BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF019E06

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001266237.1|  Hop-interacting protein THI120                     278   8e-91   
ref|XP_011074724.1|  PREDICTED: DNL-type zinc finger protein-like       277   2e-90   Sesamum indicum [beniseed]
ref|XP_009776939.1|  PREDICTED: uncharacterized protein LOC104226608    276   5e-90   Nicotiana sylvestris
ref|XP_009620058.1|  PREDICTED: uncharacterized protein LOC104111945    276   5e-90   Nicotiana tomentosiformis
gb|EYU36814.1|  hypothetical protein MIMGU_mgv1a013669mg                273   1e-88   Erythranthe guttata [common monkey flower]
emb|CDP07337.1|  unnamed protein product                                263   1e-84   Coffea canephora [robusta coffee]
ref|XP_011083416.1|  PREDICTED: uncharacterized protein LOC105165954    261   2e-84   Sesamum indicum [beniseed]
ref|NP_001274971.1|  uncharacterized protein LOC102584137               261   4e-84   Solanum tuberosum [potatoes]
ref|XP_010664127.1|  PREDICTED: uncharacterized protein LOC100243759    249   9e-80   Vitis vinifera
ref|XP_010539089.1|  PREDICTED: uncharacterized protein LOC104813220    246   2e-78   Tarenaya hassleriana [spider flower]
gb|EPS65916.1|  hypothetical protein M569_08860                         244   3e-78   Genlisea aurea
ref|XP_006435267.1|  hypothetical protein CICLE_v10002475mg             242   1e-76   Citrus clementina [clementine]
gb|KHG11073.1|  Mitochondrial import protein ZIM17                      239   7e-76   Gossypium arboreum [tree cotton]
ref|XP_007017922.1|  Zim17-type zinc finger protein                     239   1e-75   
gb|KJB14347.1|  hypothetical protein B456_002G120700                    239   1e-75   Gossypium raimondii
gb|AIA63975.1|  transcription factor ZFP130                             239   2e-75   Gossypium hirsutum [American cotton]
ref|XP_011003097.1|  PREDICTED: uncharacterized protein LOC105109924    239   2e-75   Populus euphratica
gb|KDP36867.1|  hypothetical protein JCGZ_08158                         239   2e-75   Jatropha curcas
ref|XP_008447918.1|  PREDICTED: uncharacterized protein LOC103490262    238   5e-75   Cucumis melo [Oriental melon]
ref|XP_004144863.1|  PREDICTED: uncharacterized protein LOC101212325    237   1e-74   Cucumis sativus [cucumbers]
ref|XP_002307755.2|  hypothetical protein POPTR_0005s26750g             236   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_002510604.1|  conserved hypothetical protein                     235   4e-74   Ricinus communis
ref|XP_010063286.1|  PREDICTED: uncharacterized protein LOC104450433    233   3e-73   
ref|XP_010266915.1|  PREDICTED: uncharacterized protein LOC104604317    228   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_011034950.1|  PREDICTED: uncharacterized protein LOC105132906    227   5e-71   Populus euphratica
ref|XP_010086843.1|  Mitochondrial protein import protein ZIM17         226   1e-70   Morus notabilis
ref|XP_008806155.1|  PREDICTED: uncharacterized protein LOC103718920    224   8e-70   Phoenix dactylifera
ref|XP_008358361.1|  PREDICTED: uncharacterized protein LOC103422104    223   4e-69   
ref|XP_009355592.1|  PREDICTED: uncharacterized protein LOC103946591    222   8e-69   Pyrus x bretschneideri [bai li]
ref|XP_010941361.1|  PREDICTED: uncharacterized protein LOC105059672    220   3e-68   Elaeis guineensis
ref|XP_007200461.1|  hypothetical protein PRUPE_ppa011293mg             220   3e-68   Prunus persica
ref|XP_008348928.1|  PREDICTED: uncharacterized protein LOC103412108    219   8e-68   
gb|KFK32942.1|  hypothetical protein AALP_AA6G309400                    219   1e-67   Arabis alpina [alpine rockcress]
ref|XP_002300678.2|  hypothetical protein POPTR_0002s01730g             219   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_008236070.1|  PREDICTED: uncharacterized protein LOC103334867    219   2e-67   Prunus mume [ume]
ref|XP_008811782.1|  PREDICTED: uncharacterized protein LOC103722...    216   4e-67   
ref|XP_008811775.1|  PREDICTED: uncharacterized protein LOC103722...    216   1e-66   Phoenix dactylifera
ref|XP_010935184.1|  PREDICTED: uncharacterized protein LOC105055145    214   9e-66   Elaeis guineensis
ref|XP_009391023.1|  PREDICTED: uncharacterized protein LOC103977...    213   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391021.1|  PREDICTED: uncharacterized protein LOC103977...    214   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391022.1|  PREDICTED: uncharacterized protein LOC103977...    214   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418558.1|  PREDICTED: uncharacterized protein LOC103998726    213   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007142794.1|  hypothetical protein PHAVU_007G017400g             211   1e-64   Phaseolus vulgaris [French bean]
