BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF019G16

Length=105
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010100865.1|  Heparanase-like protein 3                        61.2    2e-09   
gb|KDO73427.1|  hypothetical protein CISIN_1g008762mg                 60.1    4e-09   Citrus sinensis [apfelsine]
gb|KDO73428.1|  hypothetical protein CISIN_1g008762mg                 60.1    4e-09   Citrus sinensis [apfelsine]
ref|XP_006453123.1|  hypothetical protein CICLE_v10007919mg           60.1    5e-09   Citrus clementina [clementine]
gb|KDP33563.1|  hypothetical protein JCGZ_07134                       59.3    9e-09   Jatropha curcas
ref|XP_006359499.1|  PREDICTED: heparanase-like protein 3-like        58.9    1e-08   Solanum tuberosum [potatoes]
ref|XP_006389405.1|  hypothetical protein POPTR_0025s00410g           58.9    1e-08   
gb|EYU20239.1|  hypothetical protein MIMGU_mgv1a026019mg              58.5    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_011020240.1|  PREDICTED: heparanase-like protein 3             58.5    2e-08   Populus euphratica
ref|XP_006381083.1|  hypothetical protein POPTR_0006s06100g           58.5    2e-08   
ref|XP_006381082.1|  hypothetical protein POPTR_0006s06100g           58.5    2e-08   
ref|XP_010687865.1|  PREDICTED: heparanase-like protein 3             57.8    3e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004242732.1|  PREDICTED: heparanase-like protein 3             57.8    3e-08   Solanum lycopersicum
ref|XP_009757548.1|  PREDICTED: heparanase-like protein 3             57.4    3e-08   Nicotiana sylvestris
gb|ACJ85694.1|  unknown                                               55.1    4e-08   Medicago truncatula
emb|CBI25561.3|  unnamed protein product                              57.4    4e-08   Vitis vinifera
ref|XP_010648741.1|  PREDICTED: heparanase-like protein 3             57.4    5e-08   Vitis vinifera
gb|AFK44771.1|  unknown                                               54.7    5e-08   Medicago truncatula
ref|XP_002263173.1|  PREDICTED: heparanase-like protein 3             57.0    5e-08   Vitis vinifera
ref|XP_009625836.1|  PREDICTED: heparanase-like protein 3             57.0    5e-08   Nicotiana tomentosiformis
emb|CAN81917.1|  hypothetical protein VITISV_038549                   57.0    5e-08   Vitis vinifera
emb|CBI21126.3|  unnamed protein product                              57.4    6e-08   Vitis vinifera
ref|XP_007138475.1|  hypothetical protein PHAVU_009G212400g           57.0    6e-08   Phaseolus vulgaris [French bean]
gb|AFK40288.1|  unknown                                               56.6    6e-08   Lotus japonicus
ref|XP_011017900.1|  PREDICTED: heparanase-like protein 3 isoform X1  56.6    7e-08   Populus euphratica
ref|XP_002283260.2|  PREDICTED: heparanase-like protein 3             56.6    7e-08   
ref|XP_008394121.1|  PREDICTED: heparanase-like protein 3 isoform X2  56.6    8e-08   Malus domestica [apple tree]
ref|XP_009355782.1|  PREDICTED: heparanase-like protein 3             56.6    8e-08   Pyrus x bretschneideri [bai li]
ref|XP_008394120.1|  PREDICTED: heparanase-like protein 3 isoform X1  56.6    8e-08   Malus domestica [apple tree]
ref|XP_002515478.1|  heparanase, putative                             56.2    9e-08   
ref|XP_007203617.1|  hypothetical protein PRUPE_ppa003883mg           56.2    1e-07   Prunus persica
ref|XP_008242878.1|  PREDICTED: heparanase-like protein 3             55.8    1e-07   Prunus mume [ume]
ref|XP_009363939.1|  PREDICTED: heparanase-like protein 3             55.8    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_009338385.1|  PREDICTED: heparanase-like protein 3             55.8    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_009358543.1|  PREDICTED: heparanase-like protein 3             55.8    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_008336960.1|  PREDICTED: heparanase-like protein 3             55.8    1e-07   
ref|XP_008385022.1|  PREDICTED: heparanase-like protein 3             55.8    1e-07   
ref|XP_011459847.1|  PREDICTED: heparanase-like protein 3             55.5    1e-07   Fragaria vesca subsp. vesca
ref|XP_002533671.1|  heparanase, putative                             55.8    1e-07   Ricinus communis
ref|XP_004159389.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...  55.8    1e-07   
gb|KJB64649.1|  hypothetical protein B456_010G059600                  55.8    1e-07   Gossypium raimondii
ref|XP_004139281.1|  PREDICTED: heparanase-like protein 3-like        55.8    1e-07   Cucumis sativus [cucumbers]
gb|KJB64651.1|  hypothetical protein B456_010G059600                  55.5    2e-07   Gossypium raimondii
ref|XP_006483406.1|  PREDICTED: heparanase-like protein 3-like is...  55.5    2e-07   Citrus sinensis [apfelsine]
ref|XP_003546578.1|  PREDICTED: heparanase-like protein 3-like        55.1    2e-07   Glycine max [soybeans]
ref|XP_004488517.1|  PREDICTED: heparanase-like protein 3-like        55.1    3e-07   Cicer arietinum [garbanzo]
ref|XP_003533856.1|  PREDICTED: heparanase-like protein 3-like        55.1    3e-07   Glycine max [soybeans]
gb|KHG18442.1|  hypothetical protein F383_07597                       54.7    3e-07   Gossypium arboreum [tree cotton]
ref|XP_007013614.1|  Glucuronidase 3 isoform 2                        54.7    4e-07   
ref|XP_010533116.1|  PREDICTED: heparanase-like protein 3             54.7    4e-07   Tarenaya hassleriana [spider flower]
gb|KDP30214.1|  hypothetical protein JCGZ_16996                       54.7    4e-07   Jatropha curcas
gb|KJB23650.1|  hypothetical protein B456_004G108900                  54.3    4e-07   Gossypium raimondii
ref|XP_007013613.1|  Glucuronidase 3 isoform 1                        54.7    4e-07   
gb|KJB23649.1|  hypothetical protein B456_004G108900                  54.3    4e-07   Gossypium raimondii
gb|KHG18266.1|  hypothetical protein F383_21213                       54.3    5e-07   Gossypium arboreum [tree cotton]
ref|XP_009108062.1|  PREDICTED: heparanase-like protein 3             53.9    6e-07   Brassica rapa
emb|CDY47561.1|  BnaA08g07260D                                        53.9    6e-07   Brassica napus [oilseed rape]
gb|KEH37925.1|  glycoside hydrolase family 79 amino-terminal doma...  53.9    6e-07   Medicago truncatula
ref|XP_002324878.2|  hypothetical protein POPTR_0018s02050g           53.9    6e-07   
ref|XP_011036603.1|  PREDICTED: heparanase-like protein 3 isoform X1  53.9    6e-07   Populus euphratica
ref|XP_011036604.1|  PREDICTED: heparanase-like protein 3 isoform X2  53.9    7e-07   Populus euphratica
gb|EPS66918.1|  hypothetical protein M569_07858                       53.9    7e-07   Genlisea aurea
emb|CDP10485.1|  unnamed protein product                              53.9    7e-07   Coffea canephora [robusta coffee]
ref|XP_011081531.1|  PREDICTED: heparanase-like protein 3             53.5    8e-07   Sesamum indicum [beniseed]
ref|XP_010250274.1|  PREDICTED: heparanase-like protein 3             53.5    9e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008457259.1|  PREDICTED: LOW QUALITY PROTEIN: heparanase-l...  53.1    1e-06   Cucumis melo [Oriental melon]
gb|EYU34947.1|  hypothetical protein MIMGU_mgv1a004017mg              53.1    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_006283483.1|  hypothetical protein CARUB_v10004531mg           53.1    1e-06   Capsella rubella
gb|AAC62794.1|  T2L5.6 gene product                                   50.8    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010099859.1|  Heparanase-like protein 3                        52.8    1e-06   Morus notabilis
ref|XP_009409980.1|  PREDICTED: heparanase-like protein 3             52.8    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435392.1|  PREDICTED: heparanase-like protein 3             51.6    2e-06   
emb|CDY12398.1|  BnaC08g08070D                                        52.4    2e-06   Brassica napus [oilseed rape]
ref|XP_009623092.1|  PREDICTED: heparanase-like protein 3             52.0    3e-06   Nicotiana tomentosiformis
ref|XP_008219535.1|  PREDICTED: heparanase-like protein 3 isoform X2  51.6    4e-06   Prunus mume [ume]
ref|XP_008219534.1|  PREDICTED: heparanase-like protein 3 isoform X1  51.6    4e-06   Prunus mume [ume]
ref|XP_010440690.1|  PREDICTED: heparanase-like protein 3             51.6    4e-06   Camelina sativa [gold-of-pleasure]
gb|KFK22707.1|  hypothetical protein AALP_AAs49083U000200             51.6    4e-06   Arabis alpina [alpine rockcress]
ref|XP_006338978.1|  PREDICTED: heparanase-like protein 3-like        51.2    5e-06   Solanum tuberosum [potatoes]
ref|XP_010450341.1|  PREDICTED: heparanase-like protein 3             51.2    6e-06   Camelina sativa [gold-of-pleasure]
gb|AFW77131.1|  hypothetical protein ZEAMMB73_462319                  50.4    6e-06   
ref|XP_008793957.1|  PREDICTED: heparanase-like protein 3             50.8    6e-06   Phoenix dactylifera
ref|XP_007011804.1|  Glucuronidase 3 isoform 2                        50.8    6e-06   
ref|XP_007224283.1|  hypothetical protein PRUPE_ppa019445mg           50.8    6e-06   
ref|XP_011457618.1|  PREDICTED: heparanase-like protein 3             50.8    7e-06   Fragaria vesca subsp. vesca
ref|NP_851092.1|  glucuronidase 3                                     50.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004249602.1|  PREDICTED: heparanase-like protein 3             50.8    7e-06   Solanum lycopersicum
