4e-91    Lilium longiflorum [Easter lily]
dbj|BAC77530.1|  plasma membrane H+-ATPase                              299   5e-91    Sesbania rostrata
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          299   5e-91    Fragaria vesca subsp. vesca
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             299   5e-91    Elaeis guineensis
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     299   6e-91    Eucalyptus grandis [rose gum]
gb|AAO72564.1|  plasma membrane H+-ATPase-like protein                  288   8e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           299   9e-91    
emb|CBW30211.1|  Plasma membrane ATPase                                 298   9e-91    Musa balbisiana [starchy banana]
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          298   1e-90    Medicago truncatula
gb|KEH35952.1|  plasma membrane H+-ATPase                               298   1e-90    Medicago truncatula
gb|AAY42949.1|  plasma membrane H+ ATPase                               298   1e-90    Lupinus albus
ref|XP_002324397.1|  H+-ATPase family protein                           296   3e-90    
ref|XP_007023380.1|  H(+)-ATPase 9                                      296   3e-90    
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                296   6e-90    Beta vulgaris subsp. vulgaris [field beet]
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       293   7e-90    Cucumis sativus [cucumbers]
emb|CBI35956.3|  unnamed protein product                                295   8e-90    Vitis vinifera
emb|CAN78639.1|  hypothetical protein VITISV_031738                     295   1e-89    Vitis vinifera
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             295   1e-89    Vitis vinifera
emb|CBI20766.3|  unnamed protein product                                293   1e-89    Vitis vinifera
gb|AHK23067.1|  plasma membrane ATPase 4                                295   1e-89    Fagopyrum tataricum [Kangra buckwheat]
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     293   2e-89    
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     295   2e-89    
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           295   2e-89    
gb|AAQ19041.1|  P-type H+-ATPase                                        280   2e-89    Phaseolus acutifolius
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     295   2e-89    
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       295   2e-89    
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    295   2e-89    
gb|ABW25091.1|  plasma membrane proton pump                             295   2e-89    Cucumis sativus [cucumbers]
gb|EPS63245.1|  hypothetical protein M569_11541                         294   2e-89    Genlisea aurea
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                294   3e-89    Vitis vinifera
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                294   3e-89    Eucalyptus grandis [rose gum]
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           294   3e-89    Cucumis melo [Oriental melon]
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          294   3e-89    
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  294   3e-89    
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  294   3e-89    Phoenix dactylifera
gb|ACL54575.1|  unknown                                                 294   3e-89    Zea mays [maize]
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     294   3e-89    Populus euphratica
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    294   3e-89    Tarenaya hassleriana [spider flower]
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    290   4e-89    
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       294   4e-89    
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           293   5e-89    
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    293   6e-89    Tarenaya hassleriana [spider flower]
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             293   6e-89    
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   293   6e-89    Citrus sinensis [apfelsine]
dbj|BAL41366.1|  plasma membrane H+-ATPase                              293   9e-89    Aeluropus littoralis
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             292   1e-88    Setaria italica
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                292   1e-88    Erythranthe guttata [common monkey flower]
ref|XP_010429928.1|  PREDICTED: ATPase 9, plasma membrane-type-like     275   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          292   2e-88    Sorghum bicolor [broomcorn]
gb|AAF27113.1|AC018849_1  aha9, 5' partial; 1-2403                      285   2e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         291   2e-88    Jatropha curcas
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             291   3e-88    
gb|KHN38020.1|  Plasma membrane ATPase                                  290   3e-88    Glycine soja [wild soybean]
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          291   4e-88    Pyrus x bretschneideri [bai li]
gb|AEO22063.1|  plasma membrane H+-ATPase                               291   4e-88    Aeluropus littoralis
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             290   6e-88    Prunus persica
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    290   7e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             290   7e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_180028.1|  H(+)-ATPase 5                                         290   7e-88    Arabidopsis thaliana [mouse-ear cress]
emb|CDY03545.1|  BnaC03g68040D                                          284   8e-88    
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          290   9e-88    
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  290   9e-88    Nelumbo nucifera [Indian lotus]
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           290   1e-87    Glycine max [soybeans]
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          290   1e-87    Prunus mume [ume]
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             290   1e-87    Phaseolus vulgaris [French bean]
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     290   1e-87    Camelina sativa [gold-of-pleasure]
dbj|BAG94605.1|  unnamed protein product                                289   1e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          289   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          289   2e-87    
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     289   2e-87    Tarenaya hassleriana [spider flower]
gb|KJB70727.1|  hypothetical protein B456_011G089100                    289   2e-87    Gossypium raimondii
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          289   2e-87    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054118.1|  Os04g0656100                                       289   2e-87    
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          289   2e-87    Cucumis melo [Oriental melon]
emb|CAD29313.1|  plasma membrane H+-ATPase                              289   3e-87    Oryza sativa Japonica Group [Japonica rice]
gb|AAB41898.1|  H+-transporting ATPase                                  288   4e-87    Mesembryanthemum crystallinum
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       287   4e-87    Cucumis sativus [cucumbers]
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    286   4e-87    Arabis alpina [alpine rockcress]
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             288   6e-87    Oryza brachyantha
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     288   6e-87    
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          288   6e-87    Tarenaya hassleriana [spider flower]
ref|XP_007023381.1|  H(+)-ATPase 9                                      288   7e-87    
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     288   7e-87    Tarenaya hassleriana [spider flower]
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    287   9e-87    
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     287   1e-86    Cucumis sativus [cucumbers]
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          287   1e-86    Vitis vinifera
emb|CDO98206.1|  unnamed protein product                                286   2e-86    Coffea canephora [robusta coffee]
emb|CAN61424.1|  hypothetical protein VITISV_027272                     286   2e-86    Vitis vinifera
gb|AAK31799.2|  plasma membrane H+ ATPase                               286   2e-86    Lilium longiflorum [Easter lily]
dbj|BAD94367.1|  plasma membrane proton ATPase                          268   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             286   3e-86    Eutrema salsugineum [saltwater cress]
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             286   3e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_194748.1|  H(+)-ATPase 2                                         286   3e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             286   3e-86    Capsella rubella
dbj|BAJ34124.1|  unnamed protein product                                286   3e-86    Eutrema halophilum
ref|NP_001190870.1|  H(+)-ATPase 2                                      286   4e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           285   4e-86    Elaeis guineensis
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    285   4e-86    Arabis alpina [alpine rockcress]
gb|AAQ19039.1|  P-type H+-ATPase                                        271   4e-86    Vicia faba [broad bean]
gb|EPS59184.1|  hypothetical protein M569_15622                         276   5e-86    Genlisea aurea
ref|NP_001185450.1|  H(+)-ATPase 9                                      285   7e-86    
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             285   8e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             285   8e-86    Phoenix dactylifera
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           285   9e-86    
ref|NP_178181.1|  H(+)-ATPase 9                                         285   9e-86    Arabidopsis thaliana [mouse-ear cress]
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     282   1e-85    Eucalyptus grandis [rose gum]
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          284   1e-85    Amborella trichopoda
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          284   1e-85    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56561.1|  hypothetical protein B456_009G125200                    284   2e-85    Gossypium raimondii
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          284   2e-85    Brassica rapa
emb|CDX76810.1|  BnaC08g33960D                                          282   2e-85    
emb|CDY14186.1|  BnaA08g13170D                                          283   2e-85    Brassica napus [oilseed rape]
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             283   3e-85    Eutrema salsugineum [saltwater cress]
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     283   4e-85    Glycine max [soybeans]
emb|CAC50884.1|  plasma membrane H+-ATPase                              276   4e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    283   4e-85    Phoenix dactylifera
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           283   4e-85    Sesamum indicum [beniseed]
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    283   4e-85    Phoenix dactylifera
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          282   5e-85    Glycine soja [wild soybean]
dbj|BAF03589.1|  P-type H+-ATPase                                       282   6e-85    Zostera marina
gb|KEH39623.1|  plasma membrane H+-ATPase                               282   8e-85    Medicago truncatula
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    282   8e-85    Arabis alpina [alpine rockcress]
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        282   8e-85    Lilium longiflorum [Easter lily]
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             281   1e-84    
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             281   2e-84    Phaseolus vulgaris [French bean]
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  281   2e-84    Brachypodium distachyon [annual false brome]
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          280   2e-84    Glycine soja [wild soybean]
emb|CDY39956.1|  BnaC06g40340D                                          280   2e-84    Brassica napus [oilseed rape]
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           281   2e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          280   3e-84    
emb|CDY34767.1|  BnaA09g41340D                                          280   3e-84    Brassica napus [oilseed rape]
ref|XP_009117122.1|  PREDICTED: ATPase 5, plasma membrane-type          280   4e-84    Brassica rapa
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     280   4e-84    Glycine max [soybeans]
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     280   5e-84    Populus euphratica
gb|KFK29576.1|  h(+)-atpase 2                                           280   6e-84    Arabis alpina [alpine rockcress]
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     279   1e-83    Tarenaya hassleriana [spider flower]
emb|CDX87330.1|  BnaA07g35430D                                          277   1e-83    
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       279   1e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           278   1e-83    Cicer arietinum [garbanzo]
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             278   1e-83    Elaeis guineensis
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    277   2e-83    
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       278   2e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    277   2e-83    
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          278   2e-83    
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       278   3e-83    
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             278   3e-83    
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       278   3e-83    
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    278   3e-83    
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           278   3e-83    
gb|AAO22672.1|  putative plasma membrane proton ATPase                  263   3e-83    
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           278   3e-83    
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          277   4e-83    
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    277   4e-83    
ref|XP_008666713.1|  PREDICTED: plasma membrane ATPase-like             256   5e-83    
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             277   5e-83    
ref|XP_010467151.1|  PREDICTED: ATPase 6, plasma membrane-type-like     261   5e-83    
ref|XP_002307856.1|  ATPase 6 family protein                            277   5e-83    
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          277   6e-83    
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          277   6e-83    
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     277   6e-83    
ref|XP_002309321.1|  ATPase 6 family protein                            277   7e-83    
gb|EMS60594.1|  Plasma membrane ATPase                                  277   7e-83    
gb|AAN15220.1|  plasma membrane P-type proton pump ATPase               277   7e-83    
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     276   7e-83    
ref|XP_002324564.1|  ATPase 6 family protein                            276   8e-83    
gb|EMT26270.1|  Plasma membrane ATPase                                  276   9e-83    
gb|ABR18001.1|  unknown                                                 276   1e-82    
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    276   1e-82    
gb|KJB66333.1|  hypothetical protein B456_010G136300                    276   1e-82    
gb|ABA18090.1|  putative plasma membrane ATPase                         276   1e-82    
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    276   2e-82    
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       273   2e-82    
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    276   2e-82    
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    272   2e-82    
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                275   3e-82    
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    274   3e-82    
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          275   3e-82    
dbj|BAF01699.1|  plasma membrane ATPase 3                               262   3e-82    
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       275   4e-82    
gb|AAV71150.1|  plasma membrane H+-ATPase                               275   4e-82    
gb|AAD46186.1|  plasma membrane proton ATPase                           275   5e-82    
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like     273   5e-82    
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    274   8e-82    
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     273   9e-82    
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             273   1e-81    
dbj|BAJ33915.1|  unnamed protein product                                273   1e-81    
ref|XP_007012006.1|  H(+)-ATPase 8                                      273   2e-81    
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           273   2e-81    
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             273   2e-81    
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             272   4e-81    
gb|ABA18112.1|  putative plasma membrane ATPase                         272   4e-81    
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    272   5e-81    
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                272   5e-81    
gb|KGN60167.1|  hypothetical protein Csa_3G881800                       266   5e-81    
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             271   5e-81    
emb|CDY51651.1|  BnaAnng10910D                                          271   7e-81    
ref|NP_179486.1|  H(+)-ATPase 1                                         271   7e-81    
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   271   8e-81    
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     271   8e-81    
emb|CDX72218.1|  BnaC07g42400D                                          270   9e-81    
gb|KFK27283.1|  h(+)-atpase 3                                           271   1e-80    
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          270   1e-80    
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             270   1e-80    
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          270   2e-80    
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           270   2e-80    
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     270   2e-80    
emb|CDX67957.1|  BnaA07g19970D                                          269   3e-80    
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             270   3e-80    
ref|NP_189850.1|  H(+)-ATPase 8                                         269   3e-80    
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     268   4e-80    
gb|EYU24620.1|  hypothetical protein MIMGU_mgv1a001404mg                268   4e-80    
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    269   4e-80    
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     269   4e-80    
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          269   4e-80    
dbj|BAC77533.1|  plasma membrane H+-ATPase                              256   5e-80    
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           268   7e-80    
ref|NP_001183637.1|  uncharacterized protein LOC100502231               254   7e-80    
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    269   7e-80    
emb|CDX82608.1|  BnaC07g02580D                                          268   8e-80    
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          268   8e-80    
gb|EYU35892.1|  hypothetical protein MIMGU_mgv1a0008592mg               252   1e-79    
emb|CDY64741.1|  BnaCnng44750D                                          268   1e-79    
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          268   1e-79    
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     268   1e-79    
gb|AAA34096.1|  plasma membrane H+ ATPase                               257   1e-79    
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    267   2e-79    
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           267   2e-79    
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                267   2e-79    
emb|CDY51650.1|  BnaAnng10900D                                          267   2e-79    
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     267   2e-79    
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                267   2e-79    
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     267   3e-79    
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    267   3e-79    
emb|CDX72217.1|  BnaC07g42390D                                          266   3e-79    
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     266   4e-79    
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     266   5e-79    
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     266   5e-79    
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    266   6e-79    
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    266   6e-79    
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150             265   7e-79    
emb|CDX93092.1|  BnaA03g38140D                                          265   1e-78    
emb|CDY50939.1|  BnaC03g74390D                                          265   1e-78    
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          265   1e-78    
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    265   1e-78    
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    265   2e-78    
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             265   2e-78    
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     264   2e-78    
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    264   2e-78    
emb|CDY67153.1|  BnaAnng23670D                                          264   2e-78    
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          264   2e-78    
gb|AAL09726.1|  AT5g57350/MJB24_16                                      264   2e-78    
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     264   3e-78    
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             264   3e-78    
ref|NP_178762.1|  H(+)-ATPase 6                                         264   3e-78    
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          264   3e-78    
ref|XP_002304716.2|  H+-ATPase family protein                           264   3e-78    
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          264   3e-78    
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             264   3e-78    
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                264   3e-78    
gb|KGN52442.1|  hypothetical protein Csa_5G635370                       262   3e-78    
gb|ACN49187.1|  plasma membrane ATPase 1-like protein                   258   4e-78    
ref|NP_200545.1|  H(+)-ATPase 3                                         264   4e-78    
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          263   7e-78    
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             263   8e-78    
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     263   8e-78    
ref|XP_002979990.1|  hypothetical protein SELMODRAFT_419690             264   9e-78    
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    262   1e-77    
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             262   1e-77    
gb|AIV00616.1|  plasma membrane H+-ATPase                               244   2e-77    
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     262   2e-77    
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     261   2e-77    
ref|NP_001169535.1|  uncharacterized protein LOC100383411               247   2e-77    
emb|CDY30730.1|  BnaA02g33520D                                          259   2e-77    
ref|XP_010914191.1|  PREDICTED: plasma membrane ATPase-like             261   2e-77    
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    261   2e-77    
gb|KGN64262.1|  hypothetical protein Csa_1G045600                       259   2e-77    
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             261   3e-77    
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     261   4e-77    
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          261   4e-77    
ref|XP_009126895.1|  PREDICTED: ATPase 3, plasma membrane-type-like     257   5e-77    
gb|EEC69747.1|  hypothetical protein OsI_39279                          260   5e-77    
ref|NP_001067382.1|  Os12g0638700                                       261   5e-77    
gb|ACR38028.1|  unknown                                                 248   6e-77    
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    260   8e-77    
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         260   9e-77    
emb|CDP14275.1|  unnamed protein product                                254   1e-76    
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                260   1e-76    
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type         259   1e-76    
emb|CAA70944.1|  pSB5                                                   241   1e-76    
gb|KHG14131.1|  ATPase 4, plasma membrane-type -like protein            256   1e-76    
gb|KEH24965.1|  plasma membrane H+-ATPase                               259   1e-76    
emb|CDY45757.1|  BnaC02g42250D                                          259   2e-76    
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    259   2e-76    
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                259   2e-76    
gb|KEH24964.1|  plasma membrane H+-ATPase                               259   2e-76    
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    259   2e-76    
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    259   2e-76    
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           259   2e-76    
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    259   2e-76    
ref|XP_006401213.1|  hypothetical protein EUTSA_v10015530mg             258   2e-76    
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         258   3e-76    
ref|NP_001136587.1|  uncharacterized protein LOC100216710               248   3e-76    
tpg|DAA59899.1|  TPA: membrane H(+)-ATPase1                             248   4e-76    
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           258   4e-76    
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             258   4e-76    
gb|EMS45119.1|  Plasma membrane ATPase 1                                258   4e-76    
gb|EMT31912.1|  Plasma membrane ATPase 1                                258   4e-76    
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         258   4e-76    
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             258   5e-76    
tpg|DAA59901.1|  TPA: membrane H(+)-ATPase1                             248   5e-76    
ref|NP_201073.1|  H(+)-ATPase 11                                        258   6e-76    
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             258   6e-76    
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                258   6e-76    
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                258   7e-76    
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         258   7e-76    
dbj|BAO02511.1|  predicted H+ ATPase ortholog                           253   8e-76    
ref|XP_002864812.1|  AHA11-ATPASE 11                                    257   8e-76    
gb|KJB33641.1|  hypothetical protein B456_006G023600                    257   9e-76    
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    257   9e-76    
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             257   9e-76    
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    257   9e-76    
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                257   1e-75    
emb|CDY38294.1|  BnaA10g11420D                                          257   1e-75    
gb|AAA34052.1|  H+-translocating ATPase                                 257   1e-75    
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like           257   1e-75    
emb|CDY47940.1|  BnaA02g08160D                                          257   1e-75    
ref|XP_002517457.1|  H(\+)-transporting atpase plant/fungi plasma...    254   1e-75    
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    257   1e-75    
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    256   1e-75    
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           256   1e-75    
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         256   2e-75    
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          256   2e-75    
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    256   2e-75    
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     256   2e-75    
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    256   2e-75    
gb|AEQ27823.1|  PM H+-ATPase L                                          256   2e-75    
emb|CDY25913.1|  BnaC09g32850D                                          256   2e-75    
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             256   2e-75    
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         256   2e-75    
dbj|BAJ92653.1|  predicted protein                                      256   3e-75    
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    256   3e-75    
dbj|BAK04567.1|  predicted protein                                      256   3e-75    
gb|EMT26085.1|  Plasma membrane ATPase 1                                256   3e-75    
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                256   3e-75    
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    255   4e-75    
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    255   4e-75    
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      255   4e-75    
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          255   4e-75    
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    255   4e-75    
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    255   4e-75    
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    255   4e-75    
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    255   5e-75    
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           255   5e-75    
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    255   5e-75    
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         255   5e-75    
gb|KGN63646.1|  hypothetical protein Csa_1G008520                       253   5e-75    
emb|CAH58642.1|  plasma membrane H+-ATPase                              238   5e-75    
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                255   6e-75    
ref|NP_001234477.1|  plasma membrane H+-ATPase                          255   6e-75    
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                255   6e-75    
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             255   7e-75    
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           255   7e-75    
gb|AFC88896.1|  plasma membrane H+-ATPase                               254   7e-75    
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     254   9e-75    