ref|XP_010421645.1|  PREDICTED: uncharacterized protein LOC104707...    212   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010421646.1|  PREDICTED: uncharacterized protein LOC104707...    211   1e-64   Camelina sativa [gold-of-pleasure]
ref|NP_001235094.1|  uncharacterized protein LOC100527113               210   2e-64   Glycine max [soybeans]
gb|KHN37381.1|  Hypothetical protein glysoja_013596                     210   3e-64   Glycine soja [wild soybean]
ref|XP_006588421.1|  PREDICTED: uncharacterized protein LOC100527...    210   4e-64   Glycine max [soybeans]
ref|XP_002874388.1|  hypothetical protein ARALYDRAFT_489599             210   5e-64   
ref|XP_011458699.1|  PREDICTED: uncharacterized protein LOC105349780    209   8e-64   Fragaria vesca subsp. vesca
ref|NP_001236547.1|  uncharacterized protein LOC100527474               209   8e-64   
ref|XP_006588420.1|  PREDICTED: uncharacterized protein LOC100527...    209   9e-64   
ref|XP_004497201.1|  PREDICTED: uncharacterized protein LOC101505438    209   1e-63   Cicer arietinum [garbanzo]
ref|XP_006405268.1|  hypothetical protein EUTSA_v10027929mg             209   1e-63   Eutrema salsugineum [saltwater cress]
ref|XP_006605315.1|  PREDICTED: uncharacterized protein LOC100527...    208   2e-63   Glycine max [soybeans]
ref|XP_010455141.1|  PREDICTED: uncharacterized protein LOC104736...    208   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009414426.1|  PREDICTED: uncharacterized protein LOC103995548    207   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010455142.1|  PREDICTED: uncharacterized protein LOC104736...    207   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010690316.1|  PREDICTED: uncharacterized protein LOC104903883    207   8e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK34110.1|  unknown                                                 206   2e-62   Lotus japonicus
ref|XP_008643737.1|  PREDICTED: LOC100283270 isoform X1                 204   4e-62   
ref|XP_010028773.1|  PREDICTED: uncharacterized protein LOC104418983    205   4e-62   Eucalyptus grandis [rose gum]
ref|NP_198080.1|  Zim17-type zinc finger protein                        203   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64347.1|  unknown                                                 202   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288620.1|  hypothetical protein CARUB_v10001922mg             202   3e-61   Capsella rubella
gb|AFK39869.1|  unknown                                                 203   4e-61   Lotus japonicus
ref|XP_003563260.1|  PREDICTED: uncharacterized protein LOC100844750    202   5e-61   Brachypodium distachyon [annual false brome]
ref|XP_002439041.1|  hypothetical protein SORBIDRAFT_10g030440          202   5e-61   Sorghum bicolor [broomcorn]
gb|EAZ38321.1|  hypothetical protein OsJ_22696                          201   1e-60   Oryza sativa Japonica Group [Japonica rice]
gb|KEH44399.1|  DNL zinc finger protein                                 201   1e-60   Medicago truncatula
ref|NP_001131303.1|  uncharacterized protein LOC100192616               201   1e-60   Zea mays [maize]
gb|AFK48753.1|  unknown                                                 201   1e-60   Medicago truncatula
ref|NP_001058612.2|  Os06g0724400                                       200   2e-60   
ref|XP_010494029.1|  PREDICTED: uncharacterized protein LOC104771232    201   2e-60   Camelina sativa [gold-of-pleasure]
gb|EAZ02398.1|  hypothetical protein OsI_24501                          200   2e-60   Oryza sativa Indica Group [Indian rice]
emb|CDY12988.1|  BnaC02g29950D                                          199   4e-60   Brassica napus [oilseed rape]
ref|XP_004966483.1|  PREDICTED: uncharacterized protein LOC101768670    198   1e-59   Setaria italica
ref|XP_006656504.1|  PREDICTED: uncharacterized protein LOC102700628    198   1e-59   
ref|XP_006828828.1|  hypothetical protein AMTR_s00001p00142230          196   4e-59   Amborella trichopoda
gb|ABK21254.1|  unknown                                                 195   2e-58   Picea sitchensis
dbj|BAJ94825.1|  predicted protein                                      195   4e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001149644.1|  LOC100283270                                       188   1e-56   
gb|KJB14348.1|  hypothetical protein B456_002G120700                    171   9e-50   Gossypium raimondii
gb|EMS65438.1|  hypothetical protein TRIUR3_05242                       174   5e-47   Triticum urartu
ref|XP_006386156.1|  hypothetical protein POPTR_0002s01730g             164   9e-47   
ref|XP_002977585.1|  hypothetical protein SELMODRAFT_58719              151   1e-42   
gb|EMT02176.1|  hypothetical protein F775_14553                         152   3e-39   