ref|NP_851093.1|  glucuronidase 3                                     50.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007011803.1|  Glucuronidase 3 isoform 1                        50.8    7e-06   
dbj|BAB10787.1|  unnamed protein product                              50.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870409.1|  glycosyl hydrolase family 79 N-terminal doma...  50.8    8e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010906003.1|  PREDICTED: heparanase-like protein 3             50.8    8e-06   Elaeis guineensis
ref|XP_009792771.1|  PREDICTED: heparanase-like protein 3 isoform X1  50.8    8e-06   Nicotiana sylvestris
ref|XP_009792772.1|  PREDICTED: heparanase-like protein 3 isoform X2  50.8    8e-06   Nicotiana sylvestris
ref|XP_002452991.1|  hypothetical protein SORBIDRAFT_04g036200        50.4    9e-06   Sorghum bicolor [broomcorn]
ref|XP_006450373.1|  hypothetical protein CICLE_v10010401mg           50.4    1e-05   
ref|XP_008647414.1|  PREDICTED: uncharacterized protein LOC100193...  50.4    1e-05   Zea mays [maize]
ref|XP_010665516.1|  PREDICTED: heparanase-like protein 3 isoform X2  50.4    1e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|ACF81144.1|  unknown                                               50.4    1e-05   Zea mays [maize]
ref|XP_010665510.1|  PREDICTED: heparanase-like protein 3 isoform X1  50.4    1e-05   
ref|NP_001132339.1|  uncharacterized protein LOC100193781 precursor   50.4    1e-05   
ref|XP_008647415.1|  PREDICTED: uncharacterized protein LOC100193...  50.1    1e-05   
ref|XP_007155083.1|  hypothetical protein PHAVU_003G171800g           50.1    1e-05   Phaseolus vulgaris [French bean]
ref|XP_007155084.1|  hypothetical protein PHAVU_003G171800g           50.1    1e-05   Phaseolus vulgaris [French bean]
ref|NP_001241969.1|  uncharacterized protein LOC100792087 precursor   50.1    1e-05   
gb|KHN15030.1|  Heparanase-like protein 3                             50.1    1e-05   Glycine soja [wild soybean]
ref|XP_006655848.1|  PREDICTED: heparanase-like protein 3-like        49.7    1e-05   Oryza brachyantha
ref|XP_003561019.1|  PREDICTED: heparanase-like protein 3             50.1    1e-05   Brachypodium distachyon [annual false brome]
ref|XP_003609474.1|  Heparanase-like protein                          49.7    2e-05   Medicago truncatula
gb|KCW81358.1|  hypothetical protein EUGRSUZ_C02740                   49.7    2e-05   Eucalyptus grandis [rose gum]
ref|XP_010048934.1|  PREDICTED: heparanase-like protein 3 isoform X2  49.7    2e-05   Eucalyptus grandis [rose gum]
gb|KJB27355.1|  hypothetical protein B456_004G293000                  49.7    2e-05   Gossypium raimondii
gb|KJB27356.1|  hypothetical protein B456_004G293000                  49.3    2e-05   Gossypium raimondii
emb|CDP13545.1|  unnamed protein product                              49.3    2e-05   Coffea canephora [robusta coffee]
gb|KCW81361.1|  hypothetical protein EUGRSUZ_C02742                   49.3    2e-05   Eucalyptus grandis [rose gum]
ref|XP_004964694.1|  PREDICTED: heparanase-like protein 3-like        49.3    3e-05   Setaria italica
ref|XP_002437942.1|  hypothetical protein SORBIDRAFT_10g005260        48.9    3e-05   Sorghum bicolor [broomcorn]
ref|NP_001152083.1|  heparanase-like protein 3 precursor              48.9    3e-05   
dbj|BAJ89245.1|  predicted protein                                    48.9    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010048933.1|  PREDICTED: heparanase-like protein 3 isoform X1  48.9    3e-05   Eucalyptus grandis [rose gum]
ref|XP_004954253.1|  PREDICTED: heparanase-like protein 3-like        48.9    3e-05   Setaria italica
gb|EMS60649.1|  Heparanase-like protein 3                             48.9    3e-05   Triticum urartu
gb|AFW73900.1|  hypothetical protein ZEAMMB73_176333                  48.9    3e-05   
ref|XP_008801894.1|  PREDICTED: heparanase-like protein 3 isoform X2  48.9    4e-05   
ref|NP_001183276.1|  uncharacterized protein LOC100501670 precursor   48.9    4e-05   
ref|XP_008658727.1|  PREDICTED: heparanase-like protein 3 isoform X1  48.9    4e-05   
ref|XP_008801893.1|  PREDICTED: heparanase-like protein 3 isoform X1  48.9    4e-05   Phoenix dactylifera
emb|CDP14477.1|  unnamed protein product                              45.8    4e-05   Coffea canephora [robusta coffee]
ref|NP_001048420.1|  Os02g0802200                                     48.5    4e-05   
gb|EAY87898.1|  hypothetical protein OsI_09318                        48.5    4e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010048938.1|  PREDICTED: heparanase-like protein 3 isoform X2  48.5    4e-05   Eucalyptus grandis [rose gum]
gb|EYU40129.1|  hypothetical protein MIMGU_mgv1a025097mg              47.8    5e-05   Erythranthe guttata [common monkey flower]
ref|XP_003570329.1|  PREDICTED: heparanase-like protein 3             48.5    5e-05   Brachypodium distachyon [annual false brome]
ref|XP_010048937.1|  PREDICTED: heparanase-like protein 3 isoform X1  48.5    5e-05   Eucalyptus grandis [rose gum]
emb|CDP16528.1|  unnamed protein product                              45.4    5e-05   Coffea canephora [robusta coffee]
ref|XP_006648064.1|  PREDICTED: heparanase-like protein 3-like        48.1    6e-05   Oryza brachyantha
ref|XP_006403100.1|  hypothetical protein EUTSA_v10003449mg           48.1    6e-05   
gb|EMT25528.1|  Heparanase-like protein 3                             47.8    8e-05   
ref|XP_003542659.1|  PREDICTED: heparanase-like protein 3-like        47.8    1e-04   Glycine max [soybeans]
ref|XP_010927354.1|  PREDICTED: heparanase-like protein 3 isoform X2  47.4    1e-04   
gb|KCW81359.1|  hypothetical protein EUGRSUZ_C02741                   47.4    1e-04   Eucalyptus grandis [rose gum]
gb|KCW83013.1|  hypothetical protein EUGRSUZ_C04395                   47.0    1e-04   Eucalyptus grandis [rose gum]
ref|XP_010927353.1|  PREDICTED: heparanase-like protein 3 isoform X1  47.4    1e-04   Elaeis guineensis
gb|ABR16706.1|  unknown                                               46.6    2e-04   Picea sitchensis
gb|KDO61807.1|  hypothetical protein CISIN_1g037212mg                 47.0    2e-04   Citrus sinensis [apfelsine]
gb|EYU38304.1|  hypothetical protein MIMGU_mgv1a011158mg              46.2    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_010050122.1|  PREDICTED: heparanase-like protein 3             47.0    2e-04   Eucalyptus grandis [rose gum]
ref|XP_004508419.1|  PREDICTED: heparanase-like protein 3-like        47.0    2e-04   Cicer arietinum [garbanzo]
ref|XP_002512115.1|  conserved hypothetical protein                   45.4    2e-04   
ref|XP_011078541.1|  PREDICTED: heparanase-like protein 3             46.6    2e-04   Sesamum indicum [beniseed]
ref|XP_007157579.1|  hypothetical protein PHAVU_002G081000g           46.6    2e-04   Phaseolus vulgaris [French bean]
gb|EAZ26032.1|  hypothetical protein OsJ_09885                        46.2    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|KCW86528.1|  hypothetical protein EUGRSUZ_B03174                   46.2    3e-04   Eucalyptus grandis [rose gum]
ref|NP_001049350.1|  Os03g0211700                                     46.2    3e-04   
ref|XP_010046621.1|  PREDICTED: heparanase-like protein 2             46.2    3e-04   Eucalyptus grandis [rose gum]
ref|XP_009399121.1|  PREDICTED: heparanase-like protein 1             45.8    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006852836.1|  hypothetical protein AMTR_s00033p00188330        45.8    4e-04   
ref|NP_001067122.1|  Os12g0578400                                     45.8    4e-04   
gb|ACR10240.1|  heparanase                                            45.8    4e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010688437.1|  PREDICTED: heparanase-like protein 3             45.1    6e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010048935.1|  PREDICTED: heparanase-like protein 3             45.1    7e-04   Eucalyptus grandis [rose gum]
ref|XP_003558511.1|  PREDICTED: heparanase-like protein 1             45.1    8e-04   Brachypodium distachyon [annual false brome]
ref|XP_008785953.1|  PREDICTED: heparanase-like protein 2 isoform X2  44.7    9e-04   Phoenix dactylifera
ref|XP_008785952.1|  PREDICTED: heparanase-like protein 2 isoform X1  44.7    9e-04   Phoenix dactylifera
gb|EAY99897.1|  hypothetical protein OsI_21892                        44.7    9e-04   Oryza sativa Indica Group [Indian rice]
gb|EMS65630.1|  Heparanase-like protein 3                             44.7    9e-04   Triticum urartu
ref|NP_001056967.1|  Os06g0179000                                     44.7    0.001   
gb|EAZ36024.1|  hypothetical protein OsJ_20330                        44.7    0.001   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009783167.1|  PREDICTED: heparanase-like protein 2             44.7    0.001   Nicotiana sylvestris
ref|XP_009612848.1|  PREDICTED: heparanase-like protein 2             44.7    0.001   Nicotiana tomentosiformis
dbj|BAJ97884.1|  predicted protein                                    44.7    0.001   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ84826.1|  predicted protein                                    44.7    0.001   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96463.1|  predicted protein                                    44.7    0.001   Hordeum vulgare subsp. vulgare [two-rowed barley]