>gb|KHN35778.1| Plasma membrane ATPase 4 [Glycine soja]
Length=365

 Score =   314 bits (804),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQL+AT+IAVYANWGFARIQG GWGWAGV+WLYSIVFY PLDIMKFAIRYILS
Sbjct  203  LVTAFVIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDIMKFAIRYILS  262

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+EK+SYREL+EI
Sbjct  263  GKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEI  322

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  323  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  365



>emb|CAG28306.1| proton-exporting ATPase [Cucumis sativus]
Length=310

 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF IAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLD+MKFAIRYILS
Sbjct  148  LVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFAIRYILS  207

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+FSEK+SYRELSEI
Sbjct  208  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSYRELSEI  267

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  268  AEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  310



>gb|KJB22049.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=695

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLDIMKFAIRYILS
Sbjct  533  LVTAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFAIRYILS  592

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  593  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSYRELSEI  652

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  653  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  695



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   321 bits (822),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLDIMKFAIRYILS
Sbjct  494  LVTAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFAIRYILS  553

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  554  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSYRELSEI  613

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  614  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  656



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVAT+IAVYANWGFARIQG GWGWAGV+WLYS+VFYIPLD+MKFAIRYILS
Sbjct  494  LVTAFIIAQLVATVIAVYANWGFARIQGIGWGWAGVIWLYSVVFYIPLDLMKFAIRYILS  553

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF++K+SYRELSEI
Sbjct  554  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNDKSSYRELSEI  613

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  614  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  656



>gb|KJB22047.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=885

 Score =   322 bits (825),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLDIMKFAIRYILS
Sbjct  723  LVTAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFAIRYILS  782

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  783  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSYRELSEI  842

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  843  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>gb|KJB53771.1| hypothetical protein B456_009G004200 [Gossypium raimondii]
Length=825

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQL AT+IAVYANWGFARIQG GWGWAGV+WLYS+VFYIPLD+MKFAIRYILS
Sbjct  663  LVTAFIIAQLAATVIAVYANWGFARIQGIGWGWAGVIWLYSVVFYIPLDLMKFAIRYILS  722

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF++K+SYRELSEI
Sbjct  723  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNDKSSYRELSEI  782

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  783  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  825



>gb|KJB22048.1| hypothetical protein B456_004G027300 [Gossypium raimondii]
Length=951

 Score =   323 bits (827),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLDIMKFAIRYILS
Sbjct  789  LVTAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFAIRYILS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  849  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score =   318 bits (815),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF IAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLD+MKFAIRYILS
Sbjct  724  LVTAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDLMKFAIRYILS  783

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEA+NLF++K+SYRELSEI
Sbjct  784  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNDKSSYRELSEI  843

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  844  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  886



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   319 bits (817),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLD+MKFAIRYILS
Sbjct  791  LVTAFVIAQLVATLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDVMKFAIRYILS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF EK+SYRELSEI
Sbjct  851  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETNNLFPEKSSYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   318 bits (816),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF IAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLD+MKFAIRYILS
Sbjct  792  LVTAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDLMKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEA+NLF++K+SYRELSEI
Sbjct  852  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   318 bits (816),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+IAQLVATLIAVYANW FAR++GCGWGWAGV+WLYSI+FY+PLDIMKFAIRYILS
Sbjct  790  LVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIIFYLPLDIMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEA+NLF+EKNSYRELSEI
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   318 bits (816),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+IAQLVATLIAVYANW FAR++GCGWGWAGV+WLYSIVFY PLDIMKFAIRYILS
Sbjct  790  LVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIVFYFPLDIMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEA+NLF+EKNSYRELSEI
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|AFK46374.1| unknown [Lotus japonicus]
Length=289

 Score =   300 bits (767),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVAT +AVYANW FARI G GWGWAGV+WLY+IV YIPLD++KFAIRY LS
Sbjct  127  LLGAFMIAQLVATFLAVYANWSFARINGMGWGWAGVIWLYTIVTYIPLDLLKFAIRYALS  186

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+EKNSYRELSEI
Sbjct  187  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNVFNEKNSYRELSEI  246

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  247  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  289



>ref|XP_006453323.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474211.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Citrus sinensis]
 gb|ESR66563.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=885

 Score =   317 bits (811),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLD+MKFAIRYILS
Sbjct  723  LVTAFVLAQLVATLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDLMKFAIRYILS  782

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF EK+SYRELSEI
Sbjct  783  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETNNLFPEKSSYRELSEI  842

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  843  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   318 bits (814),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+IAQLVATLIAVYANW FAR++GCGWGWAGV+WLYSI+FY PLDIMKFAIRYILS
Sbjct  790  LVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIIFYFPLDIMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEA+NLF+EKNSYRELSEI
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   317 bits (813),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLD+MKFAIRYILS
Sbjct  792  LVTAFVLAQLVATLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDLMKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF EK+SYRELSEI
Sbjct  852  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETNNLFPEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KGN62871.1| hypothetical protein Csa_2G378530 [Cucumis sativus]
Length=170

 Score =   295 bits (754),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+IAQLVAT+IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KF IRY  S
Sbjct  8    LVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHS  67

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF EK+SYRELSEI
Sbjct  68   GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEI  127

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  128  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  170



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   317 bits (811),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF++AQLVATLIAVYANWGFARI+G GWGWAGV+W+YSIVFY PLDIMKFAIRYILS
Sbjct  790  LVSAFMLAQLVATLIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE + +F+EK+SYRELSEI
Sbjct  850  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETAGIFNEKSSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =   316 bits (810),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AFLIAQL+ATLIAVYANWGFA++QG GWGWAGV+WLYSIVFYIPLD+MKFAIRYILS
Sbjct  790  LVIAFLIAQLIATLIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLDVMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE+S +F+EK+SYRELSEI
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPESSGIFNEKSSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   315 bits (808),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AFLIAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLDIMKFAIRYILS
Sbjct  792  LVGAFLIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDIMKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+FSEK+SYRELSEI
Sbjct  852  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   315 bits (808),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGVVW+YS+VFY+PLD +KF IRYILS
Sbjct  792  LVTAFIIAQLVATLIAVYANWGFARIKGMGWGWAGVVWIYSVVFYVPLDFIKFFIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  852  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   315 bits (807),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQL+ATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLDIMKFAIRYILS
Sbjct  792  LMSAFVIAQLIATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S +F+EK+SYRELSEI
Sbjct  852  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSGIFNEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CDP04837.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   295 bits (754),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+TAF+IAQLVATLIAVYANW FARI+GCGWGWAGV+WLYS+VFY+PLD +KF IRY+LS
Sbjct  65   LLTAFVIAQLVATLIAVYANWSFARIKGCGWGWAGVIWLYSVVFYVPLDFLKFFIRYVLS  124

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
             KAWLNL++NK AFTTKKDYGKEEREAQWA AQRTLHGLQPP+AS +  EK+SYRELSEI
Sbjct  125  RKAWLNLIDNKIAFTTKKDYGKEEREAQWAVAQRTLHGLQPPDASGILDEKSSYRELSEI  184

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQH T+
Sbjct  185  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHCTV  227



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   315 bits (807),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQL+AT+IAVYANWGFARIQG GWGWAGV+WLYSIVFY PLDIMKFAIRYILS
Sbjct  793  LVTAFVIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDIMKFAIRYILS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+EK+SYREL+EI
Sbjct  853  GKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   315 bits (806),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFARI+G GWGWAGVVW+YS+VFY+PLD +KF IRYILS
Sbjct  792  LVTAFIIAQLVATLIAVYANWGFARIKGMGWGWAGVVWIYSVVFYVPLDFIKFFIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF +KNSYRELSEI
Sbjct  852  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFXDKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   314 bits (805),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF IAQL+AT+IAVYANWGFA++QG GWGWAGV+WLYSIVFYIPLD+MKFAIRYILS
Sbjct  790  LVIAFFIAQLIATIIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLDVMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE+S +F+EK+SYRELSEI
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPESSGIFNEKSSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF++AQLVATLIAVYANWGFARI+G GWGWAGV+W+YSIVFY PLDIMKFAIRYILS
Sbjct  790  LLSAFMLAQLVATLIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLL+NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE + +F+EK+SYRELSEI
Sbjct  850  GKAWLNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETAGIFNEKSSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF IAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLD+MKFAIRYILS
Sbjct  792  LVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+FSEK+SYRELSEI
Sbjct  852  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+TAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFAIRY+LS
Sbjct  497  LLTAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLS  556

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF+EK+SYRELSEI
Sbjct  557  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSYRELSEI  616

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  617  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  659



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   313 bits (803),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF IAQLVATLIAVYANWGFA+I+G GWGWAGV+WLYSIVFYIPLD+MKFAIRYILS
Sbjct  792  LVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+FSEK+SYRELSEI
Sbjct  852  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQLVATLIAVYANWGFARIQG GWGWAGV+W+YSIVFY PLD+MKFAIRYILS
Sbjct  793  LLSAFMIAQLVATLIAVYANWGFARIQGVGWGWAGVIWIYSIVFYFPLDVMKFAIRYILS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PEA+NLF++K+SYRELSEI
Sbjct  853  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQAPEAANLFNDKSSYRELSEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+TAF+IAQL+AT+IAVYANWGFARIQG GWGWAGV+WLYSIVFY PLD+MKFAIRYILS
Sbjct  793  LMTAFIIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+EK+SYREL+EI
Sbjct  853  GKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+TAF+IAQL+AT+IAVYANWGFARIQG GWGWAGV+WLYSIVFY PLD+MKFAIRYILS
Sbjct  793  LMTAFIIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+EK+SYREL+EI
Sbjct  853  GKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+IAQL+AT+IAVYA+WGFA+++G GWGWAGV+WLYSIVFYIPLD+MKFA RY+LS
Sbjct  791  LVCAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSIVFYIPLDVMKFATRYVLS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+N+LENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE S +F+EKNSYRELSEI
Sbjct  851  GKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   312 bits (800),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFA I+G GWGWAGV+WLYSIVFYIPLD++KFAIRYILS
Sbjct  790  LVTAFIIAQLVATLIAVYANWGFAHIKGIGWGWAGVIWLYSIVFYIPLDLLKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +++F+EK+SYRELSEI
Sbjct  850  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETASIFNEKSSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   312 bits (799),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVFY+PLD +KFAIRYILS
Sbjct  792  LLSAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDFIKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWL L ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF EKNSYRELSEI
Sbjct  852  GKAWLTLFENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFHEKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   312 bits (799),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQL+ATLIAVYANW FARI+G GWGWAGV+WLYSIVFY PLDIMKFA RYILS
Sbjct  793  LLGAFVIAQLIATLIAVYANWSFARIKGVGWGWAGVIWLYSIVFYFPLDIMKFATRYILS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASN+F+EK+SYRELSEI
Sbjct  853  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNIFNEKSSYRELSEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   312 bits (799),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFARI+GCGWGWAGV+WLYSIVFY+PLD+MKFAIRYILS
Sbjct  789  LVTAFIIAQLVATLIAVYANWGFARIKGCGWGWAGVIWLYSIVFYVPLDLMKFAIRYILS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NL +NKTAFTTKKDYGK EREAQWA AQRTLHGLQ PEA+N+F+EK+SYRELSEI
Sbjct  849  GKAWQNLYDNKTAFTTKKDYGKGEREAQWALAQRTLHGLQTPEATNIFNEKSSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  909  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   312 bits (799),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+IAQL+AT+IAVYA+WGFA+++G GWGWAGV+WLYS+VFYIPLD+MKFA RYILS
Sbjct  791  LVFAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSVVFYIPLDVMKFATRYILS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+N+LENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE S +F+EKNSYRELSEI
Sbjct  851  GKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_002515334.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF46783.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=734

 Score =   307 bits (787),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+ AQL+AT+IAVYANWGFARI+GCGWGWAGV+WLYS+V Y+PLD++KFAIRYILS
Sbjct  572  LIGAFIAAQLIATVIAVYANWGFARIEGCGWGWAGVIWLYSVVTYVPLDLLKFAIRYILS  631

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N F++KNSYRELSEI
Sbjct  632  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNFFADKNSYRELSEI  691

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  692  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  734