ref|XP_001760208.1|  predicted protein                                  145   2e-38   
gb|EYU17552.1|  hypothetical protein MIMGU_mgv1a023730mg              99.4    4e-22   Erythranthe guttata [common monkey flower]
emb|CAO02549.1|  putative zinc finger (DNL type) family protein       89.7    5e-19   Vigna unguiculata
ref|XP_005652036.1|  zf-DNL-domain-containing protein                 84.0    3e-16   Coccomyxa subellipsoidea C-169
gb|ABK26747.1|  unknown                                               82.8    4e-16   Picea sitchensis
tpg|DAA58876.1|  TPA: etched1 isoform 1                               79.3    1e-15   
ref|XP_004969096.1|  PREDICTED: DNL-type zinc finger protein-like     80.5    3e-15   Setaria italica
ref|NP_001150527.1|  zinc ribbon 1                                    80.1    3e-15   
ref|XP_002458121.1|  hypothetical protein SORBIDRAFT_03g027210        80.1    4e-15   Sorghum bicolor [broomcorn]
tpg|DAA58878.1|  TPA: etched1                                         80.1    4e-15   
ref|NP_001043517.2|  Os01g0605200                                     79.7    4e-15   
ref|XP_008446529.1|  PREDICTED: uncharacterized protein C24H6.02c...  80.1    4e-15   Cucumis melo [Oriental melon]
ref|NP_001105722.1|  etched1                                          80.1    5e-15   
gb|EEC71043.1|  hypothetical protein OsI_02763                        79.3    7e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_002438978.1|  hypothetical protein SORBIDRAFT_10g029320        79.0    9e-15   
ref|NP_001105159.1|  zinc ribbon 1                                    79.0    1e-14   Zea mays [maize]
ref|XP_002888678.1|  zinc finger family protein                       79.0    1e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_009392908.1|  PREDICTED: uncharacterized protein LOC103978730  78.2    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010066771.1|  PREDICTED: uncharacterized protein LOC104453...  78.6    2e-14   Eucalyptus grandis [rose gum]
gb|EPS62111.1|  hypothetical protein M569_12682                       75.9    2e-14   Genlisea aurea
gb|KFK41298.1|  hypothetical protein AALP_AA2G112200                  78.2    2e-14   Arabis alpina [alpine rockcress]
gb|AFW81000.1|  putative tify domain/CCT motif transcription fact...  79.0    3e-14   
ref|XP_010511888.1|  PREDICTED: uncharacterized protein LOC104787...  77.8    3e-14   
ref|XP_002280593.1|  PREDICTED: mitochondrial protein import prot...  77.8    4e-14   Vitis vinifera
ref|XP_010511887.1|  PREDICTED: uncharacterized protein LOC104787...  77.8    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_001777870.1|  predicted protein                                77.8    4e-14   
ref|XP_006301666.1|  hypothetical protein CARUB_v10022115mg           77.8    4e-14   
ref|XP_008777543.1|  PREDICTED: uncharacterized protein LOC103697...  77.0    6e-14   Phoenix dactylifera
ref|XP_010470860.1|  PREDICTED: uncharacterized protein LOC104750716  77.0    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004135125.1|  PREDICTED: uncharacterized protein LOC101206910  77.0    6e-14   Cucumis sativus [cucumbers]
ref|XP_008777542.1|  PREDICTED: uncharacterized protein LOC103697...  77.0    6e-14   Phoenix dactylifera
ref|XP_010925225.1|  PREDICTED: uncharacterized protein LOC105047...  77.0    6e-14   Elaeis guineensis
ref|XP_010925248.1|  PREDICTED: uncharacterized protein LOC105047...  77.0    6e-14   Elaeis guineensis
ref|XP_010925233.1|  PREDICTED: uncharacterized protein LOC105047...  77.0    6e-14   Elaeis guineensis
ref|XP_006644344.1|  PREDICTED: uncharacterized protein C24H6.02c...  76.6    6e-14   
ref|XP_010925241.1|  PREDICTED: uncharacterized protein LOC105047...  76.6    6e-14   Elaeis guineensis
ref|XP_010470865.1|  PREDICTED: uncharacterized protein LOC104750723  77.0    7e-14   Camelina sativa [gold-of-pleasure]
ref|NP_177040.2|  Zim17-type zinc finger protein                      76.6    7e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004238981.1|  PREDICTED: uncharacterized protein C24H6.02c     76.6    9e-14   Solanum lycopersicum
ref|XP_002314899.2|  zinc finger family protein                       76.3    1e-13   
ref|XP_006348591.1|  PREDICTED: uncharacterized protein C24H6.02c...  76.3    1e-13   Solanum tuberosum [potatoes]
ref|XP_010096705.1|  DNL-type zinc finger protein                     76.3    1e-13   Morus notabilis
ref|XP_010681378.1|  PREDICTED: DNL-type zinc finger protein isof...  75.5    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011008859.1|  PREDICTED: mitochondrial protein import prot...  75.5    2e-13   Populus euphratica
ref|XP_011070860.1|  PREDICTED: DNL-type zinc finger protein isof...  74.3    3e-13   
gb|KEH29577.1|  DNL zinc finger protein                               74.7    3e-13   Medicago truncatula