>ref|XP_010100865.1| Heparanase-like protein 3 [Morus notabilis]
 gb|EXB85444.1| Heparanase-like protein 3 [Morus notabilis]
Length=534

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRNA STS SGTKKIRAYAH
Sbjct  368  PNPDYYSALLWHRLMGRNALSTSFSGTKKIRAYAH  402



>gb|KDO73427.1| hypothetical protein CISIN_1g008762mg [Citrus sinensis]
Length=554

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRNA STS SGTKKIR+YAH
Sbjct  396  PNPDYYSALLWHRLMGRNALSTSFSGTKKIRSYAH  430



>gb|KDO73428.1| hypothetical protein CISIN_1g008762mg [Citrus sinensis]
Length=547

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRNA STS SGTKKIR+YAH
Sbjct  389  PNPDYYSALLWHRLMGRNALSTSFSGTKKIRSYAH  423



>ref|XP_006453123.1| hypothetical protein CICLE_v10007919mg [Citrus clementina]
 ref|XP_006474380.1| PREDICTED: heparanase-like protein 3-like [Citrus sinensis]
 gb|ESR66363.1| hypothetical protein CICLE_v10007919mg [Citrus clementina]
Length=547

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRNA STS SGTKKIR+YAH
Sbjct  389  PNPDYYSALLWHRLMGRNALSTSFSGTKKIRSYAH  423



>gb|KDP33563.1| hypothetical protein JCGZ_07134 [Jatropha curcas]
Length=539

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRNA STS SGT KIRAYAH
Sbjct  377  PNPDYYSALLWHRLMGRNALSTSFSGTNKIRAYAH  411



>ref|XP_006359499.1| PREDICTED: heparanase-like protein 3-like [Solanum tuberosum]
Length=536

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +TS SGTKKIRAYAH
Sbjct  374  PNPDYYSALLWHRLMGRNVLATSFSGTKKIRAYAH  408



>ref|XP_006389405.1| hypothetical protein POPTR_0025s00410g [Populus trichocarpa]
 gb|ERP48319.1| hypothetical protein POPTR_0025s00410g [Populus trichocarpa]
Length=547

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS SGTKKIRAY H
Sbjct  387  PNPDYYSALLWHRLMGRNVLSTSFSGTKKIRAYTH  421



>gb|EYU20239.1| hypothetical protein MIMGU_mgv1a026019mg [Erythranthe guttata]
Length=544

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS  GTKKIRAYAH
Sbjct  377  PNPDYYSALLWHRLMGRNVLSTSFEGTKKIRAYAH  411



>ref|XP_011020240.1| PREDICTED: heparanase-like protein 3 [Populus euphratica]
Length=559

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS SGTKKIRAY H
Sbjct  387  PNPDYYSALLWHRLMGRNVLSTSFSGTKKIRAYTH  421



>ref|XP_006381083.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
 gb|ERP58880.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
Length=562

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS SGTKKIRAY H
Sbjct  387  PNPDYYSALLWHRLMGRNVLSTSFSGTKKIRAYTH  421



>ref|XP_006381082.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
 gb|ERP58879.1| hypothetical protein POPTR_0006s06100g [Populus trichocarpa]
Length=554

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS SGTKKIRAY H
Sbjct  379  PNPDYYSALLWHRLMGRNVLSTSFSGTKKIRAYTH  413



>ref|XP_010687865.1| PREDICTED: heparanase-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=546

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW +LMGRN  STS SGTKK+RAYAH
Sbjct  382  PNPDYYSALLWHKLMGRNVLSTSFSGTKKVRAYAH  416



>ref|XP_004242732.1| PREDICTED: heparanase-like protein 3 [Solanum lycopersicum]
Length=536

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +TS SGTKK+RAYAH
Sbjct  374  PNPDYYSALLWHRLMGRNVLATSFSGTKKLRAYAH  408



>ref|XP_009757548.1| PREDICTED: heparanase-like protein 3 [Nicotiana sylvestris]
Length=538

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  ST+ SG+KKIRAYAH
Sbjct  376  PNPDYYSALLWHRLMGRNVLSTTFSGSKKIRAYAH  410



>gb|ACJ85694.1| unknown [Medicago truncatula]
Length=176

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR   ST+ SGT KIRAYAH
Sbjct  30   PNPDYYSALLWHRLMGRGVLSTTFSGTNKIRAYAH  64



>emb|CBI25561.3| unnamed protein product [Vitis vinifera]
Length=533

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS SG KKIRAYAH
Sbjct  375  PNPDYYSALLWHRLMGRNVLSTSFSGPKKIRAYAH  409



>ref|XP_010648741.1| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=567

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS +GTKKIRAY+H
Sbjct  383  PNPDYYSALLWHRLMGRNVLSTSFNGTKKIRAYSH  417



>gb|AFK44771.1| unknown [Medicago truncatula]
Length=186

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR   ST+ SGT KIRAYAH
Sbjct  30   PNPDYYSALLWHRLMGRGVLSTTFSGTNKIRAYAH  64



>ref|XP_002263173.1| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=559

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS SG KKIRAYAH
Sbjct  386  PNPDYYSALLWHRLMGRNVLSTSFSGPKKIRAYAH  420



>ref|XP_009625836.1| PREDICTED: heparanase-like protein 3 [Nicotiana tomentosiformis]
Length=538

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS SG+KKIRAY H
Sbjct  376  PNPDYYSALLWHRLMGRNVLSTSFSGSKKIRAYTH  410



>emb|CAN81917.1| hypothetical protein VITISV_038549 [Vitis vinifera]
Length=636

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS SG KKIRAYAH
Sbjct  382  PNPDYYSALLWHRLMGRNVLSTSFSGPKKIRAYAH  416



>emb|CBI21126.3| unnamed protein product [Vitis vinifera]
Length=887

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS +GTKKIRAY+H
Sbjct  367  PNPDYYSALLWHRLMGRNVLSTSFNGTKKIRAYSH  401


 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS  GT+KIRAYAH
Sbjct  746  PNPDYYSALLWHRLMGRNVLSTSFYGTRKIRAYAH  780