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   311 bits (798),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AFL+AQL+AT +AVYANW FARI GCGWGWAGV+W+YSIVFYIPLDI+KF  RY LS
Sbjct  787  LVAAFLVAQLIATFVAVYANWDFARIHGCGWGWAGVIWIYSIVFYIPLDILKFGTRYALS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP  SN+F +KNSYRELSEI
Sbjct  847  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPADSNIFDDKNSYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   311 bits (798),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+IAQL+AT+IAVYA+WGFA+++G GWGWAGV+WLYS+VFYIPLD+MKFA RYILS
Sbjct  791  LVFAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSVVFYIPLDVMKFATRYILS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+N+LENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE S +F+EKNSYRELSEI
Sbjct  851  GKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   311 bits (798),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANW FARI GCGWGWAGV+W+YSIVFY PLD+MKFAIRYILS
Sbjct  793  LLGAFLIAQLIATLIAVYANWSFARIHGCGWGWAGVIWIYSIVFYFPLDLMKFAIRYILS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGL+ PE+S++F++K+SYRELSEI
Sbjct  853  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLEAPESSSIFNDKSSYRELSEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVATLIAVYA+W FAR++GCGWGWAGV+W++SIV Y PLDIMKFAIRYILS
Sbjct  790  LMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF+EKNSYRELSEI
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KFAIRYILS
Sbjct  789  LLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDILKFAIRYILS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KFAIRYILS
Sbjct  789  LLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDILKFAIRYILS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVATLIAVYA+W FAR++GCGWGWAGV+W++SIV Y PLDIMKFAIRYILS
Sbjct  790  LMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF+EKNSYRELSEI
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_006381782.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
 gb|ERP59579.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
Length=885

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+IAQLVAT+IAVYANWGFARI+G GWGWAGV+W+YSIVFY PLDIMKFAIRYILS
Sbjct  723  LVSAFMIAQLVATVIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYILS  782

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE + +F+EK+ YRELSEI
Sbjct  783  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETAGVFNEKSGYRELSEI  842

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  843  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVATLIAVYA+W FAR++GCGWGWAGV+W++SIV Y PLDIMKFAIRYILS
Sbjct  790  LMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF+EKNSYRELSEI
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  910  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L TAFLIAQLVATLIAVYANWGFA I+GCGWGWAGVVWLY+IVFY+PLDI+KFAIRYILS
Sbjct  790  LFTAFLIAQLVATLIAVYANWGFADIKGCGWGWAGVVWLYNIVFYVPLDILKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN-LFSEKNSYRELSE  331
            GKAWLNL E+KTAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE SN LF+EKNSYRELSE
Sbjct  850  GKAWLNLFESKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPEPSNHLFNEKNSYRELSE  909

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  910  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQNYTV  953



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   310 bits (795),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQLVAT +AVYANWGFARIQG GWGWAGV+WLYS+V YIPLDI+KFAIRY+LS
Sbjct  789  LLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   310 bits (795),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQLVAT +AVYANWGFARIQG GWGWAGV+WLYS+V YIPLDI+KFAIRY+LS
Sbjct  789  LLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQLVAT +AVYANWGFARIQG GWGWAGV+WLYS+V YIPLDI+KFAIRY+LS
Sbjct  789  LLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   310 bits (794),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF++AQLVATLIAVYANW FARI+GCGWGWAGV+WL+S+V Y PLD++KFAIRYILS
Sbjct  792  LLGAFMVAQLVATLIAVYANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLFSEKNSYRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   310 bits (794),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF++AQLVATLIAVYANW FARI+GCGWGWAGV+WL+S+V Y PLD++KFAIRYILS
Sbjct  781  LLGAFMVAQLVATLIAVYANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILS  840

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLFSEKNSYRELSEI
Sbjct  841  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSYRELSEI  900

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  901  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  943



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   310 bits (794),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AFLIAQLVATLIAVYA+WGFARI+G GWGWAGV+W+YSIVFYIPLD++KFAIRYILS
Sbjct  790  LMSAFLIAQLVATLIAVYADWGFARIKGIGWGWAGVIWIYSIVFYIPLDLLKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +++F+EKNSYRELSEI
Sbjct  850  GKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETASIFNEKNSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>emb|CAD62443.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   293 bits (750),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF IR++LS
Sbjct  148  LVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLS  207

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEA--SNLFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA  S LF +KNSYRELS
Sbjct  208  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELS  267

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  268  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  312



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   310 bits (794),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFAIRY+LS
Sbjct  789  LLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFAIRYVLS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASNLF+EKNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPEASNLFNEKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>emb|CAD29579.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   293 bits (749),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 157/165 (95%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF IR++LS
Sbjct  148  LVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFFIRFVLS  207

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN--LFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEAS+  LF++K+SYRELS
Sbjct  208  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYRELS  267

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  268  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  312



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   310 bits (793),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANWGFARIQG GWGWAGV+WLYSIV Y+PLD++KFAIRYI S
Sbjct  792  LLGAFMIAQLVATLIAVYANWGFARIQGAGWGWAGVIWLYSIVTYVPLDLLKFAIRYIQS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSYRELSEI
Sbjct  852  GKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   310 bits (793),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANWGFARIQG GWGWAGV+WLYSIV Y+PLD++KFAIRYI S
Sbjct  786  LLGAFMIAQLVATLIAVYANWGFARIQGAGWGWAGVIWLYSIVTYVPLDLLKFAIRYIQS  845

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSYRELSEI
Sbjct  846  GKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEI  905

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  906  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>emb|CAG28305.1| proton-exporting ATPase [Cucumis sativus]
Length=311

 Score =   293 bits (749),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANW FA+I+G GWGWAGVVW+YS++FYIPLD +KFAIRYILS
Sbjct  148  LMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFAIRYILS  207

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNSYRELSE  331
            GKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNSYRELSE
Sbjct  208  GKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSE  267

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  268  IAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  311



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   309 bits (792),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+IAQLVATLIAVYA+W FARI+G  WGWAGV+W+YSIVFY+PLDIMKFA RYILS
Sbjct  795  LVSAFIIAQLVATLIAVYADWSFARIKGIDWGWAGVIWIYSIVFYVPLDIMKFATRYILS  854

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF EK+SYRELSEI
Sbjct  855  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETTNLFPEKSSYRELSEI  914

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  915  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  957



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   309 bits (791),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANW FARI+GCGWGWAGV+WL+S+V Y PLD++KFAIRYILS
Sbjct  773  LLGAFMIAQLVATLIAVYANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILS  832

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSYRELSEI
Sbjct  833  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEI  892

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  893  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  935



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   309 bits (791),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AFLIAQLVATLIAVYANWGFA+I+GCGWGWAGV+WLYSIV YIPLDI+KF IRY+LS
Sbjct  792  LLSAFLIAQLVATLIAVYANWGFAKIKGCGWGWAGVIWLYSIVTYIPLDILKFCIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTK +YGKEEREAQWA AQRTLHGLQPPE +NLF EK+SYRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKSNYGKEEREAQWAAAQRTLHGLQPPETTNLFPEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006404985.1| hypothetical protein EUTSA_v10000729mg [Eutrema salsugineum]
 gb|ESQ46438.1| hypothetical protein EUTSA_v10000729mg [Eutrema salsugineum]
Length=197

 Score =   288 bits (736),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQLVAT IAVYANW FARI+G GW WAGV+WLYS++ YIPLD++KFAIRYILS
Sbjct  35   LLGAFFIAQLVATFIAVYANWSFARIEGVGWRWAGVIWLYSLITYIPLDLLKFAIRYILS  94

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLL+NKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +N+F+EKN Y ELSEI
Sbjct  95   GKAWLNLLDNKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPETNNIFNEKNCYSELSEI  154

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKG VESVVKLKGLDI+TIQQHYT+
Sbjct  155  AEQAKRRAEVARLRELNTLKGQVESVVKLKGLDIDTIQQHYTV  197



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   308 bits (790),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFAIRYILS
Sbjct  789  LLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   308 bits (790),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQLVATL+AVYA WGFARI G GWGWAGV+W+YSIVFY PLD MKF IRYILS
Sbjct  793  LMSAFMIAQLVATLLAVYAKWGFARIHGVGWGWAGVIWIYSIVFYFPLDFMKFTIRYILS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE+S++F++KNSYRELSEI
Sbjct  853  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPESSSIFNDKNSYRELSEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   308 bits (790),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFARIQG GWGWAGV+WLYSIVF+ PLD+ KFAIRYILS
Sbjct  792  LVTAFVIAQLVATLIAVYANWGFARIQGIGWGWAGVIWLYSIVFFFPLDLFKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLE KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +NLF++K+SYRELSEI
Sbjct  852  GKAWDNLLEKKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHM99449.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=940

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFAIRYILS
Sbjct  778  LLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILS  837

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  838  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEI  897

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  898  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  940



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   308 bits (790),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQL+ATL+AVYANWGFARI G GWGWAGV+W+YSIVFY PLD+MKFAIRYILS
Sbjct  793  LLGAFMIAQLIATLVAVYANWGFARIHGVGWGWAGVIWVYSIVFYFPLDVMKFAIRYILS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PEA+NLF++K+SYRELSEI
Sbjct  853  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQAPEAANLFNDKSSYRELSEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANWGFARIQGCGWGWAGV+WLYSIVFY PLDIMKFA RY LS
Sbjct  788  LLGAFLIAQLIATLIAVYANWGFARIQGCGWGWAGVIWLYSIVFYFPLDIMKFATRYALS  847

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
             KAW ++++N+TAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASN+F+EK+SYRELSEI
Sbjct  848  NKAWQSMIDNRTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNIFNEKSSYRELSEI  907

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  908  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>gb|KJB55190.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=954

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+TAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFAIRY+LS
Sbjct  792  LLTAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF+EK+SYRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KJB55189.1| hypothetical protein B456_009G068100 [Gossypium raimondii]
Length=956

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+TAF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFAIRY+LS
Sbjct  792  LLTAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF+EK+SYRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT  202
            AEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT
Sbjct  912  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYT  953



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVAT+IAVYANW FARI+G GWGWAGV+WLYSIVF+ PLD  KFAIRYILS
Sbjct  792  LVTAFVIAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFFFPLDCFKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLEN+TAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +NLFS+KNSYRELSEI
Sbjct  852  GKAWDNLLENRTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETANLFSDKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   307 bits (787),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+AT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD++KFAIRY LS
Sbjct  789  LLGAFLIAQLIATFIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFAIRYFLS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPEASN+F+EKNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPEASNVFNEKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRE+HTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLREVHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQL+ATLIAVYANWGFARIQGCGWGWAGV+WLYSIVFY+PLD+MKFAIRYILS
Sbjct  792  LLVAFCIAQLIATLIAVYANWGFARIQGCGWGWAGVIWLYSIVFYVPLDLMKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NL +NK AF+TK+DYGK EREAQWAHAQRTLHGLQ PEA NLF+EK+SYRELSEI
Sbjct  852  GKAWQNLYDNKIAFSTKQDYGKGEREAQWAHAQRTLHGLQNPEAGNLFNEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQLVATLIAVYANWGFA I+GCGWGWAG +W+YSIV Y+PLDI+KFAIRYILS
Sbjct  792  LLSAFIIAQLVATLIAVYANWGFAEIKGCGWGWAGAIWVYSIVSYVPLDIIKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S +FS+K+SYRELSEI
Sbjct  852  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSTIFSDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELQTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KCW81010.1| hypothetical protein EUGRSUZ_C023861, partial [Eucalyptus grandis]
Length=935

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQLVATLIAVYANWGFA I+GCGWGWAG +W+YSIV Y+PLDI+KFAIRYILS
Sbjct  773  LLSAFIIAQLVATLIAVYANWGFAEIKGCGWGWAGAIWVYSIVSYVPLDIIKFAIRYILS  832

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S +FS+K+SYRELSEI
Sbjct  833  GKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSTIFSDKSSYRELSEI  892

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  893  AEQAKRRAEVARLRELQTLKGHVESVVKLKGLDIDTIQQHYTV  935



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+TAF+IAQLVATLIAVYANWGFARI+GCGWGWAGV+W+YS+VFY+PLD+MKFA+RYILS
Sbjct  791  LMTAFVIAQLVATLIAVYANWGFARIKGCGWGWAGVIWIYSVVFYVPLDLMKFAVRYILS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NL ENK AFTTKKDYGKEEREAQWA AQRTLHGLQ PEA+ +F+EK+SYRELSEI
Sbjct  851  GKAWQNLYENKIAFTTKKDYGKEEREAQWALAQRTLHGLQTPEATTVFNEKSSYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  911  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  953



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATLIAVYANWGFARI+G GWGWA V+WLYSIVF+ PLD+ KF+IRYILS
Sbjct  792  LVTAFVIAQLVATLIAVYANWGFARIKGIGWGWAAVIWLYSIVFFFPLDLFKFSIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLE KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +NLF+EKNSYRELSEI
Sbjct  852  GKAWDNLLEKKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNEKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008360343.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=885

 Score =   306 bits (783),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQL ATL+AVYA WGFA+I G GWGWAGV+W+YSIVFY PLD MKFAIRYILS
Sbjct  723  LMSAFMIAQLXATLLAVYAKWGFAKIHGVGWGWAGVIWIYSIVFYFPLDFMKFAIRYILS  782

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE+S++F +KNSYRELSEI
Sbjct  783  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPESSSIFHDKNSYRELSEI  842

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  843  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   306 bits (785),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVATLIAVYA+WGFARI+G GWGWAGV+WLYS+VF+ PLD+ KFAIRYILS
Sbjct  792  LVTAFIVAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSVVFFFPLDLFKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLE KTAFT+KKDYG+EEREAQWA AQRTLHGLQPPE +NLF++KNSYRELSEI
Sbjct  852  GKAWDNLLEKKTAFTSKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNDKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   306 bits (784),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQLVAT IAVYANW FARI+G GWGWAGV+WLYS+V YIPLD++KFAIRYILS
Sbjct  789  LLGAFFIAQLVATFIAVYANWSFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   306 bits (784),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+W YSIV Y+PLD++KFAIRYI S
Sbjct  792  LLGAFMIAQLVATLIAVYANWGFARIEGAGWGWAGVIWXYSIVTYVPLDLLKFAIRYIQS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSYRELSEI
Sbjct  852  GKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   306 bits (784),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF++AQL+ATLIAVYANWGFARI+GCGWGWAGV+WLYS+V Y+PLD++KFAIRYILS
Sbjct  792  LVGAFIVAQLIATLIAVYANWGFARIEGCGWGWAGVIWLYSVVTYVPLDLLKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N F EK+ YRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETNNFFGEKSGYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   306 bits (783),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+IAQLVATLIAVYANWGF+RI+G GWGWAGV+WLY+IV Y+PLDI+KF IRY+LS
Sbjct  792  LVSAFIIAQLVATLIAVYANWGFSRIKGIGWGWAGVIWLYTIVSYVPLDIIKFFIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++K+SYRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   304 bits (779),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L TAF+IAQLVAT IAVYANW FARI+GCGWGWAGV+WLYS+V Y PLDI+KF IRYILS
Sbjct  723  LATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILS  782

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE + +FS+KNSYRELSEI
Sbjct  783  GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEI  842

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  843  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 157/163 (96%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQL+AT+IAVYANWGFA+IQG GWGWAGV+WLYS+VFY PLD++KFAIRY+LS
Sbjct  795  LMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLLKFAIRYVLS  854

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+N+ ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE SN+F+E N+YRELSEI
Sbjct  855  GKAWVNI-ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNYRELSEI  913

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  914  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF++AQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIV Y PLD +KFAIRYI S
Sbjct  792  LLGAFMVAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYFPLDFLKFAIRYIQS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSYRELSEI
Sbjct  852  GKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008367709.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=956

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+W YSIV Y+PLD++KFAIRYI S
Sbjct  794  LLGAFMIAQLVATLIAVYANWGFARIEGAGWGWAGVIWXYSIVTYVPLDLLKFAIRYIQS  853

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSYRELSEI
Sbjct  854  GKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEI  913

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  914  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 157/164 (96%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+ AQLVATLIAVYANWGFARI+GCGWGWAGV+WL+S+V Y+PLDI+KFAIRYILS
Sbjct  792  LLGAFVAAQLVATLIAVYANWGFARIEGCGWGWAGVIWLFSVVTYVPLDILKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEAS-NLFSEKNSYRELSE  331
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S N+FSEKNSYRELSE
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETSHNMFSEKNSYRELSE  911

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  IAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AFL+AQLVATLIAVYA+WGFARI+G GWGWAGV+WLYS+V YIPLD++KFAIRY+LS
Sbjct  501  LVSAFLVAQLVATLIAVYADWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLS  560

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +++F+E++SYRELSEI
Sbjct  561  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETTSIFNERSSYRELSEI  620

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  621  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  663



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   305 bits (780),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+TAF+IAQLVATLIAVYANW FARI+GCGWGWAGV+WLYS+VFY+PLD +KF IRY+LS
Sbjct  792  LLTAFVIAQLVATLIAVYANWSFARIKGCGWGWAGVIWLYSVVFYVPLDFLKFFIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL++NK AFTTKKDYGKEEREAQWA AQRTLHGLQPP+AS +  EK+SYRELSEI
Sbjct  852  GKAWLNLIDNKIAFTTKKDYGKEEREAQWAVAQRTLHGLQPPDASGILDEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  912  AEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   305 bits (780),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 157/164 (96%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+ AQL+ATLIAVYANWGFARI+GCGWGWAGV+WL+S+V Y+PLDI+KFAIRYILS
Sbjct  792  LLGAFVAAQLIATLIAVYANWGFARIKGCGWGWAGVIWLFSVVTYVPLDILKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEAS-NLFSEKNSYRELSE  331
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S N+FSEKNSYRELSE
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETSHNMFSEKNSYRELSE  911

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  IAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   304 bits (779),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVAT +AVYANW FARI+G GWGWAGV+WLYS+V YIPLDI+KFAIRY+LS
Sbjct  789  LLGAFMIAQLVATFLAVYANWEFARIKGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   304 bits (779),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L TAF+IAQLVAT IAVYANW FARI+GCGWGWAGV+WLYS+V Y PLDI+KF IRYILS
Sbjct  792  LATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE + +FS+KNSYRELSEI
Sbjct  852  GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   304 bits (779),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L TAF+IAQLVAT IAVYANW FARI+GCGWGWAGV+WLYS+V Y PLDI+KF IRYILS
Sbjct  792  LATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE + +FS+KNSYRELSEI
Sbjct  852  GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   304 bits (779),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQL+ATLIAVYANW FA++QG GWGWAGV+WLYSIVFY PLD+MKFAIRYILS
Sbjct  790  LLIAFFIAQLIATLIAVYANWTFAKVQGIGWGWAGVIWLYSIVFYFPLDVMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFT+KKDYGKEEREAQWA AQRTLHGLQPPEAS +F+EK+SYRELSEI
Sbjct  850  GKAWNNLLDNKTAFTSKKDYGKEEREAQWALAQRTLHGLQPPEASGIFNEKSSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   304 bits (779),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF +AQLVATL+AVYANWGFAR++G GWGWAGV+W+YSIVFY+PLD++KFA++YILS
Sbjct  788  LVSAFFVAQLVATLLAVYANWGFARVKGIGWGWAGVIWIYSIVFYVPLDLIKFAVKYILS  847

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LLE KTAFT+KKDYG+EEREAQWA AQRTLHGLQPPEASNLF+EK+SYRELSEI
Sbjct  848  GKAWDTLLEKKTAFTSKKDYGREEREAQWALAQRTLHGLQPPEASNLFNEKSSYRELSEI  907

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  908  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   304 bits (778),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF++AQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIV Y PLD +KFAIRYI S
Sbjct  792  LLGAFMVAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYFPLDFLKFAIRYIQS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF+EKNSYRELSEI
Sbjct  852  GKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI++IQQHYT 
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDSIQQHYTF  954



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   304 bits (778),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIV Y+PLD +KFAIRYI S
Sbjct  792  LLGAFMIAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYVPLDFLKFAIRYIQS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF+E+NSYRELSEI
Sbjct  852  GKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNERNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELTTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   303 bits (777),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYS+V ++PLD++KFA RY+LS
Sbjct  792  LVSAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTFVPLDLIKFATRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+FSE++SYRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNIFSERSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   303 bits (777),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF++AQLVATLIAVYA+WGFARI+G GWGWAGV+WLYSIVF+ PLD+ KFAIRYILS
Sbjct  792  LVIAFVVAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSIVFFFPLDLFKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLE KTAFT+KKDYG+EEREAQWA AQRTLHGLQPPE +NLF++KNSYRELSEI
Sbjct  852  GKAWDNLLEKKTAFTSKKDYGREEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   303 bits (777),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQL+AT+IAVYANWGFARI GCGWGWAGVVWLYSIVFY PLDIMKFA RY LS
Sbjct  788  LLGAFMIAQLLATVIAVYANWGFARIHGCGWGWAGVVWLYSIVFYFPLDIMKFATRYALS  847

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+++N+TAF+TKKDYGKEEREAQWA AQRTLHGLQPPEAS +F++K+SYRELSEI
Sbjct  848  GKAWQNMIDNRTAFSTKKDYGKEEREAQWALAQRTLHGLQPPEASTIFNDKSSYRELSEI  907

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  908  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   303 bits (777),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF+IAQL+AT +AVYA+WGFA+I+G GWGWAGVVWLYSIVFYIPLD +KF IRY+LS
Sbjct  792  LMSAFIIAQLIATFLAVYADWGFAKIKGIGWGWAGVVWLYSIVFYIPLDFLKFTIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S++F++KNSYRELSEI
Sbjct  852  GKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSSIFNDKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   303 bits (776),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQ++AT+IAVYA+W FA+++G GWGWAGV+WLYSIVFY PLD+MKFAIRYILS
Sbjct  791  LIIAFMIAQMIATIIAVYADWSFAKVKGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+NLLENKTAFTTKKDYG+EEREAQWAHAQRTLHGLQPPE +++F+EKNSYRELSEI
Sbjct  851  GKAWVNLLENKTAFTTKKDYGREEREAQWAHAQRTLHGLQPPETTSIFNEKNSYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQA +RAEVARLRELHTLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  911  AEQAMKRAEVARLRELHTLKGHVESVVKLKGLDIDNIQQHYTV  953



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   303 bits (776),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVAT +AVYANWGFARI+G GWGWAGV+W+YS+V YIPLDI+KF IRY+LS
Sbjct  789  LLGAFMIAQLVATFLAVYANWGFARIKGMGWGWAGVIWVYSLVTYIPLDILKFTIRYVLS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N+F++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNIFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+T+QQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 156/163 (96%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQL+AT+IAVYANWGFA+IQG GWGWAGV+WLYS+VFY PLD++KFAIRY+LS
Sbjct  792  LMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLLKFAIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+N+ ENKTAFTTKKD GKEEREAQWAHAQRTLHGLQPPE SN+F+E N+YRELSEI
Sbjct  852  GKAWVNI-ENKTAFTTKKDCGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   302 bits (774),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 154/164 (94%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANWGFARI+GCGWGWAGV+W+YS+VFY PLDIMKF  RY LS
Sbjct  788  LLGAFLIAQLIATLIAVYANWGFARIEGCGWGWAGVIWIYSVVFYFPLDIMKFGTRYALS  847

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNS-YRELSE  331
            GKAW N++E + AFTTKKDYGKEEREAQWAH QRTLHGLQPPEA+N+F++KNS YRELSE
Sbjct  848  GKAWNNMIEQRVAFTTKKDYGKEEREAQWAHVQRTLHGLQPPEATNIFNDKNSNYRELSE  907

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  908  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=955

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF++AQLVATLIAVYANW FARI GCGWGWAGVVWL+S+V Y PLD++KFAIRYILS
Sbjct  793  LLGAFIVAQLVATLIAVYANWEFARIHGCGWGWAGVVWLFSVVTYFPLDLLKFAIRYILS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE+SN+FS+K+SYRELSEI
Sbjct  853  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPESSNIFSDKSSYRELSEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  913  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  955



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   302 bits (773),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIV Y+PLD +KFAIRYI S
Sbjct  792  LLGAFMIAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYVPLDFLKFAIRYIQS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE  NLF+E+NSYRELSEI
Sbjct  852  GKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETXNLFNERNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELTTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   302 bits (773),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFL AQL+ATLIAVYANWGFARI G GWGWAGV+WLYSI+FY+PLD++KF IRY+LS
Sbjct  794  LMGAFLTAQLIATLIAVYANWGFARIHGIGWGWAGVIWLYSIIFYLPLDVIKFFIRYLLS  853

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE S++F+EK+SYRELSEI
Sbjct  854  GKAWQNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSSVFNEKSSYRELSEI  913

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  914  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_011459045.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=983

 Score =   302 bits (774),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF++AQLVATLIAVYANW FARI GCGWGWAGVVWL+S+V Y PLD++KFAIRYILS
Sbjct  821  LLGAFIVAQLVATLIAVYANWEFARIHGCGWGWAGVVWLFSVVTYFPLDLLKFAIRYILS  880

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE+SN+FS+K+SYRELSEI
Sbjct  881  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPESSNIFSDKSSYRELSEI  940

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  941  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  983



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   302 bits (773),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+ AQL+ATLIAVYA+WGFARI+G GWGWAGV+WLYSIV + PLDI KFAIRYILS
Sbjct  788  LVFAFIAAQLIATLIAVYADWGFARIKGIGWGWAGVIWLYSIVTFFPLDIFKFAIRYILS  847

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLE KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA NLF+EKNSYRELSEI
Sbjct  848  GKAWDNLLEKKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAVNLFNEKNSYRELSEI  907

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  908  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>gb|AAB35314.2| plasma membrane H(+)-ATPase precursor [Vicia faba]
Length=956

 Score =   301 bits (771),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANW FARIQG GWGWAGV+WLYSI+FYIPLDI+KFA RY LS
Sbjct  790  LLGAFLIAQLIATLIAVYANWAFARIQGIGWGWAGVIWLYSIIFYIPLDIIKFATRYFLS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NL ENKTAFTTKKDYGK EREAQWAHAQRTLHGL+PPE+S +F EKNSYRELSEI
Sbjct  850  GKAWSNL-ENKTAFTTKKDYGKGEREAQWAHAQRTLHGLEPPESSGIFHEKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   301 bits (771),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AFL+AQLVATLIAVYANWGFAR++GCGWGWAGV+WLYSIVFY PLD MKFAIRY+LS
Sbjct  792  LVSAFLLAQLVATLIAVYANWGFARVKGCGWGWAGVIWLYSIVFYFPLDPMKFAIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NL +N+TAFTTKKDYGKEEREAQWA AQRT+HGL+  +A NLF++K+SYRELSEI
Sbjct  852  GKAWNNLFDNRTAFTTKKDYGKEEREAQWALAQRTMHGLKTNDAGNLFTDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  912  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   301 bits (771),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQL+ATLIAVYANWGFARIQG GWGWAGV+WLYSI+FYIPLDI+KFAIRY LS
Sbjct  795  LMGAFVIAQLIATLIAVYANWGFARIQGIGWGWAGVIWLYSIIFYIPLDIIKFAIRYGLS  854

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP-EASNLFSEKNSYRELSE  331
            GKAW NLLENKTAFT KKDYGKEEREAQWAHAQRTLHGL  P E S+LF++KN+YRELSE
Sbjct  855  GKAWTNLLENKTAFTNKKDYGKEEREAQWAHAQRTLHGLSAPEETSSLFNDKNTYRELSE  914

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIET+QQHYT+
Sbjct  915  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  958



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   301 bits (770),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVATL+AVYANWGFARI+G GWGWAGV+WLYSIVF+ PLD  KFAIRY+LS
Sbjct  792  LVTAFIIAQLVATLLAVYANWGFARIKGIGWGWAGVIWLYSIVFFFPLDWFKFAIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPP+ +NLF EK+SYRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPDTANLFPEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESV KLKGLDI+ IQQHYT+
Sbjct  912  AEQAKRRAEIARLRELHTLKGHVESVFKLKGLDIDNIQQHYTV  954



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score =   300 bits (769),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+IAQLVAT+IAVY NWGFARI+G GWGWAGV+W+YSIVFY PLDIMKFAIRYILS
Sbjct  789  LVSAFMIAQLVATVIAVYVNWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYILS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREA WA AQRTLHGLQPPE + +F+EK+ YRELSEI
Sbjct  849  GKAWLNLLENKTAFTTKKDYGKEEREAHWALAQRTLHGLQPPETAGVFNEKSGYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGH ESVVKLKGLDI+TIQQH T+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHDESVVKLKGLDIDTIQQHCTV  951



>gb|KHN01287.1| Plasma membrane ATPase 4 [Glycine soja]
Length=885

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQL+ATLIAVYANWGFAR++G GWGWAGV+WLYSI+FYIPLD +KF IRY LS
Sbjct  723  LVTAFIIAQLIATLIAVYANWGFARMRGIGWGWAGVIWLYSIIFYIPLDFLKFGIRYFLS  782

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+ ENKTAFTTKKDYGKEEREAQWA AQRTLHGL PPE   +FSEKN+YRELSEI
Sbjct  783  GKAWNNITENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPETEQIFSEKNNYRELSEI  842

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            A+QA++RAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  843  ADQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   300 bits (768),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+IAQLVAT+IAVYA+WGFARI+G GW WAGV+W+YSIVF+ PLD  KFAIRYILS
Sbjct  792  LVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAGVIWIYSIVFFFPLDWFKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLFS+K+SYRELSEI
Sbjct  852  GKAWDNLLQNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPPETTNLFSDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   300 bits (768),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVATLIAVYA+W FA+I+GCGWGWAGV+WLYSIV Y PLDI+KF IRY+LS
Sbjct  792  LLGAFLIAQLVATLIAVYADWSFAKIKGCGWGWAGVIWLYSIVTYFPLDILKFCIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLEN+TAFTTK +YGKEEREAQWA +QRTLHGLQPPE +NLF+EK+SYRELSEI
Sbjct  852  GKAWDNLLENRTAFTTKSNYGKEEREAQWAASQRTLHGLQPPETANLFAEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+IAQLVAT+IAVYA+WGFARI+G GW WAGV+W+YSIVF+ PLD  KFAIRYILS
Sbjct  792  LVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAGVIWIYSIVFFFPLDWFKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLFS+K+SYRELSEI
Sbjct  852  GKAWDNLLQNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPPETTNLFSDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4 [Fragaria vesca subsp. vesca]
Length=955

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQL+ATL+AVYANWGFARI G GWGWAGV+WLYSIVFY PLDIMKFAIRYILS
Sbjct  793  LLGAFAIAQLIATLVAVYANWGFARIHGVGWGWAGVIWLYSIVFYFPLDIMKFAIRYILS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLN+L+N+TAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE+S+LF++K+SYRELSEI
Sbjct  853  GKAWLNMLDNRTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPESSSLFNDKSSYRELSEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLREL TLKGHVESV KLKGLD+++IQQHYT+
Sbjct  913  AEQAKRRAEMARLRELTTLKGHVESVAKLKGLDLDSIQQHYTV  955



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+IAQLVAT+IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KF IRY  S
Sbjct  793  LVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF EK+SYRELSEI
Sbjct  853  GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+IAQLVATLIAVYA+WGFARI+G GWGWAGV+WLYS+VF+ PLD  KFAIRYILS
Sbjct  792  LVSAFIIAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSVVFFFPLDWFKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +N+FSEK+SYRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETANIFSEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+AR+REL+TLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  912  AEQAKRRAEIARIRELNTLKGHVESVVKLKGLDIDNIQQHYTV  954



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+IAQLVAT+IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KF IRY  S
Sbjct  793  LVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF EK+SYRELSEI
Sbjct  853  GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEI  912

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  913  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KJB65971.1| hypothetical protein B456_010G123000 [Gossypium raimondii]
Length=957

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AFL+AQLVATLIAVYA+WGFARI+G GWGWAGV+WLYS+V YIPLD +KFAIRY+LS
Sbjct  795  LVSAFLVAQLVATLIAVYADWGFARIKGMGWGWAGVIWLYSVVTYIPLDFIKFAIRYVLS  854