ref|XP_003518825.1|  PREDICTED: DNL-type zinc finger protein-like     74.7    3e-13   Glycine max [soybeans]
ref|XP_008360068.1|  PREDICTED: uncharacterized protein LOC103423766  75.1    3e-13   
ref|XP_007153312.1|  hypothetical protein PHAVU_003G024500g           74.7    3e-13   Phaseolus vulgaris [French bean]
ref|XP_010262339.1|  PREDICTED: uncharacterized protein LOC104600...  74.7    3e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009355956.1|  PREDICTED: uncharacterized protein LOC103946868  74.7    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_009356516.1|  PREDICTED: uncharacterized protein LOC103947335  74.7    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_009614441.1|  PREDICTED: uncharacterized protein C24H6.02c     74.7    4e-13   Nicotiana tomentosiformis
gb|KJB50817.1|  hypothetical protein B456_008G188300                  73.9    4e-13   Gossypium raimondii
ref|XP_008361865.1|  PREDICTED: uncharacterized protein LOC103425553  74.7    5e-13   
ref|XP_009791194.1|  PREDICTED: uncharacterized protein C24H6.02c     74.3    5e-13   Nicotiana sylvestris
emb|CDP00540.1|  unnamed protein product                              74.3    5e-13   Coffea canephora [robusta coffee]
ref|XP_003569318.1|  PREDICTED: uncharacterized protein C24H6.02c...  73.6    5e-13   Brachypodium distachyon [annual false brome]
emb|CDM83104.1|  unnamed protein product                              73.6    6e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006437770.1|  hypothetical protein CICLE_v10032948mg           73.9    6e-13   
ref|NP_001239683.1|  uncharacterized protein LOC100786955             73.6    6e-13   Glycine max [soybeans]
ref|XP_008339721.1|  PREDICTED: uncharacterized protein LOC103402741  73.9    8e-13   
ref|XP_006391103.1|  hypothetical protein EUTSA_v10019239mg           73.6    8e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010425752.1|  PREDICTED: uncharacterized protein LOC104710796  73.6    9e-13   Camelina sativa [gold-of-pleasure]
ref|XP_004505313.1|  PREDICTED: mitochondrial protein import prot...  73.2    9e-13   
ref|XP_011070859.1|  PREDICTED: uncharacterized protein LOC105156...  73.6    1e-12   Sesamum indicum [beniseed]
gb|KHG19418.1|  DNL-type zinc finger                                  72.8    1e-12   Gossypium arboreum [tree cotton]
gb|EMT29434.1|  hypothetical protein F775_05239                       72.8    1e-12   
dbj|BAJ89579.1|  predicted protein                                    72.8    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008246043.1|  PREDICTED: mitochondrial protein import prot...  73.2    1e-12   Prunus mume [ume]
ref|XP_010523289.1|  PREDICTED: DNL-type zinc finger protein          72.8    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_010227814.1|  PREDICTED: DNL-type zinc finger protein-like     72.4    2e-12   
ref|XP_005847953.1|  hypothetical protein CHLNCDRAFT_52093            73.9    2e-12   Chlorella variabilis
ref|XP_006858707.1|  hypothetical protein AMTR_s00066p00105400        72.4    2e-12   Amborella trichopoda
ref|XP_004297161.1|  PREDICTED: uncharacterized protein LOC101312048  72.0    3e-12   Fragaria vesca subsp. vesca
ref|XP_007046358.1|  Zim17-type zinc finger protein, putative iso...  71.2    3e-12   
ref|XP_007223547.1|  hypothetical protein PRUPE_ppa012145mg           72.0    4e-12   Prunus persica
ref|XP_009127663.1|  PREDICTED: uncharacterized protein LOC103852...  71.6    4e-12   Brassica rapa
ref|XP_009127664.1|  PREDICTED: uncharacterized protein LOC103852...  71.2    4e-12   
emb|CDY54500.1|  BnaA02g35640D                                        71.2    5e-12   Brassica napus [oilseed rape]
emb|CDX81538.1|  BnaC02g18420D                                        70.9    6e-12   
emb|CDX95993.1|  BnaA07g27380D                                        69.7    2e-11   
emb|CDY38613.1|  BnaC06g30360D                                        69.3    2e-11   Brassica napus [oilseed rape]
ref|XP_003063279.1|  predicted protein                                69.3    4e-11   Micromonas pusilla CCMP1545
emb|CDY28109.1|  BnaC06g02900D                                        66.2    4e-11   Brassica napus [oilseed rape]
ref|XP_009105422.1|  PREDICTED: mitochondrial protein import prot...  67.8    8e-11   Brassica rapa
ref|XP_005844772.1|  hypothetical protein CHLNCDRAFT_138626           64.7    8e-10   Chlorella variabilis
gb|EXX72907.1|  Zim17p                                                65.5    9e-10   Rhizophagus irregularis DAOM 197198w
emb|CEI97298.1|  Putative Zf-DNL-domain-containing protein            64.7    1e-09   Rhizopus microsporus
gb|EIF45938.1|  zim17p                                                64.7    1e-09   Brettanomyces bruxellensis AWRI1499
emb|CEG63113.1|  Putative Zf-DNL-domain-containing protein            64.7    1e-09   Rhizopus microsporus