>ref|XP_007138475.1| hypothetical protein PHAVU_009G212400g [Phaseolus vulgaris]
 gb|ESW10469.1| hypothetical protein PHAVU_009G212400g [Phaseolus vulgaris]
Length=536

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  ST+ SGTK IRAYAH
Sbjct  381  PNPDYYSALLWHRLMGRNVLSTTFSGTKMIRAYAH  415



>gb|AFK40288.1| unknown [Lotus japonicus]
Length=529

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR+  ST+ SGTKKIRAYAH
Sbjct  371  PNPDYYSALLWHRLMGRSVLSTTFSGTKKIRAYAH  405



>ref|XP_011017900.1| PREDICTED: heparanase-like protein 3 isoform X1 [Populus euphratica]
 ref|XP_011017901.1| PREDICTED: heparanase-like protein 3 isoform X2 [Populus euphratica]
Length=547

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  ST  SGTKKIRAY H
Sbjct  387  PNPDYYSALLWHRLMGRNVLSTRSSGTKKIRAYTH  421



>ref|XP_002283260.2| PREDICTED: heparanase-like protein 3 [Vitis vinifera]
Length=532

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS  GT+KIRAYAH
Sbjct  367  PNPDYYSALLWHRLMGRNVLSTSFYGTRKIRAYAH  401



>ref|XP_008394121.1| PREDICTED: heparanase-like protein 3 isoform X2 [Malus domestica]
Length=533

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG  A STS SGTKKIRAYAH
Sbjct  383  PNPDYYSALLWHRLMGNKALSTSFSGTKKIRAYAH  417



>ref|XP_009355782.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=533

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG  A STS SGTKKIRAYAH
Sbjct  383  PNPDYYSALLWHRLMGNKALSTSFSGTKKIRAYAH  417



>ref|XP_008394120.1| PREDICTED: heparanase-like protein 3 isoform X1 [Malus domestica]
Length=563

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG  A STS SGTKKIRAYAH
Sbjct  413  PNPDYYSALLWHRLMGNKALSTSFSGTKKIRAYAH  447



>ref|XP_002515478.1| heparanase, putative [Ricinus communis]
 gb|EEF46927.1| heparanase, putative [Ricinus communis]
Length=527

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG NA +TS SGTKK+RAYAH
Sbjct  358  PNPDYYSALLWHRLMGTNALATSFSGTKKMRAYAH  392



>ref|XP_007203617.1| hypothetical protein PRUPE_ppa003883mg [Prunus persica]
 gb|EMJ04816.1| hypothetical protein PRUPE_ppa003883mg [Prunus persica]
Length=542

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +TS SG KKIRAYAH
Sbjct  382  PNPDYYSALLWHRLMGRNVLATSFSGPKKIRAYAH  416



>ref|XP_008242878.1| PREDICTED: heparanase-like protein 3 [Prunus mume]
Length=542

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +TS SG KKIRAYAH
Sbjct  382  PNPDYYSALLWHRLMGRNVLATSFSGPKKIRAYAH  416



>ref|XP_009363939.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +TS SG KKIRAYAH
Sbjct  381  PNPDYYSALLWHRLMGRNVLATSFSGPKKIRAYAH  415



>ref|XP_009338385.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +TS SG KKIRAYAH
Sbjct  381  PNPDYYSALLWHRLMGRNVLATSFSGPKKIRAYAH  415



>ref|XP_009358543.1| PREDICTED: heparanase-like protein 3 [Pyrus x bretschneideri]
Length=542

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +TS SG KKIRAYAH
Sbjct  381  PNPDYYSALLWHRLMGRNVLATSFSGPKKIRAYAH  415



>ref|XP_008336960.1| PREDICTED: heparanase-like protein 3 [Malus domestica]
Length=542

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +TS SG KKIRAYAH
Sbjct  381  PNPDYYSALLWHRLMGRNVLATSFSGPKKIRAYAH  415



>ref|XP_008385022.1| PREDICTED: heparanase-like protein 3 [Malus domestica]
Length=542

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +TS SG KKIRAYAH
Sbjct  381  PNPDYYSALLWHRLMGRNVLATSFSGPKKIRAYAH  415



>ref|XP_011459847.1| PREDICTED: heparanase-like protein 3 [Fragaria vesca subsp. vesca]
Length=412

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG N  STS SGTKK+R YAH
Sbjct  259  PNPDYYSALLWQRLMGNNVLSTSFSGTKKLRTYAH  293



>ref|XP_002533671.1| heparanase, putative [Ricinus communis]
 gb|EEF28717.1| heparanase, putative [Ricinus communis]
Length=551

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  ST+ SG KKIRAYAH
Sbjct  384  PNPDYYSALLWHRLMGRNVLSTNFSGMKKIRAYAH  418



>ref|XP_004159389.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-like protein 3-like 
[Cucumis sativus]
Length=539

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  ST  +GT+KIRAYAH
Sbjct  377  PNPDYYSALLWHRLMGRNVLSTGFNGTEKIRAYAH  411



>gb|KJB64649.1| hypothetical protein B456_010G059600 [Gossypium raimondii]
Length=545

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS  GTKKIR+Y H
Sbjct  377  PNPDYYSALLWHRLMGRNVLSTSFDGTKKIRSYTH  411



>ref|XP_004139281.1| PREDICTED: heparanase-like protein 3-like [Cucumis sativus]
Length=539

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  ST  +GT+KIRAYAH
Sbjct  377  PNPDYYSALLWHRLMGRNVLSTGFNGTEKIRAYAH  411



>gb|KJB64651.1| hypothetical protein B456_010G059600 [Gossypium raimondii]
Length=451

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS  GTKKIR+Y H
Sbjct  377  PNPDYYSALLWHRLMGRNVLSTSFDGTKKIRSYTH  411



>ref|XP_006483406.1| PREDICTED: heparanase-like protein 3-like isoform X1 [Citrus 
sinensis]
Length=561

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG N  STS SGT KIRAYAH
Sbjct  393  PNPDYYSALLWHRLMGSNVLSTSLSGTTKIRAYAH  427



>ref|XP_003546578.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN37477.1| Heparanase-like protein 3 [Glycine soja]
Length=538

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR+  ST+ SGT KIRAYAH
Sbjct  381  PNPDYYSALLWHRLMGRHVLSTTFSGTNKIRAYAH  415



>ref|XP_004488517.1| PREDICTED: heparanase-like protein 3-like [Cicer arietinum]
Length=536

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR+  ST+ SGT KIRAYAH
Sbjct  380  PNPDYYSALLWHRLMGRHVLSTTFSGTNKIRAYAH  414



>ref|XP_003533856.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN48130.1| Heparanase-like protein 3 [Glycine soja]
Length=538

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR+  ST+ SGT KIRAYAH
Sbjct  381  PNPDYYSALLWHRLMGRHVLSTTFSGTNKIRAYAH  415



>gb|KHG18442.1| hypothetical protein F383_07597 [Gossypium arboreum]
Length=545

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW +LMGRN  STS  GTKKIR+Y+H
Sbjct  377  PNPDYYSALLWHQLMGRNVLSTSFDGTKKIRSYSH  411



>ref|XP_007013614.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
 gb|EOY31233.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
Length=554

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW +LMGRN  STS +GTKKIR+Y H
Sbjct  386  PNPDYYSALLWHQLMGRNVLSTSFAGTKKIRSYTH  420



>ref|XP_010533116.1| PREDICTED: heparanase-like protein 3 [Tarenaya hassleriana]
Length=547

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRNA  TS SG+KKIR+Y H
Sbjct  380  PNPDYYSALLWHRLMGRNALFTSFSGSKKIRSYTH  414



>gb|KDP30214.1| hypothetical protein JCGZ_16996 [Jatropha curcas]
Length=555

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN    + SGTKKIRAYAH
Sbjct  384  PNPDYYSALLWHRLMGRNVLLANFSGTKKIRAYAH  418



>gb|KJB23650.1| hypothetical protein B456_004G108900 [Gossypium raimondii]
Length=546

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS +GT KIR+Y H
Sbjct  376  PNPDYYSALLWHRLMGRNVLSTSFTGTDKIRSYTH  410



>ref|XP_007013613.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
 gb|EOY31232.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
Length=615

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW +LMGRN  STS +GTKKIR+Y H
Sbjct  386  PNPDYYSALLWHQLMGRNVLSTSFAGTKKIRSYTH  420



>gb|KJB23649.1| hypothetical protein B456_004G108900 [Gossypium raimondii]
Length=554

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS +GT KIR+Y H
Sbjct  376  PNPDYYSALLWHRLMGRNVLSTSFTGTDKIRSYTH  410



>gb|KHG18266.1| hypothetical protein F383_21213 [Gossypium arboreum]
Length=519

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  STS +GT KIR+Y H
Sbjct  349  PNPDYYSALLWHRLMGRNVLSTSFTGTDKIRSYTH  383