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +++F+E++SYRELSEI
Sbjct  855  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETTSIFNERSSYRELSEI  914

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  915  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  957



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF++AQL+AT IAVYANW FARIQG GWGWAGV+W+YS+V YIPLD++KFAIRY+LS
Sbjct  794  LLGAFVVAQLIATFIAVYANWSFARIQGTGWGWAGVIWVYSVVTYIPLDLLKFAIRYVLS  853

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP +A+N+FS+KNSYRELSEI
Sbjct  854  GRAWNNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPADAANVFSDKNSYRELSEI  913

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  914  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF++AQL+AT IAVYANW FARIQG GWGWAGV+W+YS+V YIPLD++KFAIRY+LS
Sbjct  769  LLGAFVVAQLIATFIAVYANWSFARIQGTGWGWAGVIWVYSVVTYIPLDLLKFAIRYVLS  828

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP +A+N+FS+KNSYRELSEI
Sbjct  829  GRAWNNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPADAANVFSDKNSYRELSEI  888

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  889  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  931



>ref|XP_003529784.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQL+ATLIAVYANWGFAR++G GWGWAGV+WLYSI+FYIPLD +KF IRY LS
Sbjct  787  LVTAFIIAQLIATLIAVYANWGFARMRGIGWGWAGVIWLYSIIFYIPLDFLKFGIRYFLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+ ENKTAFTTKKDYGKEEREAQWA AQRTLHGL PPE   +FSEKN+YRELSEI
Sbjct  847  GKAWNNITENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPETEQIFSEKNNYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            A+QA++RAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  ADQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   299 bits (766),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVAT IAVYANWGFARI+G GWGWAGV+W+YS+V Y PLDI+KF IRY+LS
Sbjct  789  LLGAFMIAQLVATFIAVYANWGFARIKGMGWGWAGVIWVYSLVTYFPLDILKFVIRYVLS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PE +NLF++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPETTNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+T+QQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>gb|KJB82763.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=954

 Score =   299 bits (766),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+ AQLVATLIAVYANW FA+IQG GWGWA V+WLYS+V YIPLD++KFAIRY+LS
Sbjct  792  LVTAFIAAQLVATLIAVYANWRFAKIQGMGWGWAAVIWLYSLVTYIPLDLIKFAIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F+E++SYRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNVFNERSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF +AQL+AT++AVYANWGFA I+GCGWGWAGV+WLYSIV Y+PLDI+KFAIRYILS
Sbjct  792  LMSAFCVAQLIATVLAVYANWGFAEIKGCGWGWAGVIWLYSIVTYLPLDILKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+++LENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP E S++F++K+SYRELSEI
Sbjct  852  GKAWVSMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPRETSSIFNDKHSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRE++TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLREVNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|ABM68570.1| plasma membrane H+ ATPase [Lilium longiflorum]
Length=191

 Score =   278 bits (711),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL AQLVAT+I+VYA+WGFARI G GW WAGV+W++SIV Y PLDI+KF IRY LS
Sbjct  29   LVTAFLAAQLVATVISVYASWGFARIDGIGWRWAGVIWIFSIVTYFPLDILKFIIRYALS  88

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GK W NL++NKTAFT+KKDYGK EREAQWA AQRTLHGLQ  + S+LF++KNSYRELSEI
Sbjct  89   GKTWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHGLQTADTSSLFNDKNSYRELSEI  148

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  149  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  191



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score =   299 bits (765),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQLVAT +AVYANWGFARI+G GWGWA V+WLYS+V Y+PLDI+KF IRY+LS
Sbjct  789  LLGAFFIAQLVATFLAVYANWGFARIKGMGWGWAAVIWLYSLVTYVPLDILKFTIRYVLS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +++F++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTSIFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=954

 Score =   299 bits (765),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+AT++AVYANWGFARI+G GWGWAGV+WLYSIV YIPLDI+KF IRY LS
Sbjct  792  LMIAFLIAQLLATILAVYANWGFARIKGMGWGWAGVIWLYSIVTYIPLDILKFMIRYALS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+LENKTAFTTKKDYGK EREAQWA AQRTLHGLQPPE S++F++KN+YRELSEI
Sbjct  852  GKAWDNVLENKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSDIFNDKNNYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   299 bits (765),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AFLIAQLVATLIAVYANWGFARI+G GWGWAGV+WLYSIVF++PLD  KFAIRYILS
Sbjct  791  LVSAFLIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFFVPLDWFKFAIRYILS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLE+KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE S LF+EKNSYRELSEI
Sbjct  851  GKAWDNLLESKTAFTTKKDYGREEREAQWALAQRTLHGLQPPETSALFNEKNSYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI TIQQ YT+
Sbjct  911  AEQAKRRAEIARLRELNTLKGHVESVVKLKGLDISTIQQSYTV  953



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score =   299 bits (766),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF +AQL+AT++AVYANWGFA I+GCGWGWAGV+WLYSIV Y+PLDI+KFAIRYILS
Sbjct  828  LMSAFCVAQLIATVLAVYANWGFAEIKGCGWGWAGVIWLYSIVTYLPLDILKFAIRYILS  887

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+++LENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP E S++F++K+SYRELSEI
Sbjct  888  GKAWVSMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPRETSSIFNDKHSYRELSEI  947

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRE++TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  948  AEQAKRRAEVARLREVNTLKGHVESVVKLKGLDIDTIQQHYTV  990



>gb|AAO72564.1| plasma membrane H+-ATPase-like protein [Oryza sativa Japonica 
Group]
Length=503

 Score =   288 bits (736),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLDI KF IR++LS
Sbjct  339  LVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLS  398

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKNSYRELS  334
            G+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+SYRELS
Sbjct  399  GRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELS  458

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  459  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  503



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score =   299 bits (766),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687   LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
             LV AF+IAQLVAT+IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLDI+KF IRY  S
Sbjct  876   LVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHS  935

Query  507   GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
             GKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF EK+SYRELSEI
Sbjct  936   GKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEI  995

Query  327   AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
             AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  996   AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  1038



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score =   298 bits (763),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+IAQLVAT+IAVYA+WGFARI+G GW WAGV+W+YS VF+ PLD  KFAIRYILS
Sbjct  792  LVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAGVIWIYSFVFFFPLDWFKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLFS+K+SYRELSEI
Sbjct  852  GKAWDNLLQNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPPETTNLFSDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   298 bits (762),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQL+AT IAVYANW FARI+G GWGWAGV+W+YSIV YIPLDI+KF IRY+LS
Sbjct  789  LLGAFMIAQLLATFIAVYANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKFVIRYVLS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ P+ +NLF++KNSYRELSEI
Sbjct  849  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+T+QQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   298 bits (762),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQL+AT IAVYANW FARI+G GWGWAGV+W+YSIV YIPLDI+KF IRY+LS
Sbjct  788  LLGAFMIAQLLATFIAVYANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKFVIRYVLS  847

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ P+ +NLF++KNSYRELSEI
Sbjct  848  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSYRELSEI  907

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+T+QQHYT+
Sbjct  908  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  950



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   298 bits (762),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVAT +AVYANW FARI+G GWGWAGV+WLYS+V Y+PLDI+KFAI Y LS
Sbjct  789  LMGAFLIAQLVATFLAVYANWSFARIKGMGWGWAGVIWLYSLVTYVPLDILKFAIAYALS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +NLF++KNSYRELSEI
Sbjct  849  GKAWNTLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =   296 bits (759),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF++AQL+ATLIAVYANWGFA I+GCGWGWAGV+WL+S+V Y+PLD++KFAIRYILS
Sbjct  792  LVSAFVVAQLIATLIAVYANWGFAHIKGCGWGWAGVIWLFSLVTYLPLDVLKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N LENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP + + +FS+K+SYRELSEI
Sbjct  852  GKAWDNFLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNTIFSDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTL
Sbjct  912  AEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTL  954



>ref|XP_007023380.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26002.1| H(+)-ATPase 9 [Theobroma cacao]
Length=926

 Score =   296 bits (758),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVAT++AVYANWGFARI+G GWGWAGV+W+YS+VFY PLD++KF IRY LS
Sbjct  764  LVTAFIIAQLVATILAVYANWGFARIKGIGWGWAGVIWIYSVVFYFPLDVLKFLIRYSLS  823

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPE ++LF+EK +YRELSEI
Sbjct  824  GKAWDNLLQNKTAFTTKKDYGRGEREAQWAMAQRTLHGLQPPETTDLFNEKTNYRELSEI  883

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQA++RAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  884  AEQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  926



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   296 bits (757),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 154/164 (94%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVATLIAVY NW FA I+GCGWGWAGVVWLY+IVFY PLD++KFAIRYILS
Sbjct  790  LMVAFLIAQLVATLIAVYPNWAFAEIKGCGWGWAGVVWLYNIVFYFPLDVIKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEAS-NLFSEKNSYRELSE  331
            GKAWLNL E+KTAFT+KKDYGKEEREAQWA AQRTLHGLQ PE+S  LF++KNSYRELSE
Sbjct  850  GKAWLNLFESKTAFTSKKDYGKEEREAQWALAQRTLHGLQAPESSATLFNDKNSYRELSE  909

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  910  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQNYTV  953



>gb|KGN65469.1| hypothetical protein Csa_1G423270 [Cucumis sativus]
Length=807

 Score =   293 bits (750),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANW FA+I+G GWGWAGVVW+YS++FYIPLD +KFAIRYILS
Sbjct  644  LMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFAIRYILS  703

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNSYRELSE  331
            GKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNSYRELSE
Sbjct  704  GKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSE  763

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  764  IAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  807



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   295 bits (756),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AFLIAQLVAT IAVYANWGFA+I+GCGWGWAGV+WLYSIVFY PLDI+KF IRY L+
Sbjct  790  LVSAFLIAQLVATFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFIRYALT  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPP+ S LF+EK +YRELSE+
Sbjct  850  GKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNYRELSEM  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIE IQQHYT+
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  952



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AFLIAQLVAT IAVYANWGFA+I+GCGWGWAGV+WLYSIVFY PLDI+KF IRY L+
Sbjct  796  LVSAFLIAQLVATFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFIRYALT  855

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPP+ S LF+EK +YRELSE+
Sbjct  856  GKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNYRELSEM  915

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIE IQQHYT+
Sbjct  916  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  958



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AFLIAQLVAT IAVYANWGFA+I+GCGWGWAGV+WLYSIVFY PLDI+KF IRY L+
Sbjct  788  LVSAFLIAQLVATFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFIRYALT  847

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPP+ S LF+EK +YRELSE+
Sbjct  848  GKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNYRELSEM  907

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIE IQQHYT+
Sbjct  908  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  950



>emb|CBI20766.3| unnamed protein product [Vitis vinifera]
Length=862

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+ AQLVAT+I+VYANWGFARI+G GWGWAGV+WLYS+V Y+PLD +KFAIRYI S
Sbjct  700  LVGAFIAAQLVATVISVYANWGFARIKGTGWGWAGVIWLYSVVTYVPLDFLKFAIRYIQS  759

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+FS+K+ YRELSEI
Sbjct  760  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNIFSDKSGYRELSEI  819

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGH+ESVVKLKGLDI+TIQ HYT+
Sbjct  820  AEQAKRRAEVARLRELNTLKGHMESVVKLKGLDIDTIQHHYTV  862



>gb|AHK23067.1| plasma membrane ATPase 4 [Fagopyrum tataricum]
Length=965

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 153/164 (93%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF IAQLVATLIAVYANWGFARIQG GWGWAGV WLYS+VFY PLD++KFAIRYILS
Sbjct  791  LVTAFFIAQLVATLIAVYANWGFARIQGMGWGWAGVAWLYSLVFYFPLDLLKFAIRYILS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN-LFSEKNSYRELSE  331
            GKAWL+L +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPP+ +N +FSEK+SYRELSE
Sbjct  851  GKAWLSLFDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPQTTNAMFSEKSSYRELSE  910

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQA+RRAE+ARLREL TLKGHVESV KLKG+DIETIQQ YT+
Sbjct  911  IAEQARRRAEMARLRELQTLKGHVESVAKLKGIDIETIQQSYTV  954



>ref|XP_010539422.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Tarenaya hassleriana]
Length=885

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVAT+IAVYANW FARI+G GWGWAGV+WLYSIVFY+PLD+MKF IRY+LS
Sbjct  723  LVTAFILAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFYVPLDVMKFGIRYVLS  782

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+NL++NKTAFTTKKDYG+EEREAQWA AQRTLHGLQP E +N+F EK SYRELSEI
Sbjct  783  GKAWVNLIDNKTAFTTKKDYGREEREAQWATAQRTLHGLQPKEGANIFPEKGSYRELSEI  842

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+    HYT+
Sbjct  843  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDAPAGHYTV  885



>ref|XP_006465284.1| PREDICTED: ATPase 9, plasma membrane-type-like [Citrus sinensis]
Length=962

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYAN+GFARI G GWGWAGV+WLYSIVFYIPLD++KF +RY L+
Sbjct  800  LIAAFIIAQLVATLIAVYANFGFARIHGIGWGWAGVIWLYSIVFYIPLDVLKFIVRYALT  859

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYG+ EREAQWA AQRTLHGL PPE S L ++KN+YRELSEI
Sbjct  860  GKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNYRELSEI  919

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  920  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>ref|XP_004146327.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=953

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANW FA+I+G GWGWAGVVW+YS++FYIPLD +KFAIRYILS
Sbjct  790  LMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNSYRELSE  331
            GKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNSYRELSE
Sbjct  850  GKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSE  909

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  IAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|AAQ19041.1| P-type H+-ATPase [Phaseolus acutifolius]
Length=370

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVAT IAVYANWGFARI+G GWGWAGV+WLYS+V YIPLD +KFAIRYILS
Sbjct  222  LLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDFLKFAIRYILS  281

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNLF++KNSYRELSEI
Sbjct  282  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEI  341

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKL  241
            AEQAKRRAEVARLRELHTLKGHVESVVKL
Sbjct  342  AEQAKRRAEVARLRELHTLKGHVESVVKL  370



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF IR++LS
Sbjct  797  LVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLS  856

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEA--SNLFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA  S LF +KNSYRELS
Sbjct  857  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELS  916

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  917  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  961



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF IR++LS
Sbjct  787  LVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEA--SNLFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA  S LF +KNSYRELS
Sbjct  847  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELS  906

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  907  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_004161788.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=953

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANW FA+I+G GWGWAGVVW+YS++FYIPLD +KFAIRYILS
Sbjct  790  LMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNSYRELSE  331
            GKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNSYRELSE
Sbjct  850  GKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSE  909

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  IAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|ABW25091.1| plasma membrane proton pump [Cucumis sativus]
Length=953

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANW FA+I+G GWGWAGVVW+YS++FYIPLD +KFAIRYILS
Sbjct  790  LMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNSYRELSE  331
            GKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNSYRELSE
Sbjct  850  GKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSE  909

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  IAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|EPS63245.1| hypothetical protein M569_11541, partial [Genlisea aurea]
Length=935

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AFL+AQLVAT+IAVYA+WGFARI+GCGWGWAGV+W+YS+VFY+PLD +KFAIRYILS
Sbjct  773  LMSAFLVAQLVATIIAVYADWGFARIKGCGWGWAGVIWIYSVVFYVPLDFIKFAIRYILS  832

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFTTK +YGKE+REAQWA AQRTLHGLQ  E S++ +EKNSYRELSEI
Sbjct  833  GKAWLNLYENKTAFTTKSNYGKEDREAQWALAQRTLHGLQTTETSSVMNEKNSYRELSEI  892

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAE+ARLRELHTLKGHVESVVKLKGLDIETIQQ+YT+
Sbjct  893  AEQAKKRAEIARLRELHTLKGHVESVVKLKGLDIETIQQNYTV  935