emb|CEI95525.1|  Putative Piso0_002320 protein                        64.3    2e-09   Rhizopus microsporus
emb|CEG80750.1|  hypothetical protein RMATCC62417_15046               64.3    2e-09   Rhizopus microsporus
gb|KHJ41186.1|  ribosomal protein S15                                 65.9    2e-09   Trichuris suis
emb|CCK72609.1|  hypothetical protein KNAG_0K02460                    63.5    2e-09   Kazachstania naganishii CBS 8797
dbj|GAN02263.1|  conserved hypothetical protein                       63.5    3e-09   Mucor ambiguus
dbj|BAJ23062.1|  hypothetical protein                                 63.5    3e-09   Pseudocentrotus depressus
ref|NP_081104.1|  DNL-type zinc finger protein isoform 1              62.8    5e-09   Mus musculus [mouse]
ref|XP_001421744.1|  predicted protein                                62.8    5e-09   Ostreococcus lucimarinus CCE9901
ref|XP_011397348.1|  Fructose-1-phosphate phosphatase YqaB            64.3    7e-09   Auxenochlorella protothecoides
gb|EPB86614.1|  hypothetical protein HMPREF1544_06590                 62.4    8e-09   Mucor circinelloides f. circinelloides 1006PhL
emb|CDX97891.1|  BnaC04g40480D                                        60.1    8e-09   
ref|XP_007637235.1|  PREDICTED: LOW QUALITY PROTEIN: DNL-type zin...  62.0    8e-09   
ref|XP_007901069.1|  PREDICTED: DNL-type zinc finger protein isof...  61.6    9e-09   Callorhinchus milii [Australian ghost shark]
gb|ERE70542.1|  DNL-type zinc finger protein                          62.4    1e-08   Cricetulus griseus [Chinese hamsters]
pdb|2E2Z|A  Chain A, Solution Nmr Structure Of Yeast Tim15, Co-Ch...  60.5    1e-08   Saccharomyces cerevisiae [brewer's yeast]
gb|AJT21325.1|  Zim17p                                                61.6    1e-08   Saccharomyces cerevisiae YJM1341
ref|XP_001691699.1|  Hsp70 escorting protein 2                        62.0    1e-08   Chlamydomonas reinhardtii
ref|XP_003083615.1|  ETCHED1 protein (ISS)                            61.6    2e-08   Ostreococcus tauri
emb|CDW52158.1|  Coq4 and Ribosomal S13 N and Ribosomal S15 and z...  63.5    2e-08   Trichuris trichiura
ref|XP_005083712.1|  PREDICTED: DNL-type zinc finger protein          61.2    2e-08   Mesocricetus auratus [Syrian golden hamster]
gb|EGW12770.1|  DNL-type zinc finger protein                          60.8    2e-08   Cricetulus griseus [Chinese hamsters]
ref|XP_003510907.1|  PREDICTED: DNL-type zinc finger protein isof...  61.2    2e-08   Cricetulus griseus [Chinese hamsters]
ref|XP_008191756.1|  PREDICTED: DNL-type zinc finger protein-like     60.8    2e-08   Tribolium castaneum [rust-red flour beetle]
gb|AJT03343.1|  Zim17p                                                60.8    2e-08   Saccharomyces cerevisiae YJM270
gb|AJT25380.1|  Zim17p                                                60.8    2e-08   Saccharomyces cerevisiae YJM1399
gb|AJT02226.1|  Zim17p                                                60.8    2e-08   Saccharomyces cerevisiae YJM195
gb|AJT21703.1|  Zim17p                                                60.8    2e-08   Saccharomyces cerevisiae YJM1342
gb|AJT18360.1|  Zim17p                                                60.8    2e-08   Saccharomyces cerevisiae YJM1273
ref|NP_014089.2|  Zim17p                                              60.8    2e-08   Saccharomyces cerevisiae S288C
gb|AJT30888.1|  Zim17p                                                60.8    2e-08   Saccharomyces cerevisiae YJM1463
gb|EGA73237.1|  Zim17p                                                59.7    2e-08   Saccharomyces cerevisiae AWRI796
gb|AJT26115.1|  Zim17p                                                60.8    2e-08   Saccharomyces cerevisiae YJM1401
gb|AJT05212.1|  Zim17p                                                60.8    3e-08   Saccharomyces cerevisiae YJM450
emb|CAA86385.1|  NO381                                                61.2    3e-08   Saccharomyces cerevisiae [brewer's yeast]
emb|CAY82303.1|  Zim17p                                               61.2    3e-08   Saccharomyces cerevisiae EC1118
gb|EGA81223.1|  Zim17p                                                61.2    3e-08   Saccharomyces cerevisiae Lalvin QA23
gb|EIE86935.1|  hypothetical protein RO3G_11646                       60.8    3e-08   Rhizopus delemar RA 99-880
ref|XP_002495780.1|  ZYRO0C02882p                                     60.1    3e-08   Zygosaccharomyces rouxii
emb|CEP62412.1|  LALA0S05e05072g1_1                                   60.5    3e-08   Lachancea lanzarotensis
ref|XP_002555014.1|  KLTH0F19052p                                     60.5    4e-08   Lachancea thermotolerans CBS 6340
emb|CDY36477.1|  BnaC03g48360D                                        59.7    4e-08   Brassica napus [oilseed rape]