>ref|XP_009108062.1| PREDICTED: heparanase-like protein 3 [Brassica rapa]
Length=536

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W RLMGRNA  T+ SGTKKIR+Y H
Sbjct  377  PNPDYYSALIWRRLMGRNALFTTFSGTKKIRSYTH  411



>emb|CDY47561.1| BnaA08g07260D [Brassica napus]
Length=536

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W RLMGRNA  T+ SGTKKIR+Y H
Sbjct  377  PNPDYYSALIWRRLMGRNALFTTFSGTKKIRSYTH  411



>gb|KEH37925.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=537

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR   ST+ SGT KIRAYAH
Sbjct  381  PNPDYYSALLWHRLMGRGVLSTTFSGTNKIRAYAH  415



>ref|XP_002324878.2| hypothetical protein POPTR_0018s02050g [Populus trichocarpa]
 gb|EEF03443.2| hypothetical protein POPTR_0018s02050g [Populus trichocarpa]
Length=563

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  ST+ SGT  IRAYAH
Sbjct  399  PNPDYYSALLWHRLMGRNVLSTTFSGTNNIRAYAH  433



>ref|XP_011036603.1| PREDICTED: heparanase-like protein 3 isoform X1 [Populus euphratica]
Length=563

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  ST+ SGT  IRAYAH
Sbjct  399  PNPDYYSALLWHRLMGRNVLSTTFSGTNNIRAYAH  433



>ref|XP_011036604.1| PREDICTED: heparanase-like protein 3 isoform X2 [Populus euphratica]
Length=520

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  ST+ SGT  IRAYAH
Sbjct  356  PNPDYYSALLWHRLMGRNVLSTTFSGTNNIRAYAH  390



>gb|EPS66918.1| hypothetical protein M569_07858, partial [Genlisea aurea]
Length=523

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR   STS +GTKKIR Y H
Sbjct  370  PNPDYYSALLWHRLMGRQVLSTSFTGTKKIRVYTH  404



>emb|CDP10485.1| unnamed protein product [Coffea canephora]
Length=543

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW +LMGRN  +T+  GTKKIRAYAH
Sbjct  382  PNPDYYSALLWHQLMGRNVLATNFRGTKKIRAYAH  416



>ref|XP_011081531.1| PREDICTED: heparanase-like protein 3 [Sesamum indicum]
Length=549

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR   STS  GT KIRAYAH
Sbjct  395  PNPDYYSALLWHRLMGRKVLSTSFVGTNKIRAYAH  429



>ref|XP_010250274.1| PREDICTED: heparanase-like protein 3 [Nelumbo nucifera]
Length=551

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR   ST+ +GTKKIRAY+H
Sbjct  382  PNPDYYSALLWHRLMGRTVLSTNFTGTKKIRAYSH  416



>ref|XP_008457259.1| PREDICTED: LOW QUALITY PROTEIN: heparanase-like protein 3 [Cucumis 
melo]
Length=538

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +   +GT+KIRAYAH
Sbjct  377  PNPDYYSALLWHRLMGRNVLTAGFNGTEKIRAYAH  411



>gb|EYU34947.1| hypothetical protein MIMGU_mgv1a004017mg [Erythranthe guttata]
Length=549

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG++  STS +G++KIRAYAH
Sbjct  377  PNPDYYSALLWHRLMGKSVLSTSFTGSRKIRAYAH  411



>ref|XP_006283483.1| hypothetical protein CARUB_v10004531mg [Capsella rubella]
 gb|EOA16381.1| hypothetical protein CARUB_v10004531mg [Capsella rubella]
Length=544

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W +LMGR A  TS SGTKKIR+YAH
Sbjct  384  PNPDYYSALIWRKLMGRKALFTSFSGTKKIRSYAH  418



>gb|AAC62794.1| T2L5.6 gene product [Arabidopsis thaliana]
Length=190

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W +LMGR A  T+ SGTKKIR+Y H
Sbjct  30   PNPDYYSALIWRQLMGRKALFTTFSGTKKIRSYTH  64



>ref|XP_010099859.1| Heparanase-like protein 3 [Morus notabilis]
 gb|EXB80736.1| Heparanase-like protein 3 [Morus notabilis]
Length=536

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG N  ST+ SGT K+RAYAH
Sbjct  375  PNPDYYSALLWHRLMGNNVISTNFSGTTKMRAYAH  409



>ref|XP_009409980.1| PREDICTED: heparanase-like protein 3 [Musa acuminata subsp. malaccensis]
Length=549

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR   ST+ +GT KIRAYAH
Sbjct  385  PNPDYYSALLWHRLMGRRVLSTNITGTNKIRAYAH  419



>ref|XP_010435392.1| PREDICTED: heparanase-like protein 3, partial [Camelina sativa]
Length=315

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W +LMGR A  TS SGTKKIR+Y H
Sbjct  155  PNPDYYSALIWRQLMGRKALFTSFSGTKKIRSYTH  189



>emb|CDY12398.1| BnaC08g08070D [Brassica napus]
Length=536

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W RLMGR A  TS SGTKKIR+Y H
Sbjct  377  PNPDYYSALIWRRLMGRKALFTSFSGTKKIRSYTH  411



>ref|XP_009623092.1| PREDICTED: heparanase-like protein 3 [Nicotiana tomentosiformis]
Length=537

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMGR+  ST   GTKK+RAYAH
Sbjct  376  PNPDYYGALLWHRLMGRSVLSTQFQGTKKLRAYAH  410



>ref|XP_008219535.1| PREDICTED: heparanase-like protein 3 isoform X2 [Prunus mume]
Length=534

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    STS  GTKK+RAYAH
Sbjct  383  PNPDYYSALLWHRLMGNKVLSTSFPGTKKLRAYAH  417



>ref|XP_008219534.1| PREDICTED: heparanase-like protein 3 isoform X1 [Prunus mume]
Length=535

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    STS  GTKK+RAYAH
Sbjct  383  PNPDYYSALLWHRLMGNKVLSTSFPGTKKLRAYAH  417



>ref|XP_010440690.1| PREDICTED: heparanase-like protein 3 [Camelina sativa]
Length=536

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W +LMGR A  TS SGTKKIR+Y H
Sbjct  376  PNPDYYSALIWRQLMGRKALFTSFSGTKKIRSYTH  410



>gb|KFK22707.1| hypothetical protein AALP_AAs49083U000200 [Arabis alpina]
Length=535

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W +LMGR A  TS SGTKKIR+Y H
Sbjct  374  PNPDYYSALIWRQLMGRKALFTSFSGTKKIRSYTH  408



>ref|XP_006338978.1| PREDICTED: heparanase-like protein 3-like [Solanum tuberosum]
Length=541

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMGRN  ST   G KK+R+YAH
Sbjct  380  PNPDYYGALLWHRLMGRNVLSTQFQGMKKLRSYAH  414



>ref|XP_010450341.1| PREDICTED: heparanase-like protein 3 [Camelina sativa]
Length=536

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W +LMGR A  TS SGTKKIR+Y H
Sbjct  376  PNPDYYSALIWRQLMGRKALFTSFSGTKKIRSYTH  410



>gb|AFW77131.1| hypothetical protein ZEAMMB73_462319 [Zea mays]
Length=303

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    +T+ SGT KIRAYAH
Sbjct  137  PNPDYYSALLWHRLMGTKVLATTFSGTNKIRAYAH  171



>ref|XP_008793957.1| PREDICTED: heparanase-like protein 3 [Phoenix dactylifera]
Length=411

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +GTK IRAYAH
Sbjct  252  PNPDYYSALLWHRLMGSKVLSTNFTGTKSIRAYAH  286



>ref|XP_007011804.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
 gb|EOY29423.1| Glucuronidase 3 isoform 2 [Theobroma cacao]
Length=513

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            P+PD  SA LW RLMG N  STS SGT+ +RAYAH
Sbjct  347  PHPDYYSALLWHRLMGSNVLSTSFSGTRNLRAYAH  381



>ref|XP_007224283.1| hypothetical protein PRUPE_ppa019445mg, partial [Prunus persica]
 gb|EMJ25482.1| hypothetical protein PRUPE_ppa019445mg, partial [Prunus persica]
Length=511

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    STS  GTKK+RAYAH
Sbjct  359  PNPDYYSALLWHRLMGNKVLSTSFPGTKKLRAYAH  393



>ref|XP_011457618.1| PREDICTED: heparanase-like protein 3 [Fragaria vesca subsp. vesca]
Length=559

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +T   G KKIRAY H
Sbjct  392  PNPDYYSALLWHRLMGRNVLATRFGGPKKIRAYTH  426