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   294 bits (753),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+ AQLVAT+I+VYANWGFARI+G GWGWAGV+WLYS+V Y+PLD +KFAIRYI S
Sbjct  792  LVGAFIAAQLVATVISVYANWGFARIKGTGWGWAGVIWLYSVVTYVPLDFLKFAIRYIQS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+FS+K+ YRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNIFSDKSGYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL+TLKGH+ESVVKLKGLDI+TIQ HYT+
Sbjct  912  AEQAKRRAEVARLRELNTLKGHMESVVKLKGLDIDTIQHHYTV  954



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   294 bits (753),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+ AQLVATLIAVYA WGFARI+G GWGWAGV+WLYS+V Y+PLDI+KFAIRYILS
Sbjct  792  LVSAFVAAQLVATLIAVYAEWGFARIKGTGWGWAGVIWLYSLVTYVPLDILKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW +LLENKTAFT+KKDYGKEEREAQWA AQRTLHGLQPPE SN  S+K SYRELSEI
Sbjct  852  GRAWNSLLENKTAFTSKKDYGKEEREAQWATAQRTLHGLQPPETSNQKSDKGSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI++IQQHYT 
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDSIQQHYTF  954



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =   294 bits (753),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 155/164 (95%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATL+AVYANW FA+I+G GWGWAGVVW+YS+VFYIPLD +KFAIRYILS
Sbjct  790  LMGAFVIAQLVATLLAVYANWEFAKIKGAGWGWAGVVWIYSVVFYIPLDFIKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PEASNLFSEKNSYRELSE  331
            GKAWLNLLENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE ++LF EKNSYRELSE
Sbjct  850  GKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSE  909

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  910  IAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQL+AT+IAVYANWGFARI G GWGWAGV+WLYS++ Y+PLDI+KF IRY+LS
Sbjct  792  LLGAFVIAQLIATIIAVYANWGFARIHGIGWGWAGVIWLYSLITYVPLDILKFIIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+LE KTAFTTKKDYGK EREAQWA AQRTLHGLQPPE S LF++KN+YRELSEI
Sbjct  852  GKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSELFNDKNNYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 157/165 (95%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF IR++LS
Sbjct  787  LVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFFIRFVLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN--LFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEAS+  LF++K+SYRELS
Sbjct  847  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYRELS  906

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  907  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AFLIAQLVATLI+VYANWGFARI+G GWGWAGV+WLYSIVF++PLD  KFA RYILS
Sbjct  792  LVSAFLIAQLVATLISVYANWGFARIKGIGWGWAGVIWLYSIVFFLPLDWFKFATRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLE KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE S LF+EK+SYRELSEI
Sbjct  852  GKAWDNLLERKTAFTTKKDYGREEREAQWATAQRTLHGLQPPETSTLFNEKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI TIQQ YT+
Sbjct  912  AEQAKRRAEIARLRELNTLKGHVESVVKLKGLDISTIQQSYTV  954



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 157/165 (95%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF IR++LS
Sbjct  787  LVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFFIRFVLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN--LFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEAS+  LF++K+SYRELS
Sbjct  847  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYRELS  906

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  907  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF++AQL+ATLIAVYANWGFA I+GCGWGWAGV+WL+S+V Y+PLD++KFAIRYILS
Sbjct  792  LVSAFVVAQLIATLIAVYANWGFAHIKGCGWGWAGVIWLFSLVTYLPLDLLKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N LENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP + + +FS+K+SYRELSEI
Sbjct  852  GKAWDNFLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNTIFSDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+ IQQHYTL
Sbjct  912  AEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDRIQQHYTL  954



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVAT+IAVYANW FARI+G GWGWAGV+WLYSIVFY+PLD+MKF IRY+LS
Sbjct  788  LVTAFILAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFYVPLDVMKFGIRYVLS  847

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+NL++NKTAFTTKKDYG+EEREAQWA AQRTLHGLQP E +N+F EK SYRELSEI
Sbjct  848  GKAWVNLIDNKTAFTTKKDYGREEREAQWATAQRTLHGLQPKEGANIFPEKGSYRELSEI  907

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+    HYT+
Sbjct  908  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDAPAGHYTV  950



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+IAQL+ATL+AVYANW FA+I G GWGWAGV+WLYSIVFYIPLD++KFAIRY LS
Sbjct  572  LVAAFIIAQLIATLLAVYANWAFAKIHGIGWGWAGVIWLYSIVFYIPLDVLKFAIRYALS  631

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NL++NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPE + +F +KN YRELSEI
Sbjct  632  GKAWDNLVQNKTAFTTKKDYGRGEREAQWAAAQRTLHGLQPPETAEIFQDKN-YRELSEI  690

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  691  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  733



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   294 bits (752),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF IR++LS
Sbjct  818  LVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLS  877

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEA--SNLFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA  S LF +KNSYRELS
Sbjct  878  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELS  937

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  938  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  982



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   293 bits (751),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AFLIAQLVATLIAVYA W FARI G GWGWAGV+W++S+VFY PLDI+KF IRY LS
Sbjct  792  LVFAFLIAQLVATLIAVYAKWHFARISGIGWGWAGVIWIFSVVFYFPLDILKFLIRYGLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGK EREAQWA AQRTLHGLQPPE S+LF++K+SYRELSEI
Sbjct  852  GKAWDNLLQNKTAFTTKKDYGKGEREAQWALAQRTLHGLQPPETSSLFNDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score =   293 bits (750),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVAT+IAVYANW FARI+G GWGWAGV+WLYSIVFY+PLD+MKF IRY+LS
Sbjct  788  LVTAFILAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFYVPLDVMKFGIRYVLS  847

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW+NL++NKTAFTTKKDYG+EEREAQWA AQRTLHGLQP E +N+F EK SYRELSEI
Sbjct  848  GKAWVNLIDNKTAFTTKKDYGREEREAQWATAQRTLHGLQPKEGANIFPEKGSYRELSEI  907

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+    HYT+
Sbjct  908  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDAPAGHYTV  950



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =   293 bits (751),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYAN+GFARI G GWGW GV+WLYSIVFYIPLD++KF +RY L+
Sbjct  800  LIAAFIIAQLVATLIAVYANFGFARIHGIGWGWVGVIWLYSIVFYIPLDVLKFIVRYALT  859

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYG+ EREAQWA AQRTLHGL PPE S L ++KN+YRELSEI
Sbjct  860  GKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNYRELSEI  919

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  920  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>gb|KDO45595.1| hypothetical protein CISIN_1g044543mg [Citrus sinensis]
Length=962

 Score =   293 bits (750),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYAN+GFARI G GWGW GV+WLYSIVFYIPLD++KF +RY L+
Sbjct  800  LIAAFIIAQLVATLIAVYANFGFARIHGIGWGWVGVIWLYSIVFYIPLDVLKFIVRYALT  859

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYG+ EREAQWA AQRTLHGL PPE S L ++KN+YRELSEI
Sbjct  860  GKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNYRELSEI  919

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  920  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   293 bits (749),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 157/165 (95%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVATLIAVYA+WGFARI+G GWGWAGVVWLYS+VFY+PLD+ KF IR+ LS
Sbjct  787  LVTAFLLAQLVATLIAVYADWGFARIKGIGWGWAGVVWLYSVVFYLPLDVFKFLIRFALS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF+EK+SYRELS
Sbjct  847  GRAWDNLLENKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPEVASNTLFNEKSSYRELS  906

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  907  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 156/165 (95%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD+ KF IR++LS
Sbjct  787  LVTAFLLAQLVATFLAVYANWGFARIEGIGWGWAGVVWLYSIVFYFPLDLFKFFIRFVLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASN--LFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA++  LF++K+SYRELS
Sbjct  847  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAASNTLFNDKSSYRELS  906

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  907  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|EYU20899.1| hypothetical protein MIMGU_mgv1a000880mg [Erythranthe guttata]
Length=952

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQL+ATLIAVYANWGFARI GCGWGWAGV+WLYS+VFY+PLD+MKFA RYILS
Sbjct  790  LMIAFCIAQLIATLIAVYANWGFARISGCGWGWAGVIWLYSLVFYVPLDLMKFATRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NL +NK AFT K DYGKEEREAQWA AQRTLHGLQ  EASN+F +K+SYRELSEI
Sbjct  850  GKAWQNLYDNKIAFTAKNDYGKEEREAQWALAQRTLHGLQTSEASNVFHDKSSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESV+KLKGLDIETI QHYT+
Sbjct  910  AEQAKRRAEIARLRELHTLKGHVESVMKLKGLDIETIPQHYTV  952



>ref|XP_010429928.1| PREDICTED: ATPase 9, plasma membrane-type-like [Camelina sativa]
Length=276

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANW FARI+G GWGWAGV+WLY+IV YIPLDI+KF IRY LS
Sbjct  113  LIFAFLIAQLIATLIAVYANWDFARIRGTGWGWAGVIWLYTIVTYIPLDILKFIIRYSLS  172

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP-EASNLFSEKNSYRELSE  331
            G+AW N++ENKTAFT+KKDYGK EREAQWA AQRTLHGLQP  ++S++F++K++YRELSE
Sbjct  173  GRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQPAHQSSDMFNDKSTYRELSE  232

Query  330  IAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            IA+QAKRRAEVARLRE HTLKGHVESVVK KGLDIE IQQHYTL
Sbjct  233  IADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  276



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   292 bits (747),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 156/165 (95%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVAT +AVYANWGFARI+G GWGWAGVVWLYSIVFY PLD++KF IR++LS
Sbjct  787  LVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEAS--NLFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPEA+   LF++K+SYRELS
Sbjct  847  GRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATNTLFNDKSSYRELS  906

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  907  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|AAF27113.1|AC018849_1 aha9, 5' partial; 1-2403 [Arabidopsis thaliana]
Length=612

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF +AQL+ATLIAVYANW FARI+G GWGWAGV+WLYSIVFYIPLDI+KF IRY LS
Sbjct  450  LISAFFMAQLIATLIAVYANWNFARIRGIGWGWAGVIWLYSIVFYIPLDILKFIIRYSLS  509

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW N++ENKTAFT+KKDYGK EREAQWA AQRTLHGLQP + S++F++K++YRELSEI
Sbjct  510  GRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQPAQTSDMFNDKSTYRELSEI  569

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            A+QAKRRAEVARLRE HTLKGHVESVVK KGLDIE IQQHYTL
Sbjct  570  ADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  612



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFLIAQL+AT+IAVY +W FARIQG GWGWAGV+WLYSIVFY+PLD++KF IRY LS
Sbjct  791  LVTAFLIAQLIATIIAVYGDWKFARIQGIGWGWAGVIWLYSIVFYVPLDVLKFIIRYALS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NL++N+TAFTTKKDYG+ EREAQWA AQRTLHGLQPPE + LF +KN YRELSEI
Sbjct  851  GKAWDNLVQNRTAFTTKKDYGRGEREAQWAAAQRTLHGLQPPETAELFQDKN-YRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_006293643.1| hypothetical protein CARUB_v10022598mg [Capsella rubella]
 gb|EOA26541.1| hypothetical protein CARUB_v10022598mg [Capsella rubella]
Length=931

 Score =   291 bits (744),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVAT IAVYANW FARI+G GWGWAGV+WLYS++ YIPLD++KF IRY+LS
Sbjct  769  LLGAFVIAQLVATFIAVYANWSFARIEGAGWGWAGVIWLYSLITYIPLDLLKFGIRYVLS  828

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F+EKNSY +LS+I
Sbjct  829  GKAWLNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAETNNIFNEKNSYHDLSQI  888

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEV RLRE++TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  889  AEQAKRRAEVVRLREINTLKGHVESVVKLKGLDIDTIQQHYTV  931



>gb|KHN38020.1| Plasma membrane ATPase [Glycine soja]
Length=885

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQL+AT+IAVYANWGFAR++G GWGWAGV+WLYSI+FYIPLD +KF IRY LS
Sbjct  723  LVTAFVIAQLIATIIAVYANWGFARMKGIGWGWAGVIWLYSIIFYIPLDFLKFGIRYFLS  782

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW N+ ENKTAFTTKKDYGKEEREAQW  AQRTLHGL PPE   +FSEKN+YRELS+I
Sbjct  783  GRAWNNITENKTAFTTKKDYGKEEREAQWVTAQRTLHGLNPPETEQIFSEKNNYRELSDI  842

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            A+QA++RAEVARLREL+TLKGHVESVVKLKGLDI TIQQHYT+
Sbjct  843  ADQARKRAEVARLRELYTLKGHVESVVKLKGLDIGTIQQHYTV  885



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =   291 bits (745),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQL+AT+IAVYANWGFARI G GWGWAGV+WLYS++ Y+PLDI+KF IRY+LS
Sbjct  792  LLGAFVIAQLIATIIAVYANWGFARIHGIGWGWAGVIWLYSLITYVPLDILKFIIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+LE KTAFTTKKDYGK EREAQWA AQRTLHGLQPPE S LF++KN+Y ELSEI
Sbjct  852  GKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSELFNDKNNYGELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   291 bits (744),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL+AQLVATLIAVYANWGFARI+G GWGWAGVVWLYS+V Y PLD+ KF IR+ LS
Sbjct  787  LVTAFLLAQLVATLIAVYANWGFARIKGIGWGWAGVVWLYSVVLYFPLDVFKFLIRFALS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKNSYRELS  334
            G+AW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF+EK+SYRELS
Sbjct  847  GRAWDNLLENKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPEVASNTLFNEKSSYRELS  906

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  907  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   290 bits (743),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AFLIAQL+AT+IAVYA+WGFARI G GWGWAGV+WLYSIVFYIPLDI+KF IRY LS
Sbjct  792  LVGAFLIAQLIATIIAVYAHWGFARIHGIGWGWAGVIWLYSIVFYIPLDILKFIIRYALS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+LE KTAFTTKKDYGK EREAQWA AQRTLHGLQ  E + LFS+KN+YRELSEI
Sbjct  852  GKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQSAETAELFSDKNNYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>sp|Q9SJB3.3|PMA5_ARATH RecName: Full=ATPase 5, plasma membrane-type; AltName: Full=Proton 
pump 5 [Arabidopsis thaliana]
Length=949

 Score =   290 bits (743),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVAT IAVYANW FARI+G GWGWAGV+WLYS + YIPLD++KF IRY+LS
Sbjct  787  LLGAFVIAQLVATFIAVYANWSFARIEGAGWGWAGVIWLYSFLTYIPLDLLKFGIRYVLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F+EKNSY ELS+I
Sbjct  847  GKAWLNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAEKNNIFNEKNSYSELSQI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEV RLRE++TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  907  AEQAKRRAEVVRLREINTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   290 bits (743),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L  AF++AQLVATLIAVYANWGFA+I+GCGWGWAG++WLYS + +IPLD +KF+IRYILS
Sbjct  792  LCGAFVVAQLVATLIAVYANWGFAKIKGCGWGWAGIIWLYSFITFIPLDWIKFSIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW +L E +TAFTTKKDYG+EEREAQWA AQRTLHGLQPPE +NLFS+K+SYRELSEI
Sbjct  852  GRAWDSLFERRTAFTTKKDYGREEREAQWAIAQRTLHGLQPPETTNLFSDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AE+AKRRAE+ARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEKAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|NP_180028.1| H(+)-ATPase 5 [Arabidopsis thaliana]
 gb|AAD23893.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
 gb|AEC07588.1| H(+)-ATPase 5 [Arabidopsis thaliana]
Length=931

 Score =   290 bits (742),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVAT IAVYANW FARI+G GWGWAGV+WLYS + YIPLD++KF IRY+LS
Sbjct  769  LLGAFVIAQLVATFIAVYANWSFARIEGAGWGWAGVIWLYSFLTYIPLDLLKFGIRYVLS  828

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F+EKNSY ELS+I
Sbjct  829  GKAWLNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAEKNNIFNEKNSYSELSQI  888

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEV RLRE++TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  889  AEQAKRRAEVVRLREINTLKGHVESVVKLKGLDIDTIQQHYTV  931