emb|CEP08401.1|  hypothetical protein                                 60.5    4e-08   Parasitella parasitica
emb|CDH58781.1|  hypothetical protein RO3G_11646                      60.5    4e-08   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH12975.1|  related to Mitochondrial protein import protein ...  59.7    5e-08   Zygosaccharomyces bailii ISA1307
emb|CDS07381.1|  hypothetical protein LRAMOSA01330                    60.1    5e-08   Lichtheimia ramosa
gb|AGO11609.1|  AaceriADL173Cp                                        60.1    6e-08   Saccharomycetaceae sp. 'Ashbya aceri'
gb|EJT44486.1|  ZIM17-like protein                                    59.7    6e-08   Saccharomyces kudriavzevii IFO 1802
ref|XP_006687723.1|  zf-DNL-domain-containing protein                 59.7    6e-08   Yamadazyma tenuis ATCC 10573
gb|EEH05800.1|  DNL zinc finger domain-containing protein             60.5    6e-08   Histoplasma capsulatum G186AR
ref|XP_002493869.1|  Heat shock protein with a zinc finger motif      59.7    6e-08   Komagataella phaffii GS115
ref|XP_002024413.1|  GL15020                                          59.7    7e-08   Drosophila persimilis
ref|XP_001354904.1|  GA20897                                          59.7    7e-08   Drosophila pseudoobscura pseudoobscura
ref|NP_983923.1|  ADL173Cp                                            59.7    7e-08   Eremothecium gossypii ATCC 10895
ref|XP_003725494.1|  PREDICTED: DNL-type zinc finger protein-like     59.7    8e-08   Strongylocentrotus purpuratus [purple urchin]
ref|XP_002614239.1|  hypothetical protein CLUG_05725                  59.3    8e-08   Clavispora lusitaniae ATCC 42720
emb|CDF87706.1|  BN860_12596g1_1                                      59.3    8e-08   Zygosaccharomyces bailii CLIB 213
ref|XP_008840170.1|  PREDICTED: DNL-type zinc finger protein isof...  59.7    9e-08   
gb|EHN00667.1|  Zim17p                                                58.2    9e-08   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|AJT25018.1|  Zim17p                                                59.3    9e-08   Saccharomyces cerevisiae YJM1389
ref|XP_004198925.1|  Piso0_002320                                     59.3    1e-07   
ref|XP_004199776.1|  Piso0_002320                                     59.3    1e-07   
ref|NP_001124462.1|  DNL-type zinc finger protein                     58.9    1e-07   Rattus norvegicus [brown rat]
gb|AJT23159.1|  Zim17p                                                58.9    1e-07   Saccharomyces cerevisiae YJM1383
ref|XP_008482374.1|  PREDICTED: DNL-type zinc finger protein-like     59.3    1e-07   
gb|EEQ92563.1|  DNL zinc finger domain-containing protein             59.7    1e-07   Blastomyces dermatitidis ER-3
ref|XP_002626197.1|  DNL zinc finger domain-containing protein        59.7    1e-07   Blastomyces gilchristii SLH14081
ref|XP_006863874.1|  PREDICTED: DNL-type zinc finger protein          58.9    1e-07   Chrysochloris asiatica
emb|CCC46977.1|  conserved hypothetical protein                       58.9    1e-07   Trypanosoma vivax Y486
ref|XP_009862369.1|  PREDICTED: DNL-type zinc finger protein-like     58.9    1e-07   Ciona intestinalis [sea vase]
ref|XP_011109584.1|  hypothetical protein H072_3614                   60.8    1e-07   
ref|XP_010607176.1|  PREDICTED: DNL-type zinc finger protein          58.5    1e-07   Fukomys damarensis [Damara mole rat]
ref|XP_001394190.1|  DNL zinc finger domain protein                   58.9    1e-07   Aspergillus niger CBS 513.88
ref|XP_003688733.1|  hypothetical protein TPHA_0P01410                58.9    1e-07   Tetrapisispora phaffii CBS 4417
dbj|GAA84039.1|  mitochondrial import protein Zim17                   58.9    2e-07   Aspergillus kawachii IFO 4308
ref|XP_004346924.1|  hypothetical protein CAOG_05239                  59.7    2e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_003644612.1|  hypothetical protein Ecym_2037                   58.9    2e-07   Eremothecium cymbalariae DBVPG#7215
gb|KGK37232.1|  hypothetical protein JL09_g3628                       58.9    2e-07   Pichia kudriavzevii
gb|ETN66741.1|  hypothetical protein AND_001480                       57.8    2e-07   Anopheles darlingi [American malaria mosquito]
gb|ABK24010.1|  unknown                                               58.9    2e-07   Picea sitchensis
ref|XP_449518.1|  hypothetical protein                                58.5    2e-07   [Candida] glabrata
gb|EGC49531.1|  DNL zinc finger domain-containing protein             58.9    2e-07   Histoplasma capsulatum H88
ref|XP_461045.2|  DEHA2F15774p                                        58.5    2e-07   Debaryomyces hansenii CBS767
gb|EER41665.1|  DNL zinc finger protein                               58.9    2e-07   Histoplasma capsulatum H143
ref|XP_004207823.1|  PREDICTED: DNL-type zinc finger protein-like     58.5    2e-07   