>ref|NP_851092.1| glucuronidase 3 [Arabidopsis thaliana]
 gb|AED93922.1| glucuronidase 3 [Arabidopsis thaliana]
Length=401

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W +LMGR A  T+ SGTKKIR+Y H
Sbjct  241  PNPDYYSALIWRQLMGRKALFTTFSGTKKIRSYTH  275



>ref|XP_004249602.1| PREDICTED: heparanase-like protein 3 [Solanum lycopersicum]
Length=542

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMGRN  ST   G KK+R+YAH
Sbjct  381  PNPDYYGALLWHRLMGRNVLSTQFQGMKKLRSYAH  415



>ref|NP_851093.1| glucuronidase 3 [Arabidopsis thaliana]
 sp|Q9FZP1.2|HPSE3_ARATH RecName: Full=Heparanase-like protein 3; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAF01139.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93923.1| glucuronidase 3 [Arabidopsis thaliana]
Length=536

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W +LMGR A  T+ SGTKKIR+Y H
Sbjct  376  PNPDYYSALIWRQLMGRKALFTTFSGTKKIRSYTH  410



>ref|XP_007011803.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
 gb|EOY29422.1| Glucuronidase 3 isoform 1 [Theobroma cacao]
Length=549

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            P+PD  SA LW RLMG N  STS SGT+ +RAYAH
Sbjct  383  PHPDYYSALLWHRLMGSNVLSTSFSGTRNLRAYAH  417



>dbj|BAB10787.1| unnamed protein product [Arabidopsis thaliana]
Length=536

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W +LMGR A  T+ SGTKKIR+Y H
Sbjct  376  PNPDYYSALIWRQLMGRKALFTTFSGTKKIRSYTH  410



>ref|XP_002870409.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH46668.1| glycosyl hydrolase family 79 N-terminal domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=536

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W +LMGR A  T+ SGTKKIR+Y H
Sbjct  376  PNPDYYSALIWRQLMGRKALFTTFSGTKKIRSYTH  410



>ref|XP_010906003.1| PREDICTED: heparanase-like protein 3 [Elaeis guineensis]
Length=545

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +GTK IRAYAH
Sbjct  386  PNPDYYSALLWHRLMGSKVLSTNFTGTKNIRAYAH  420



>ref|XP_009792771.1| PREDICTED: heparanase-like protein 3 isoform X1 [Nicotiana sylvestris]
Length=550

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMGR+  ST   GTKK+RAY H
Sbjct  389  PNPDYYGALLWHRLMGRSVLSTQFKGTKKLRAYTH  423



>ref|XP_009792772.1| PREDICTED: heparanase-like protein 3 isoform X2 [Nicotiana sylvestris]
Length=546

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMGR+  ST   GTKK+RAY H
Sbjct  385  PNPDYYGALLWHRLMGRSVLSTQFKGTKKLRAYTH  419



>ref|XP_002452991.1| hypothetical protein SORBIDRAFT_04g036200 [Sorghum bicolor]
 gb|EES05967.1| hypothetical protein SORBIDRAFT_04g036200 [Sorghum bicolor]
Length=540

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +GT KIRAYAH
Sbjct  383  PNPDYYSALLWHRLMGTKVLSTTFNGTNKIRAYAH  417



>ref|XP_006450373.1| hypothetical protein CICLE_v10010401mg [Citrus clementina]
 gb|ESR63613.1| hypothetical protein CICLE_v10010401mg [Citrus clementina]
Length=551

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW  LMG N  STS +GT KIRAYAH
Sbjct  383  PNPDYYSALLWHWLMGSNVLSTSLAGTTKIRAYAH  417



>ref|XP_008647414.1| PREDICTED: uncharacterized protein LOC100193781 isoform X1 [Zea 
mays]
Length=494

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    +T+ SGT KIRAYAH
Sbjct  328  PNPDYYSALLWHRLMGTKVLATTFSGTNKIRAYAH  362



>ref|XP_010665516.1| PREDICTED: heparanase-like protein 3 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG+   STS SGT  +RAY H
Sbjct  385  PNPDYYSALLWNRLMGKQVLSTSISGTNNLRAYTH  419



>gb|ACF81144.1| unknown [Zea mays]
 gb|AFW77132.1| heparanase-like protein 3 [Zea mays]
Length=543

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    +T+ SGT KIRAYAH
Sbjct  377  PNPDYYSALLWHRLMGTKVLATTFSGTNKIRAYAH  411



>ref|XP_010665510.1| PREDICTED: heparanase-like protein 3 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=604

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG+   STS SGT  +RAY H
Sbjct  446  PNPDYYSALLWNRLMGKQVLSTSISGTNNLRAYTH  480



>ref|NP_001132339.1| uncharacterized protein LOC100193781 precursor [Zea mays]
 gb|ACG29680.1| heparanase-like protein 3 precursor [Zea mays]
Length=543

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    +T+ SGT KIRAYAH
Sbjct  377  PNPDYYSALLWHRLMGTKVLATTFSGTNKIRAYAH  411



>ref|XP_008647415.1| PREDICTED: uncharacterized protein LOC100193781 isoform X2 [Zea 
mays]
Length=401

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    +T+ SGT KIRAYAH
Sbjct  235  PNPDYYSALLWHRLMGTKVLATTFSGTNKIRAYAH  269



>ref|XP_007155083.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
 gb|ESW27077.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
Length=512

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+  GTKKIR+YAH
Sbjct  369  PNPDYYSALLWHRLMGGRVLSTTFYGTKKIRSYAH  403



>ref|XP_007155084.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
 gb|ESW27078.1| hypothetical protein PHAVU_003G171800g [Phaseolus vulgaris]
Length=524

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+  GTKKIR+YAH
Sbjct  381  PNPDYYSALLWHRLMGGRVLSTTFYGTKKIRSYAH  415



>ref|NP_001241969.1| uncharacterized protein LOC100792087 precursor [Glycine max]
 gb|ACU20377.1| unknown [Glycine max]
Length=525

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+  GTKKIR YAH
Sbjct  382  PNPDYYSALLWHRLMGGRVLSTTFYGTKKIRTYAH  416



>gb|KHN15030.1| Heparanase-like protein 3 [Glycine soja]
Length=525

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+  GTKKIR YAH
Sbjct  382  PNPDYYSALLWHRLMGGRVLSTTFYGTKKIRTYAH  416



>ref|XP_006655848.1| PREDICTED: heparanase-like protein 3-like [Oryza brachyantha]
Length=409

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ SGT  IRAYAH
Sbjct  252  PNPDYYSALLWHRLMGTKVLSTTFSGTNMIRAYAH  286



>ref|XP_003561019.1| PREDICTED: heparanase-like protein 3 [Brachypodium distachyon]
Length=538

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    +T  SGT KIRAYAH
Sbjct  385  PNPDYYSALLWHRLMGTKVLATKFSGTNKIRAYAH  419



>ref|XP_003609474.1| Heparanase-like protein [Medicago truncatula]
 gb|AES91671.1| glycoside hydrolase family 79 amino-terminal domain protein [Medicago 
truncatula]
Length=529

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+  GTKKIR YAH
Sbjct  385  PNPDYYSALLWHRLMGGRVLSTTFYGTKKIRTYAH  419



>gb|KCW81358.1| hypothetical protein EUGRSUZ_C02740 [Eucalyptus grandis]
Length=488

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG N   T+ +GT K+RAY+H
Sbjct  346  PNPDYYSALLWHRLMGNNVLFTNFTGTNKLRAYSH  380



>ref|XP_010048934.1| PREDICTED: heparanase-like protein 3 isoform X2 [Eucalyptus grandis]
Length=444

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG N   T+ +GT K+RAY+H
Sbjct  280  PNPDYYSALLWHRLMGNNVLFTNFTGTNKLRAYSH  314



>gb|KJB27355.1| hypothetical protein B456_004G293000 [Gossypium raimondii]
Length=505

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMG N  STS SGT  +RAYAH
Sbjct  361  PNPDYYGALLWHRLMGSNVLSTSFSGTTGVRAYAH  395



>gb|KJB27356.1| hypothetical protein B456_004G293000 [Gossypium raimondii]
Length=532

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMG N  STS SGT  +RAYAH
Sbjct  388  PNPDYYGALLWHRLMGSNVLSTSFSGTTGVRAYAH  422



>emb|CDP13545.1| unnamed protein product [Coffea canephora]
Length=514

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGRN  +T+ +  K +RAYAH
Sbjct  376  PNPDYYSALLWHRLMGRNVLATNLTAIKNLRAYAH  410



>gb|KCW81361.1| hypothetical protein EUGRSUZ_C02742 [Eucalyptus grandis]
Length=435