>emb|CDY03545.1| BnaC03g68040D [Brassica napus]
Length=660

 Score =   284 bits (727),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVATLIAVYANW FA+++G GWGWAGV+WLYSIV Y P DI KFAIRYILS
Sbjct  499  LMVAFLIAQLVATLIAVYANWEFAKVRGIGWGWAGVIWLYSIVTYFPQDIFKFAIRYILS  558

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SYRELSEI
Sbjct  559  GKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSYRELSEI  618

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  619  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PGHYTV  660



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   290 bits (742),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF IAQL+AT+IAVYANWGFA++QG GWGWAGV+WLYSIVFYIPLD+MKFAIRYILS
Sbjct  790  LVIAFFIAQLIATIIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLDVMKFAIRYILS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE+S +F+EK+SYRELSEI
Sbjct  850  GKAWNNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPESSGIFNEKSSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIE  223
            AEQAKRRAEVARLRELHTLKGHVESVVKLK + ++
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKAIKVK  944



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   290 bits (742),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AFL AQL+ATLIAVYA WGFARIQG GWGWAGV+W+YSI+FY PLD +KF IR+ LS
Sbjct  792  LVSAFLAAQLLATLIAVYAKWGFARIQGIGWGWAGVIWVYSIIFYFPLDPLKFIIRFALS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPP+ S L ++KNSYRELSEI
Sbjct  852  GKAWDNLLENKTAFTTKKDYGREEREAQWALAQRTLHGLQPPDLSGLLNDKNSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  912  AEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  954



>ref|XP_003531728.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   290 bits (742),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQL+AT+IAVYANWGFAR++G GWGWAGV+WLYSI+FYIPLD +KF IRY LS
Sbjct  787  LVTAFVIAQLIATIIAVYANWGFARMKGIGWGWAGVIWLYSIIFYIPLDFLKFGIRYFLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW N+ ENKTAFTTKKDYGKEEREAQW  AQRTLHGL PPE   +FSEKN YRELS+I
Sbjct  847  GRAWNNITENKTAFTTKKDYGKEEREAQWVTAQRTLHGLNPPETEQIFSEKNKYRELSDI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            A+QA++RAEVARLREL+TLKGHVESVVKLKGLDI TIQQHYT+
Sbjct  907  ADQARKRAEVARLRELYTLKGHVESVVKLKGLDIGTIQQHYTV  949



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =   290 bits (742),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AFLIAQL+AT+IAVYA+WGFARI G GWGWAGV+WLYSIVFYIPLDI+KF IRY LS
Sbjct  792  LVGAFLIAQLIATIIAVYAHWGFARIHGIGWGWAGVIWLYSIVFYIPLDILKFIIRYALS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+LE KTAFTTKKDYG+ EREAQWA AQRTLHGLQ  E + LFS+KN+YRELSEI
Sbjct  852  GKAWDNVLERKTAFTTKKDYGRGEREAQWATAQRTLHGLQSAETAELFSDKNNYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007135798.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
 gb|ESW07792.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
Length=949

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF++AQL+AT+IAVYANW FAR+QG GWGWAGV+WLYSIVFY+PLD++KF IRY LS
Sbjct  787  LVSAFIVAQLIATVIAVYANWEFARMQGIGWGWAGVIWLYSIVFYLPLDVLKFGIRYFLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+ ENKTAFTTKKDYGKEEREAQWA AQRTLHGL PPE    FSE+N+YRELSEI
Sbjct  847  GKAWNNITENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPETEPTFSERNNYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQA++RAEVARLRELHTLKGH+ESVVKLKGLDI+TIQ HYT+
Sbjct  907  AEQARKRAEVARLRELHTLKGHMESVVKLKGLDIDTIQHHYTV  949



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANW FA+I+G GWGWAGV+WLYSIV Y PLD+ KFAIRYILS
Sbjct  787  LMIAFLIAQLIATLIAVYANWQFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFAIRYILS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFT KKDYGKEEREAQWAHAQRTLHGLQP EA N F EK SYRELSEI
Sbjct  847  GKAWLNLFENKTAFTMKKDYGKEEREAQWAHAQRTLHGLQPKEADNTFPEKGSYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  907  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  948



>dbj|BAG94605.1| unnamed protein product [Oryza sativa Japonica Group]
Length=908

 Score =   289 bits (739),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLDI KF IR++LS
Sbjct  744  LVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLS  803

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKNSYRELS  334
            G+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+SYRELS
Sbjct  804  GRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELS  863

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  864  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  908



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score =   289 bits (740),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANW FA+I+G GWGWAGV+WLYSIV Y PLD+ KFAIRYILS
Sbjct  787  LMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFAIRYILS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFT KKDYGKEEREAQWAHAQRTLHGLQP EA N F EK SYRELSEI
Sbjct  847  GKAWLNLFENKTAFTMKKDYGKEEREAQWAHAQRTLHGLQPKEADNTFPEKGSYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  907  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  948



>ref|XP_010472461.1| PREDICTED: ATPase 5, plasma membrane-type [Camelina sativa]
Length=957

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVAT IAVYA+W FARI+G GWGWAGV+WLYS++ YIPLD++KF IRY+LS
Sbjct  795  LLGAFVIAQLVATFIAVYADWSFARIEGAGWGWAGVIWLYSLITYIPLDLLKFGIRYVLS  854

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F+EKNSY ELS+I
Sbjct  855  GKAWLNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAETNNIFNEKNSYSELSQI  914

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEV RLRE+++LKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  915  AEQAKRRAEVVRLREINSLKGHVESVVKLKGLDIDTIQQHYTV  957



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 150/163 (92%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+TAF+IAQL+AT IAVYA+WGFA+I+G GWGWAGV+WLYS+V Y PLD+MKFAIRYILS
Sbjct  787  LMTAFVIAQLIATFIAVYADWGFAKIKGIGWGWAGVIWLYSLVTYFPLDVMKFAIRYILS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E+ N+F EK SYRELSEI
Sbjct  847  GKAWLNLFENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPKESGNIFPEKGSYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T   HYT+
Sbjct  907  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDT-PGHYTV  948



>gb|KJB70727.1| hypothetical protein B456_011G089100 [Gossypium raimondii]
Length=953

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF++AQL+ATL+AVYANWGFARI+G GWGWAGV+WLYS+VFY+PLD++KF IRY LS
Sbjct  791  LVVAFILAQLIATLLAVYANWGFARIKGIGWGWAGVIWLYSLVFYVPLDVLKFLIRYSLS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYGK EREAQWA AQRTLHGL PPE + L++E+ +YRELSEI
Sbjct  851  GKAWDNLLQNKTAFTTKKDYGKGEREAQWAMAQRTLHGLTPPEMTQLYNEETNYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQA++RAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  911  AEQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|EAZ32257.1| hypothetical protein OsJ_16461 [Oryza sativa Japonica Group]
Length=951

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLDI KF IR++LS
Sbjct  787  LVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKNSYRELS  334
            G+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+SYRELS
Sbjct  847  GRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELS  906

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  907  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|NP_001054118.1| Os04g0656100 [Oryza sativa Japonica Group]
 sp|Q7XPY2.1|PMA1_ORYSJ RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Oryza sativa Japonica Group]
 emb|CAE03410.3| OSJNBa0071I13.11 [Oryza sativa Japonica Group]
 dbj|BAF16032.1| Os04g0656100 [Oryza sativa Japonica Group]
 emb|CAH66693.1| OSIGBa0158D24.1 [Oryza sativa Indica Group]
 gb|EAY95868.1| hypothetical protein OsI_17734 [Oryza sativa Indica Group]
Length=951

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLDI KF IR++LS
Sbjct  787  LVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKNSYRELS  334
            G+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+SYRELS
Sbjct  847  GRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELS  906

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  907  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF +AQLVATLIAVYANWGFA ++G GWGWAGV+W+YS+VFYIPLD++KFA RY LS
Sbjct  789  LVFAFFVAQLVATLIAVYANWGFADMKGIGWGWAGVIWIYSVVFYIPLDVLKFATRYALS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+++N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPE S+LF++K +YRELSEI
Sbjct  849  GKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSDLFNDKTNYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  909  AEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>emb|CAD29313.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=948

 Score =   289 bits (739),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 155/165 (94%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLDI KF IR++LS
Sbjct  784  LVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLS  843

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKNSYRELS  334
            G+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+SYRELS
Sbjct  844  GRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELS  903

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  904  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  948



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   288 bits (738),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF++AQL+ATLIAVYANW FA+I+G GWGWA  VW+Y++V YIPLDI+KF IRY LS
Sbjct  791  LLGAFVVAQLIATLIAVYANWSFAKIEGMGWGWALAVWIYTLVTYIPLDILKFTIRYALS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW NLL+NKTAFTTKKDYGKEEREAQWA AQRT+HGLQPPE +NLF EK++YRELSEI
Sbjct  851  GRAWNNLLDNKTAFTTKKDYGKEEREAQWAAAQRTMHGLQPPETTNLFPEKSNYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  911  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   287 bits (735),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF +AQLVATLIAVYANWGFA ++G GWGWAGV+W+YS++FYIPLD++KFA RY LS
Sbjct  728  LVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFATRYALS  787

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+++N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPE S LF++K +YRELSEI
Sbjct  788  GKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNYRELSEI  847

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  848  AEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  890



>gb|KFK32649.1| hypothetical protein AALP_AA6G270500 [Arabis alpina]
Length=838

 Score =   286 bits (732),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQLVAT IAVYANW FARI+G GWGWAGV+WLYS++ YIPLD++KFAIRYILS
Sbjct  676  LLGAFFIAQLVATFIAVYANWSFARIEGAGWGWAGVIWLYSLITYIPLDLLKFAIRYILS  735

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFT KKDYGKEEREAQWA AQRTLHGLQP E +N+F+EKNS+ ELSEI
Sbjct  736  GKAWLNLLENKTAFTMKKDYGKEEREAQWAAAQRTLHGLQPAERNNIFNEKNSFSELSEI  795

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEV RLREL+TLK  VESVVKLKGLDI+TIQQHYT+
Sbjct  796  AEQAKRRAEVVRLRELNTLKRQVESVVKLKGLDIDTIQQHYTV  838



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =   288 bits (736),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 154/165 (93%), Gaps = 2/165 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF++AQLVAT IAVYANW FARI+G GWGWAGV+WLYSIVFY PLDI KF IR++LS
Sbjct  787  LVTAFMLAQLVATFIAVYANWSFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-ASN-LFSEKNSYRELS  334
            G+AW NLLENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ASN LF++K+SYRELS
Sbjct  847  GRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNALFNDKSSYRELS  906

Query  333  EIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            EIAEQAKRRAE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YT+
Sbjct  907  EIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_008386550.1| PREDICTED: ATPase 9, plasma membrane-type-like [Malus domestica]
Length=962

 Score =   288 bits (736),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQL+AT+IAVYANWGFARI+G GWGWAGV+WLYSIV YIPLDI+KF IRYILS
Sbjct  801  LLGAFFIAQLIATIIAVYANWGFARIRGIGWGWAGVIWLYSIVTYIPLDILKFIIRYILS  860

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+LENKTAFTTKKDYGK +REAQWA AQRTLHGLQPPE + LF +KN YRELSEI
Sbjct  861  GKAWDNVLENKTAFTTKKDYGKGDREAQWATAQRTLHGLQPPETAELFHDKN-YRELSEI  919

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAEVARLREL+TLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  920  AEQAKKRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  962



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   288 bits (736),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFLIAQL+AT IAVYA+WGFA+I+G GWGWAGV+WLYS+V Y PLD+MKFAIRYILS
Sbjct  787  LVTAFLIAQLIATFIAVYADWGFAKIKGIGWGWAGVIWLYSLVTYFPLDVMKFAIRYILS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NL ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E  N+F EK SYRELSEI
Sbjct  847  GKAWTNLFENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPKEQVNIFPEKGSYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T   HYT+
Sbjct  907  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDT-PGHYTV  948



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   288 bits (736),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+IAQLVAT++AVYANWGFAR++G GWGWAGV+W+YSIVFYIPLDI+KF IRY LS
Sbjct  791  LVTAFIIAQLVATILAVYANWGFARMKGIGWGWAGVIWIYSIVFYIPLDILKFFIRYSLS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ P + ++ ++KNS+ ELSEI
Sbjct  851  GKAWDNLLQNKTAFTTKKDYGREEREAQWATAQRTLHGLQTPGSVDILNDKNSHEELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAEVARLRE HTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  911  AEQAKKRAEVARLREFHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   288 bits (736),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF++AQLVATLIAVYANW FARI+G GWGWAGV+WLYSIVFY+PLD+MKFAIRYILS
Sbjct  795  LVIAFILAQLVATLIAVYANWSFARIKGIGWGWAGVIWLYSIVFYVPLDLMKFAIRYILS  854

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWL+LL+NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ  EA  +  EK SYRELSEI
Sbjct  855  GKAWLSLLDNKTAFTTKKDYGREEREAQWALAQRTLHGLQSKEAVGILPEKGSYRELSEI  914

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T   HYT+
Sbjct  915  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTPSGHYTV  957



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   287 bits (735),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF +AQLVATLIAVYANWGFA ++G GWGWAGV+W+YS++FYIPLD++KFA RY LS
Sbjct  789  LVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFATRYALS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+++N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPE S LF++K +YRELSEI
Sbjct  849  GKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  909  AEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF +AQLVATLIAVYANWGFA ++G GWGWAGV+W+YS++FYIPLD++KFA RY LS
Sbjct  789  LVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFATRYALS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW N+++N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPE S LF++K +YRELSEI
Sbjct  849  GKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  909  AEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   287 bits (734),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+ AQLVAT IAVY +WGFARI+G GWGWAG +WL+SI+ Y PLDI+KF IRY LS
Sbjct  790  LVGAFIAAQLVATCIAVYPSWGFARIEGIGWGWAGAIWLFSIITYFPLDILKFIIRYGLS  849

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPE SNLF++ +SYRELSEI
Sbjct  850  GKAWDNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPETSNLFNDNSSYRELSEI  909

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  910  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>emb|CDO98206.1| unnamed protein product [Coffea canephora]
Length=956

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF++AQL+ATLIAVYANW FA I G GWGWAGV+WLYS++FYIPLD+MKF IRY L+
Sbjct  794  LVGAFVVAQLIATLIAVYANWEFAYIHGIGWGWAGVIWLYSVIFYIPLDVMKFFIRYCLT  853

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW NLL+NKTAFTTKKDYG+ EREAQWA AQRTLHGL PPE S++ ++KN+YRELSEI
Sbjct  854  GRAWNNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPENSDILNDKNNYRELSEI  913

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  914  AEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+ AQLVAT IAVY +WGFARI+G GWGWAG +WL+SI+ Y PLDI+KF IRY LS
Sbjct  805  LVGAFIAAQLVATCIAVYPSWGFARIEGIGWGWAGAIWLFSIITYFPLDILKFIIRYGLS  864

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPE SNLF++ +SYRELSEI
Sbjct  865  GKAWDNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPETSNLFNDNSSYRELSEI  924

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  925  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  967



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAFL AQLVATLIAVYA+WGFARI G GWGWAGV+W++SIV Y PLDI+KF IRY LS
Sbjct  789  LVTAFLAAQLVATLIAVYASWGFARIDGIGWGWAGVIWIFSIVTYFPLDILKFIIRYALS  848

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW NL++NKTAFT+KKDYGK EREAQWA AQRTLHGLQ  + SNLF++KN+YRELSEI
Sbjct  849  GRAWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHGLQTADTSNLFNDKNNYRELSEI  908

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  909  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>dbj|BAD94367.1| plasma membrane proton ATPase [Arabidopsis thaliana]
Length=262

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYA+W FA+++G GWGWAGV+W+YSIV Y P DI+KFAIRYILS
Sbjct  100  LMIAFVIAQLVATLIAVYADWTFAKVKGIGWGWAGVIWIYSIVTYFPQDILKFAIRYILS  159

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW +L +N+TAFTTKKDYG  EREAQWA AQRTLHGLQP E  N+F EK SYRELSEI
Sbjct  160  GKAWASLFDNRTAFTTKKDYGIGEREAQWAQAQRTLHGLQPKEDVNIFPEKGSYRELSEI  219