ref|XP_001992524.1|  GH24157                                          58.5    2e-07   Drosophila grimshawi
ref|XP_007095644.1|  PREDICTED: uncharacterized protein LOC102959539  60.1    2e-07   
ref|XP_004285091.1|  PREDICTED: DNL-type zinc finger protein          57.8    3e-07   Orcinus orca [Orca]
ref|XP_001483464.1|  hypothetical protein PGUG_04193                  57.8    3e-07   Meyerozyma guilliermondii ATCC 6260
ref|XP_004410770.1|  PREDICTED: DNL-type zinc finger protein          57.8    3e-07   Odobenus rosmarus divergens
ref|XP_003473033.1|  PREDICTED: DNL-type zinc finger protein isof...  57.8    3e-07   Cavia porcellus [guinea pig]
ref|XP_004640585.1|  PREDICTED: DNL-type zinc finger protein          57.8    4e-07   Octodon degus
emb|CBK20169.2|  Zim17                                                57.0    4e-07   Blastocystis hominis
ref|XP_006674935.1|  hypothetical protein BATDEDRAFT_7290             55.8    4e-07   Batrachochytrium dendrobatidis JAM81
ref|XP_010736167.1|  PREDICTED: DNL-type zinc finger protein          57.4    4e-07   
ref|XP_001385314.1|  hypothetical protein PICST_59964                 56.6    4e-07   Scheffersomyces stipitis CBS 6054
ref|XP_002059602.1|  GJ14731                                          57.4    4e-07   Drosophila virilis
ref|XP_002010480.1|  GI14660                                          57.8    4e-07   Drosophila mojavensis
ref|XP_011122970.1|  hypothetical protein AOL_s00080g293              57.8    4e-07   Arthrobotrys oligospora ATCC 24927
ref|XP_004799780.1|  PREDICTED: DNL-type zinc finger protein          57.4    4e-07   
ref|XP_004593704.1|  PREDICTED: DNL-type zinc finger protein          56.6    4e-07   Ochotona princeps [southern American pika]
ref|XP_315385.4|  AGAP005377-PA                                       57.0    4e-07   Anopheles gambiae str. PEST
emb|CDK25150.1|  unnamed protein product                              58.2    4e-07   
ref|XP_003941416.1|  PREDICTED: DNL-type zinc finger protein          57.4    5e-07   
ref|XP_008840169.1|  PREDICTED: DNL-type zinc finger protein isof...  58.5    5e-07   
ref|XP_520365.2|  PREDICTED: DNL-type zinc finger protein             57.4    5e-07   
ref|XP_003965336.1|  PREDICTED: DNL-type zinc finger protein-like     56.6    6e-07   
gb|AFW71389.1|  hypothetical protein ZEAMMB73_297185                  58.9    6e-07   
ref|XP_454278.1|  hypothetical protein                                57.0    7e-07   
ref|XP_007521583.1|  PREDICTED: DNL-type zinc finger protein          56.6    8e-07   
ref|XP_009523416.1|  hypothetical protein PHYSODRAFT_259700           57.0    8e-07   
gb|ETE59988.1|  DNL-type zinc finger protein                          55.8    8e-07   
ref|NP_001074318.1|  DNL-type zinc finger protein                     56.6    8e-07   
ref|XP_002100706.1|  GE16027                                          56.6    1e-06   
ref|XP_001642186.1|  hypothetical protein Kpol_167p1                  56.6    1e-06   
ref|XP_001978049.1|  GG19380                                          55.5    1e-06   
ref|XP_849286.1|  PREDICTED: DNL-type zinc finger protein             56.2    1e-06   
ref|XP_007945125.1|  PREDICTED: DNL-type zinc finger protein          56.2    1e-06   
ref|XP_005408560.1|  PREDICTED: DNL-type zinc finger protein-like     56.2    1e-06   
ref|XP_008890456.1|  hypothetical protein PPTG_00743                  56.2    1e-06   
ref|XP_006062284.1|  PREDICTED: DNL-type zinc finger protein-like     55.5    1e-06   
dbj|BAO40425.1|  DNL zinc finger domain-containing protein            56.2    1e-06   
ref|XP_006918169.1|  PREDICTED: DNL-type zinc finger protein          55.8    1e-06   
ref|XP_003668024.1|  hypothetical protein NDAI_0A06270                56.6    1e-06   
ref|XP_010765447.1|  PREDICTED: DNL-type zinc finger protein          56.2    1e-06   
gb|EFB22703.1|  hypothetical protein PANDA_014080                     55.1    1e-06   
ref|XP_002175448.1|  TIM23 translocase complex subunit Tim15          55.8    2e-06   
ref|XP_002908206.1|  conserved hypothetical protein                   55.8    2e-06   
ref|NP_573064.1|  CG8206, isoform A                                   56.2    2e-06   
ref|XP_003673948.1|  hypothetical protein NCAS_0A10090                56.2    2e-06   
ref|XP_011229908.1|  PREDICTED: DNL-type zinc finger protein          55.5    2e-06   
ref|XP_003911135.1|  PREDICTED: DNL-type zinc finger protein          55.8    2e-06   
ref|XP_002107042.1|  GD17233                                          56.2    2e-06   
ref|XP_003582892.1|  PREDICTED: DNL-type zinc finger protein          55.5    2e-06   
ref|NP_001181664.1|  DNL-type zinc finger protein                     55.8    2e-06   
ref|XP_008003840.1|  PREDICTED: DNL-type zinc finger protein isof...  55.8    2e-06   