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW +LMG     TS SGT KIRAYAH
Sbjct  379  PNPDYYSALLWHKLMGSEVLLTSFSGTDKIRAYAH  413



>ref|XP_004964694.1| PREDICTED: heparanase-like protein 3-like [Setaria italica]
Length=572

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    +T+ +GT KIRAYAH
Sbjct  380  PNPDYYSALLWHRLMGTKVLATTFTGTNKIRAYAH  414



>ref|XP_002437942.1| hypothetical protein SORBIDRAFT_10g005260 [Sorghum bicolor]
 gb|EER89309.1| hypothetical protein SORBIDRAFT_10g005260 [Sorghum bicolor]
Length=554

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    +T+ +GT KIRAYAH
Sbjct  382  PNPDYYSALLWHRLMGTKVLATTFNGTNKIRAYAH  416



>ref|NP_001152083.1| heparanase-like protein 3 precursor [Zea mays]
 gb|ACG45701.1| heparanase-like protein 3 precursor [Zea mays]
Length=552

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    + + SGT KIRAYAH
Sbjct  379  PNPDYYSALLWHRLMGTEVLAVTFSGTNKIRAYAH  413



>dbj|BAJ89245.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +GT KIRAY H
Sbjct  391  PNPDYYSALLWHRLMGTKVLSTTFNGTNKIRAYTH  425



>ref|XP_010048933.1| PREDICTED: heparanase-like protein 3 isoform X1 [Eucalyptus grandis]
Length=544

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG N   T+ +GT K+RAY+H
Sbjct  380  PNPDYYSALLWHRLMGNNVLFTNFTGTNKLRAYSH  414



>ref|XP_004954253.1| PREDICTED: heparanase-like protein 3-like [Setaria italica]
Length=538

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +GT KIR YAH
Sbjct  381  PNPDYYSALLWHRLMGTKVLSTTFNGTNKIRTYAH  415



>gb|EMS60649.1| Heparanase-like protein 3 [Triticum urartu]
Length=588

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +GT KIRAY H
Sbjct  414  PNPDYYSALLWHRLMGTKVLSTTFNGTNKIRAYTH  448



>gb|AFW73900.1| hypothetical protein ZEAMMB73_176333 [Zea mays]
Length=540

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +GT KIR YAH
Sbjct  386  PNPDYYSALLWHRLMGTKVLSTAFNGTNKIRGYAH  420



>ref|XP_008801894.1| PREDICTED: heparanase-like protein 3 isoform X2 [Phoenix dactylifera]
Length=499

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG     T+ +GTK IRAYAH
Sbjct  340  PNPDYYSALLWHRLMGSKVLPTNFTGTKNIRAYAH  374



>ref|NP_001183276.1| uncharacterized protein LOC100501670 precursor [Zea mays]
 gb|ACR36272.1| unknown [Zea mays]
Length=478

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +GT KIR YAH
Sbjct  386  PNPDYYSALLWHRLMGTKVLSTAFNGTNKIRGYAH  420



>ref|XP_008658727.1| PREDICTED: heparanase-like protein 3 isoform X1 [Zea mays]
Length=555

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    + + SGT KIRAYAH
Sbjct  380  PNPDYYSALLWHRLMGTKVLAVTFSGTNKIRAYAH  414



>ref|XP_008801893.1| PREDICTED: heparanase-like protein 3 isoform X1 [Phoenix dactylifera]
Length=548

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG     T+ +GTK IRAYAH
Sbjct  389  PNPDYYSALLWHRLMGSKVLPTNFTGTKNIRAYAH  423



>emb|CDP14477.1| unnamed protein product [Coffea canephora]
Length=71

 Score = 45.8 bits (107),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRA  10
            PNPD  SA LW +LMGRN  +T+ +GTKKI A
Sbjct  40   PNPDYYSALLWHQLMGRNVLATNFTGTKKIHA  71



>ref|NP_001048420.1| Os02g0802200 [Oryza sativa Japonica Group]
 dbj|BAD36026.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAD36734.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF10334.1| Os02g0802200 [Oryza sativa Japonica Group]
 gb|EAZ24974.1| hypothetical protein OsJ_08752 [Oryza sativa Japonica Group]
 dbj|BAG98079.1| unnamed protein product [Oryza sativa Japonica Group]
Length=541

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S + +GT KIRAYAH
Sbjct  383  PNPDYYSALLWNRLMGTKVLSATFNGTNKIRAYAH  417



>gb|EAY87898.1| hypothetical protein OsI_09318 [Oryza sativa Indica Group]
 gb|ACR10239.1| heparanase [Oryza sativa Indica Group]
Length=541

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S + +GT KIRAYAH
Sbjct  383  PNPDYYSALLWNRLMGTKVLSATFNGTNKIRAYAH  417



>ref|XP_010048938.1| PREDICTED: heparanase-like protein 3 isoform X2 [Eucalyptus grandis]
Length=506

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW +LMG     TS SGT KIRAYAH
Sbjct  342  PNPDYYSALLWHKLMGSEVLLTSFSGTDKIRAYAH  376



>gb|EYU40129.1| hypothetical protein MIMGU_mgv1a025097mg, partial [Erythranthe 
guttata]
Length=278

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG++   T   G+ KIRAYAH
Sbjct  236  PNPDYYSALLWHRLMGKHVLRTRFEGSTKIRAYAH  270



>ref|XP_003570329.1| PREDICTED: heparanase-like protein 3 [Brachypodium distachyon]
Length=541

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +GT KIRAY H
Sbjct  384  PNPDYYSALLWHRLMGTKVLSTTFNGTNKIRAYTH  418



>ref|XP_010048937.1| PREDICTED: heparanase-like protein 3 isoform X1 [Eucalyptus grandis]
 gb|KCW81360.1| hypothetical protein EUGRSUZ_C02742 [Eucalyptus grandis]
Length=543

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW +LMG     TS SGT KIRAYAH
Sbjct  379  PNPDYYSALLWHKLMGSEVLLTSFSGTDKIRAYAH  413



>emb|CDP16528.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 45.4 bits (106),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAY  7
            PNPD  SA LW +LMGRN  +T+ + TKKI AY
Sbjct  40   PNPDYYSALLWHQLMGRNDLATNFTCTKKIHAY  72



>ref|XP_006648064.1| PREDICTED: heparanase-like protein 3-like [Oryza brachyantha]
Length=549

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG N  ST+ +   KIRAYAH
Sbjct  381  PNPDYYSALLWHRLMGTNVLSTTFNSMNKIRAYAH  415



>ref|XP_006403100.1| hypothetical protein EUTSA_v10003449mg [Eutrema salsugineum]
 gb|ESQ44553.1| hypothetical protein EUTSA_v10003449mg [Eutrema salsugineum]
Length=529

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA +W  LMGR A  TS SG KKIR+Y H
Sbjct  368  PNPDYYSALIWRTLMGRKALFTSFSGIKKIRSYTH  402



>gb|EMT25528.1| Heparanase-like protein 3 [Aegilops tauschii]
Length=481

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +GT KIRAY H
Sbjct  323  PNPDYYSALLWHRLMGTKVLSTTFNGTNKIRAYTH  357



>ref|XP_003542659.1| PREDICTED: heparanase-like protein 3-like [Glycine max]
 gb|KHN47116.1| Heparanase-like protein 3 [Glycine soja]
Length=524

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG     T+  GTKKIR YAH
Sbjct  381  PNPDYYSALLWHRLMGGRVLLTTFYGTKKIRTYAH  415



>ref|XP_010927354.1| PREDICTED: heparanase-like protein 3 isoform X2 [Elaeis guineensis]
Length=463

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S   +GT+ IRAYAH
Sbjct  304  PNPDYYSALLWHRLMGSKVLSAKFTGTESIRAYAH  338



>gb|KCW81359.1| hypothetical protein EUGRSUZ_C02741 [Eucalyptus grandis]
Length=490

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW +LMG     TS  GT KIRAYAH
Sbjct  342  PNPDYYSALLWHKLMGSKVLLTSFLGTDKIRAYAH  376



>gb|KCW83013.1| hypothetical protein EUGRSUZ_C04395 [Eucalyptus grandis]
Length=461

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR     S S + KIRAYAH
Sbjct  384  PNPDYYSALLWHRLMGRKVLGASLSRSDKIRAYAH  418



>ref|XP_010927353.1| PREDICTED: heparanase-like protein 3 isoform X1 [Elaeis guineensis]
Length=543

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S   +GT+ IRAYAH
Sbjct  384  PNPDYYSALLWHRLMGSKVLSAKFTGTESIRAYAH  418



>gb|ABR16706.1| unknown [Picea sitchensis]
Length=381

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    +T+ +GT+ +RAYAH
Sbjct  242  PNPDYYSALLWHRLMGTRVLATNSTGTEYLRAYAH  276