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESV KLKGLDI+T   HYT+
Sbjct  220  AEQAKRRAEIARLRELHTLKGHVESVAKLKGLDIDTAGHHYTV  262



>ref|XP_006412736.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
 gb|ESQ54189.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
Length=948

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANWGFA+++G GWGWAGV+WLYSIV Y P DI KFAIRYILS
Sbjct  787  LMIAFLIAQLIATLIAVYANWGFAKVRGIGWGWAGVIWLYSIVTYFPQDIFKFAIRYILS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SYRELSEI
Sbjct  847  GKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  907  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PGHYTV  948



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L  AF+IAQL+ATL+AVYANW FARI+GCGWGWAG++WLYS++ +IPLD +KFAIRY+LS
Sbjct  792  LCCAFVIAQLIATLVAVYANWSFARIKGCGWGWAGIIWLYSLISFIPLDWIKFAIRYVLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G AW  L E KTAFTTKKDYG+EEREAQWA AQRTLHGLQPP+ ++LF++K+SYRELSEI
Sbjct  852  GNAWTYLFERKTAFTTKKDYGREEREAQWAIAQRTLHGLQPPDTTSLFNDKSSYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDI+T+QQHYT+
Sbjct  912  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  954



>ref|NP_194748.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 sp|P19456.2|PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type; AltName: Full=Proton 
pump 2 [Arabidopsis thaliana]
 gb|AAA32751.1| H+-ATPase [Arabidopsis thaliana]
 emb|CAB52463.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 emb|CAB81012.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 gb|AAK59580.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AAN31920.1| putative H+-transporting ATPase type 2 [Arabidopsis thaliana]
 gb|AAN71968.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE85731.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=948

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANW FA+I+G GWGWAGV+WLYSIV Y PLD+ KFAIRYILS
Sbjct  787  LMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFAIRYILS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SYRELSEI
Sbjct  847  GKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  907  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  948



>ref|XP_006282542.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
 gb|EOA15440.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
Length=948

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANW FA+I+G GWGWAGV+WLYSIV Y PLD+ KFAIRYILS
Sbjct  787  LMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFAIRYILS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SYRELSEI
Sbjct  847  GKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  907  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  948



>dbj|BAJ34124.1| unnamed protein product [Thellungiella halophila]
Length=948

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANWGFA+++G GWGWAGV+WLYSIV Y P DI KFAIRYILS
Sbjct  787  LMIAFLIAQLIATLIAVYANWGFAKVRGIGWGWAGVIWLYSIVTYFPQDIFKFAIRYILS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SYRELSEI
Sbjct  847  GKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  907  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PGHYTV  948



>ref|NP_001190870.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 gb|AEE85732.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=981

 Score =   286 bits (731),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQL+ATLIAVYANW FA+I+G GWGWAGV+WLYSIV Y PLD+ KFAIRYILS
Sbjct  820  LMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFAIRYILS  879

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SYRELSEI
Sbjct  880  GKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSYRELSEI  939

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  940  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  981



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   285 bits (730),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+ AQLVAT+IAVYA+W FARIQG GWGWA  +W+YS++ YIPLDI+KF  RY+LS
Sbjct  788  LVTAFIAAQLVATVIAVYASWSFARIQGIGWGWAAFIWVYSVITYIPLDILKFITRYVLS  847

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFT+KKDYG+ EREAQWA AQRTLHGLQ P+ S LF++KNSYRELSEI
Sbjct  848  GKAWDNLLQNKTAFTSKKDYGRGEREAQWAMAQRTLHGLQSPDTSALFNDKNSYRELSEI  907

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  908  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>gb|KFK42449.1| hypothetical protein AALP_AA2G258100 [Arabis alpina]
Length=953

 Score =   285 bits (730),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF +AQLVA+LIAVYANW FARI+G GWGWAGV+WLYSIV YIPLDI+KF IRY LS
Sbjct  791  LVAAFFVAQLVASLIAVYANWNFARIRGIGWGWAGVIWLYSIVTYIPLDILKFIIRYSLS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW N++ENKTAFT+KKDYGK EREAQWA AQRTLHGLQPP+ S++F++K++YRELSEI
Sbjct  851  GRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQPPQTSDMFNDKSTYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            A+QAKRRAEVARLRE HTLKGHVESVVK KGLDIE IQQHYTL
Sbjct  911  ADQAKRRAEVARLRECHTLKGHVESVVKQKGLDIEAIQQHYTL  953



>gb|AAQ19039.1| P-type H+-ATPase [Vicia faba]
Length=370

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVAT IAVYANWGFARI+G GWGWAGV+W+YS+V Y PLDI+KF IRY+LS
Sbjct  222  LLGAFMIAQLVATFIAVYANWGFARIKGMGWGWAGVIWVYSLVTYFPLDILKFVIRYVLS  281

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PE +NLF++KNSYRELSEI
Sbjct  282  GKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPETTNLFNDKNSYRELSEI  341

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKL  241
            AEQAKRRAEVARLRELHTLKGHVESVVKL
Sbjct  342  AEQAKRRAEVARLRELHTLKGHVESVVKL  370



>gb|EPS59184.1| hypothetical protein M569_15622, partial [Genlisea aurea]
Length=522

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AFL AQL+ATLIAVYANWGFA+IQG GWGWAGV+WLY+I+FYIPLD+ KF IRY LS
Sbjct  360  LVFAFLAAQLIATLIAVYANWGFAKIQGIGWGWAGVIWLYNIIFYIPLDVFKFIIRYALS  419

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW ++LENK AFT+KKDYG+ EREAQWA AQRTLHGLQ P  S LF +K++YRELSEI
Sbjct  420  GKAWNHMLENKIAFTSKKDYGRGEREAQWAMAQRTLHGLQAPNTSELFHDKSNYRELSEI  479

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQA +RAEVARLRELHTLKGHVESVVK KGLDI+TIQQHYT+
Sbjct  480  AEQAMKRAEVARLRELHTLKGHVESVVKRKGLDIDTIQQHYTV  522



>ref|NP_001185450.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 gb|AEE36434.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=945

 Score =   285 bits (728),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF +AQL+ATLIAVYANW FARI+G GWGWAGV+WLYSIVFYIPLDI+KF IRY LS
Sbjct  783  LISAFFMAQLIATLIAVYANWNFARIRGIGWGWAGVIWLYSIVFYIPLDILKFIIRYSLS  842

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW N++ENKTAFT+KKDYGK EREAQWA AQRTLHGLQP + S++F++K++YRELSEI
Sbjct  843  GRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQPAQTSDMFNDKSTYRELSEI  902

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            A+QAKRRAEVARLRE HTLKGHVESVVK KGLDIE IQQHYTL
Sbjct  903  ADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  945



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   285 bits (728),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LVTAF+ AQLVAT+IA YA+WGFARIQG GWGWAG++WL+S+V Y PLD++KF IRY LS
Sbjct  794  LVTAFIAAQLVATVIAAYASWGFARIQGIGWGWAGIIWLFSLVTYFPLDVLKFIIRYTLS  853

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLENKTAFTTKKDYG+ EREAQWA AQRTLHGLQP +   LF++K+SYRELSEI
Sbjct  854  GKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLQPADTPGLFNDKSSYRELSEI  913

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  914  AEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   285 bits (728),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF+IAQLVATLIAVYA+W FARI+G GWGWAGV+WLYSIVF++PLD  KFAIRYILS
Sbjct  792  LVSAFMIAQLVATLIAVYADWSFARIKGVGWGWAGVIWLYSIVFFVPLDWFKFAIRYILS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLLE KTAFT+KKDYG+EEREAQWA AQRTLHGLQP E S LFSEK+SY ELSEI
Sbjct  852  GKAWDNLLERKTAFTSKKDYGREEREAQWATAQRTLHGLQPRETSTLFSEKSSYHELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+A+LREL+TLKGHVESVVKLKGLDI TIQQ YT+
Sbjct  912  AEQAKRRAEIAKLRELNTLKGHVESVVKLKGLDINTIQQSYTV  954



>ref|XP_009607951.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana tomentosiformis]
Length=954

 Score =   285 bits (728),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVAT+IAVYANWGFARI G GWGWAGV+WLYSI+FYIPLDI+KFAIRY LS
Sbjct  793  LLAAFVIAQLVATIIAVYANWGFARIHGIGWGWAGVIWLYSIIFYIPLDILKFAIRYTLS  852

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW N++ENK AFT+KKDYG+ EREAQWA AQRTLHGLQP ++S +F  K SY ELSEI
Sbjct  853  GRAWNNMMENKVAFTSKKDYGRGEREAQWALAQRTLHGLQPSDSSQVFDNK-SYMELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|NP_178181.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 sp|Q42556.2|PMA9_ARATH RecName: Full=ATPase 9, plasma membrane-type; AltName: Full=Proton 
pump 9 [Arabidopsis thaliana]
 gb|AAF14653.1|AC011713_1 Identical to gb|X73676 aha9 (ATAHA9) ATPase gene from Arabidopsis 
thaliana [Arabidopsis thaliana]
 gb|AEE36433.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=954

 Score =   285 bits (728),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L++AF +AQL+ATLIAVYANW FARI+G GWGWAGV+WLYSIVFYIPLDI+KF IRY LS
Sbjct  792  LISAFFMAQLIATLIAVYANWNFARIRGIGWGWAGVIWLYSIVFYIPLDILKFIIRYSLS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW N++ENKTAFT+KKDYGK EREAQWA AQRTLHGLQP + S++F++K++YRELSEI
Sbjct  852  GRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQPAQTSDMFNDKSTYRELSEI  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            A+QAKRRAEVARLRE HTLKGHVESVVK KGLDIE IQQHYTL
Sbjct  912  ADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  954



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   282 bits (722),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  660  LVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILSGKAWLNLLE  481
            +VATLIAVYA WGFARI+G GWGWAGV+WLYS+V Y+PLDI+KFAIRYILSG+AW +LLE
Sbjct  662  VVATLIAVYAEWGFARIKGTGWGWAGVIWLYSLVTYVPLDILKFAIRYILSGRAWNSLLE  721

Query  480  NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEIAEQAKRRAE  301
            NKTAFT+KKDYGKEEREAQWA AQRTLHGLQPPE SN  S+K SYRELSEIAEQAKRRAE
Sbjct  722  NKTAFTSKKDYGKEEREAQWATAQRTLHGLQPPETSNQKSDKGSYRELSEIAEQAKRRAE  781

Query  300  VARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            VARLRELHTLKGHVESVVKLKGLDI++IQQHYT 
Sbjct  782  VARLRELHTLKGHVESVVKLKGLDIDSIQQHYTF  815



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF +AQL+ATLIAVYANWGFARI G GWGWAGV+WLYSI+ Y PLDI KF +RY LS
Sbjct  792  LLFAFAVAQLIATLIAVYANWGFARISGIGWGWAGVIWLYSIITYSPLDIFKFIVRYALS  851

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  LL+NKTAFT+KKDYGK EREAQWA AQRTLHGLQPPE+S +F++K +YREL+E+
Sbjct  852  GKAWDTLLQNKTAFTSKKDYGKGEREAQWALAQRTLHGLQPPESSQIFNDKTNYRELTEL  911

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  912  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF+ AQLVAT+IAVYA+W FARIQG GWGWAG++WL+S++ Y PLDI+KF IRY LS
Sbjct  787  LVAAFVAAQLVATVIAVYASWSFARIQGIGWGWAGIIWLFSLITYFPLDILKFIIRYALS  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYG+ EREAQWA AQRTLHGLQP + S+LF++K+SYRELSEI
Sbjct  847  GKAWDNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPADTSDLFNDKSSYRELSEI  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYT+
Sbjct  907  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>gb|KJB56561.1| hypothetical protein B456_009G125200 [Gossypium raimondii]
Length=953

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV AF++AQLVAT++AVYANWGFARI+G GW WAGV+WLYSIVFYIPLD++KF IRY LS
Sbjct  791  LVVAFILAQLVATVLAVYANWGFARIKGIGWPWAGVIWLYSIVFYIPLDVLKFLIRYALS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW NLL+NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ P A  + +EK+SYRELSEI
Sbjct  851  GKAWDNLLQNKTAFTTKKDYGREEREAQWATAQRTLHGLQAPGAEEILNEKSSYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAEVARLRELHTLKGHV+SVVKLKGLDIETI Q+YT+
Sbjct  911  AEQAKKRAEVARLRELHTLKGHVDSVVKLKGLDIETINQNYTV  953



>ref|XP_009109000.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
Length=947

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVATLIAVYANW FA+++G GWGWAGV+WLYSIV Y P DI KFAIRYILS
Sbjct  786  LMVAFLIAQLVATLIAVYANWEFAKVRGIGWGWAGVIWLYSIVTYFPQDIFKFAIRYILS  845

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SYRELSEI
Sbjct  846  GKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSYRELSEI  905

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  906  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-SGHYTV  947



>emb|CDX76810.1| BnaC08g33960D [Brassica napus]
Length=854

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF+IAQLVATLIAVYANW FARI+G GWGWAGV+WLYS+V YIPLD++KF IRY+LS
Sbjct  692  LLGAFVIAQLVATLIAVYANWNFARIEGAGWGWAGVIWLYSLVTYIPLDLLKFLIRYVLS  751

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNLLENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E + +F+EKN Y ELSEI
Sbjct  752  GKAWLNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPRETNIIFNEKNCYSELSEI  811

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAEVARLREL TL G VESVVKL GLDI+ IQQHYT+
Sbjct  812  AEQAKRRAEVARLRELSTLTGQVESVVKLGGLDIDAIQQHYTV  854



>emb|CDY14186.1| BnaA08g13170D [Brassica napus]
Length=939

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AFLIAQLVATLIAVYANW FA+++G GWGWAGV+WLYSIV Y P DI KFAIRYILS
Sbjct  778  LMVAFLIAQLVATLIAVYANWEFAKVRGIGWGWAGVIWLYSIVTYFPQDIFKFAIRYILS  837

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAWLNL ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP EA N+F EK SYRELSEI
Sbjct  838  GKAWLNLFENKTAFTMKKDYGKEEREAQWALAQRTLHGLQPKEAVNIFPEKGSYRELSEI  897

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAKRRAE+ARLRELHTLKGHVESVVKLKGLDIET   HYT+
Sbjct  898  AEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIET-SGHYTV  939



>ref|XP_006389820.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
 gb|ESQ27106.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
Length=953

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            LV+AF IAQL+ATLIAVYANW FARI+G GWGWAGV+WLYSIV YIPLDI+KF IRY LS
Sbjct  791  LVSAFFIAQLIATLIAVYANWNFARIRGIGWGWAGVIWLYSIVTYIPLDILKFIIRYSLS  850

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            G+AW N++ENKTAFT+KKDYGK EREAQWA AQRTLHGLQ P+ S++F++K++YRELSEI
Sbjct  851  GRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQSPQTSDMFNDKSTYRELSEI  910

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            A+QAKRRAEVARLRE HTLKGHVESVVK KGLDIE IQQHYTL
Sbjct  911  ADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  953



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   283 bits (723),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  687  LVTAFLIAQLVATLIAVYANWGFARIQGCGWGWAGVVWLYSIVFYIPLDIMKFAIRYILS  508
            L+ AF IAQL+ATLIAVYANWGFA+++G GWGWAGV+WLYSIVFYIP+DI+KF IRY L+
Sbjct  787  LLVAFFIAQLIATLIAVYANWGFAKMKGIGWGWAGVIWLYSIVFYIPMDILKFIIRYALT  846

Query  507  GKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPEASNLFSEKNSYRELSEI  328
            GKAW  + EN+ AFTTKKDYGK EREAQWA AQRTLHGL PPE   + +EKN+YRELSE+
Sbjct  847  GKAWNTITENRVAFTTKKDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSEL  906

Query  327  AEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTL  199
            AEQAK+RAEVARLRELHTLKGHVESVVKLKGLDIET+QQHYT+
Sbjct  907  AEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  949



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700