>gb|KDO61807.1| hypothetical protein CISIN_1g037212mg [Citrus sinensis]
Length=551

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNP   SA LW RLMG    STS S T KIRAYAH
Sbjct  383  PNPGYYSALLWHRLMGSTVLSTSLSETTKIRAYAH  417



>gb|EYU38304.1| hypothetical protein MIMGU_mgv1a011158mg [Erythranthe guttata]
Length=290

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMG++   T   G+ KIRAYAH
Sbjct  142  PNPDYYGALLWHRLMGKHVLLTRFEGSSKIRAYAH  176



>ref|XP_010050122.1| PREDICTED: heparanase-like protein 3 [Eucalyptus grandis]
 gb|KCW83012.1| hypothetical protein EUGRSUZ_C04395 [Eucalyptus grandis]
Length=542

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR     S S + KIRAYAH
Sbjct  384  PNPDYYSALLWHRLMGRKVLGASLSRSDKIRAYAH  418



>ref|XP_004508419.1| PREDICTED: heparanase-like protein 3-like [Cicer arietinum]
Length=527

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+   TKKIR YAH
Sbjct  384  PNPDYYSALLWHRLMGGRVLSTTFYETKKIRTYAH  418



>ref|XP_002512115.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50784.1| conserved hypothetical protein [Ricinus communis]
Length=206

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMG+N  +TS  G+  +RAY+H
Sbjct  164  PNPDNYGALLWHRLMGKNVLATSYVGSPYLRAYSH  198



>ref|XP_011078541.1| PREDICTED: heparanase-like protein 3 [Sesamum indicum]
Length=537

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +G + IRAYAH
Sbjct  376  PNPDYYSALLWHRLMGTYVLSTNFTGNRTIRAYAH  410



>ref|XP_007157579.1| hypothetical protein PHAVU_002G081000g [Phaseolus vulgaris]
 gb|ESW29573.1| hypothetical protein PHAVU_002G081000g [Phaseolus vulgaris]
Length=515

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMGRN  S S  G+  +R YAH
Sbjct  370  PNPDYYGALLWHRLMGRNVLSVSHEGSPLLRTYAH  404



>gb|EAZ26032.1| hypothetical protein OsJ_09885 [Oryza sativa Japonica Group]
Length=497

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR   S   +  +K+RAYAH
Sbjct  329  PNPDYYSALLWHRLMGREVLSVDINAPRKLRAYAH  363



>gb|KCW86528.1| hypothetical protein EUGRSUZ_B03174 [Eucalyptus grandis]
Length=522

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMG+   ST+ SG+  +RAYAH
Sbjct  374  PNPDFYGALLWHRLMGKEVLSTTHSGSPYLRAYAH  408



>ref|NP_001049350.1| Os03g0211700 [Oryza sativa Japonica Group]
 gb|ABF94603.1| Heparanase-like protein 2 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11264.1| Os03g0211700 [Oryza sativa Japonica Group]
Length=541

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMGR   S   +  +K+RAYAH
Sbjct  373  PNPDYYSALLWHRLMGREVLSVDINAPRKLRAYAH  407



>ref|XP_010046621.1| PREDICTED: heparanase-like protein 2 [Eucalyptus grandis]
Length=526

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW RLMG+   ST+ SG+  +RAYAH
Sbjct  378  PNPDFYGALLWHRLMGKEVLSTTHSGSPYLRAYAH  412



>ref|XP_009399121.1| PREDICTED: heparanase-like protein 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009399122.1| PREDICTED: heparanase-like protein 1 [Musa acuminata subsp. malaccensis]
Length=538

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG+   S   SG+  +RAYAH
Sbjct  370  PNPDYYSALLWHRLMGKGVLSVDISGSSYLRAYAH  404



>ref|XP_006852836.1| hypothetical protein AMTR_s00033p00188330 [Amborella trichopoda]
 gb|ERN14303.1| hypothetical protein AMTR_s00033p00188330 [Amborella trichopoda]
Length=544

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    ST+ +   KIRAYAH
Sbjct  383  PNPDYYSALLWHRLMGTRVLSTNFTAKSKIRAYAH  417



>ref|NP_001067122.1| Os12g0578400 [Oryza sativa Japonica Group]
 gb|ABA99069.1| Heparanase-like protein 2 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF30141.1| Os12g0578400 [Oryza sativa Japonica Group]
 dbj|BAG93793.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG+   S   SG+  +RAYAH
Sbjct  370  PNPDYYSALLWHRLMGKGVISLDTSGSSYLRAYAH  404



>gb|ACR10240.1| heparanase [Oryza sativa Indica Group]
Length=539

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG+   S   SG+  +RAYAH
Sbjct  370  PNPDYYSALLWHRLMGKGVISLDTSGSSYLRAYAH  404



>ref|XP_010688437.1| PREDICTED: heparanase-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=459

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  +A LW RLMG+   +T   G  KIRAY H
Sbjct  316  PNPDYYNALLWHRLMGKQVLATKVIGNPKIRAYTH  350



>ref|XP_010048935.1| PREDICTED: heparanase-like protein 3 [Eucalyptus grandis]
Length=551

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW +LMG     TS  GT KIRAYAH
Sbjct  387  PNPDYYSALLWHKLMGSKVLLTSFLGTDKIRAYAH  421



>ref|XP_003558511.1| PREDICTED: heparanase-like protein 1 [Brachypodium distachyon]
Length=544

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG+   S   +  +K+RAYAH
Sbjct  374  PNPDYYSALLWHRLMGKGVLSVDINAPRKVRAYAH  408



>ref|XP_008785953.1| PREDICTED: heparanase-like protein 2 isoform X2 [Phoenix dactylifera]
Length=539

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S   SG+  +RAYAH
Sbjct  371  PNPDYYSALLWNRLMGNGVLSIDLSGSSYLRAYAH  405



>ref|XP_008785952.1| PREDICTED: heparanase-like protein 2 isoform X1 [Phoenix dactylifera]
Length=540

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S   SG+  +RAYAH
Sbjct  371  PNPDYYSALLWNRLMGNGVLSIDLSGSSYLRAYAH  405



>gb|EAY99897.1| hypothetical protein OsI_21892 [Oryza sativa Indica Group]
 gb|ACR10238.1| heparanase [Oryza sativa Indica Group]
Length=525

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S + +GT  IR YAH
Sbjct  373  PNPDYYSALLWHRLMGTKVLSATFNGTNMIRTYAH  407



>gb|EMS65630.1| Heparanase-like protein 3 [Triticum urartu]
Length=490

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG        +GT  IRAYAH
Sbjct  290  PNPDYYSALLWHRLMGTKVLEAKFTGTNMIRAYAH  324



>ref|NP_001056967.1| Os06g0179000 [Oryza sativa Japonica Group]
 dbj|BAD72300.1| putative beta-glucuronidase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18881.1| Os06g0179000 [Oryza sativa Japonica Group]
 dbj|BAG89440.1| unnamed protein product [Oryza sativa Japonica Group]
Length=526

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S + +GT  IR YAH
Sbjct  374  PNPDYYSALLWHRLMGTKVLSATFNGTNMIRTYAH  408



>gb|EAZ36024.1| hypothetical protein OsJ_20330 [Oryza sativa Japonica Group]
Length=525

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S + +GT  IR YAH
Sbjct  373  PNPDYYSALLWHRLMGTKVLSATFNGTNMIRTYAH  407



>ref|XP_009783167.1| PREDICTED: heparanase-like protein 2 [Nicotiana sylvestris]
Length=516

 Score = 44.7 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW +LMG+N  ST+  G+  +R YAH
Sbjct  374  PNPDYYGALLWHKLMGKNVLSTTHEGSPYLRTYAH  408



>ref|XP_009612848.1| PREDICTED: heparanase-like protein 2 [Nicotiana tomentosiformis]
Length=516

 Score = 44.7 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD   A LW +LMG+N  ST+  G+  +R YAH
Sbjct  374  PNPDYYGALLWHKLMGKNVLSTTHEGSPYLRTYAH  408



>dbj|BAJ97884.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S    GT  +RAYAH
Sbjct  370  PNPDYYSALLWHRLMGNGVLSIDFGGTSYLRAYAH  404



>dbj|BAJ84826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S    GT  +RAYAH
Sbjct  370  PNPDYYSALLWHRLMGNGVLSIDFGGTSYLRAYAH  404



>dbj|BAJ96463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -1

Query  105  PNPDXXSAXLWXRLMGRNAXSTSXSGTKKIRAYAH  1
            PNPD  SA LW RLMG    S    GT  +RAYAH
Sbjct  370  PNPDYYSALLWHRLMGNGVLSIDFGGTSYLRAYAH  404



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 572405144870