ref|XP_002100710.1|  GE17213                                          55.8    2e-06   
ref|XP_009308557.1|  zf-DNL-domain-containing protein                 56.2    2e-06   
ref|XP_002797301.1|  DNL zinc finger domain-containing protein        56.6    2e-06   
ref|XP_008446528.1|  PREDICTED: uncharacterized protein LOC103489...  55.5    2e-06   
ref|XP_003795003.1|  PREDICTED: DNL-type zinc finger protein          55.8    2e-06   
ref|XP_001978045.1|  GG17905                                          55.8    2e-06   
ref|XP_010371036.1|  PREDICTED: DNL-type zinc finger protein          55.8    2e-06   
ref|XP_002071136.1|  GK25634                                          55.8    2e-06   
gb|EFX88143.1|  hypothetical protein DAPPUDRAFT_221352                55.1    2e-06   
gb|EEH19415.1|  hypothetical protein PABG_01734                       56.6    2e-06   
ref|XP_820850.1|  hypothetical protein                                55.8    2e-06   
ref|XP_010759549.1|  hypothetical protein PADG_03669                  56.6    2e-06   
ref|XP_011368287.1|  PREDICTED: DNL-type zinc finger protein          54.7    2e-06   
ref|XP_009003700.1|  PREDICTED: DNL-type zinc finger protein          55.5    2e-06   
gb|EDL08302.1|  mCG128376                                             57.4    2e-06   
gb|EHB04827.1|  DNL-type zinc finger protein                          55.5    2e-06   
ref|XP_004459655.1|  PREDICTED: DNL-type zinc finger protein          55.5    3e-06   
dbj|BAP71913.1|  DNL zinc finger domain-containing protein            55.5    3e-06   
ref|XP_007901068.1|  PREDICTED: DNL-type zinc finger protein isof...  55.1    3e-06   
ref|XP_004613455.1|  PREDICTED: DNL-type zinc finger protein          55.1    3e-06   
emb|CDO94518.1|  unnamed protein product                              57.4    3e-06   
ref|XP_843824.1|  hypothetical protein                                55.5    3e-06   
gb|KFM78808.1|  DNL-type zinc finger protein                          55.1    3e-06   
ref|XP_002107038.1|  GD15783                                          54.3    3e-06   
gb|KIY70132.1|  zf-DNL-domain-containing protein                      55.5    3e-06   
emb|CBH09890.1|  hypothetical protein, conserved                      55.5    3e-06   
ref|XP_005336996.1|  PREDICTED: DNL-type zinc finger protein          55.1    3e-06   
ref|XP_002594862.1|  hypothetical protein BRAFLDRAFT_86030            55.1    3e-06   
ref|XP_006981043.1|  PREDICTED: DNL-type zinc finger protein isof...  55.1    3e-06   
ref|XP_002820433.1|  PREDICTED: DNL-type zinc finger protein          55.1    3e-06   
ref|XP_006403530.1|  hypothetical protein EUTSA_v10010741mg           55.1    4e-06   
ref|XP_001819335.1|  DNL zinc finger domain protein                   55.1    4e-06   
ref|XP_005760580.1|  DNL zinc finger protein                          56.2    4e-06   
ref|XP_004388748.1|  PREDICTED: DNL-type zinc finger protein          55.1    4e-06   
gb|EIT72832.1|  DNL zinc finger domain protein                        55.1    4e-06   
ref|NP_573061.2|  CG12379                                             54.7    4e-06   
ref|XP_005189472.1|  PREDICTED: DNL-type zinc finger protein          54.7    4e-06   
ref|XP_006675484.1|  hypothetical protein BATDEDRAFT_22160            55.8    4e-06   
ref|XP_003230644.1|  PREDICTED: DNL-type zinc finger protein          54.3    4e-06   
ref|XP_010954228.1|  PREDICTED: DNL-type zinc finger protein          54.7    4e-06   
ref|XP_001235328.1|  PREDICTED: DNL-type zinc finger protein          54.3    5e-06   
ref|XP_004178081.1|  hypothetical protein TBLA_0A07730                54.7    5e-06   
gb|AAS15675.1|  LP13032p                                              54.7    5e-06   
ref|XP_008150888.1|  PREDICTED: DNL-type zinc finger protein          54.3    5e-06   
ref|XP_006218420.1|  PREDICTED: DNL-type zinc finger protein-like     55.5    5e-06   
ref|XP_008495513.1|  PREDICTED: DNL-type zinc finger protein          53.5    5e-06   
ref|XP_002022881.1|  GL16522                                          54.7    6e-06   
ref|XP_005107608.1|  PREDICTED: DNL-type zinc finger protein-like     54.3    6e-06   
ref|XP_008003839.1|  PREDICTED: DNL-type zinc finger protein isof...  54.7    6e-06   
ref|XP_006824976.1|  PREDICTED: DNL-type zinc finger protein-like     54.7    6e-06   
gb|ACN37055.1|  unknown                                               54.3    6e-06   
gb|EYE95089.1|  DNL zinc finger domain protein                        54.7    6e-06   
gb|KFH66652.1|  hypothetical protein MVEG_07177                       55.5    6e-06   
ref|NP_001150499.1|  LOC100284130                                     54.3    7e-06   
ref|XP_006163455.1|  PREDICTED: DNL-type zinc finger protein-like     53.1    7e-06   
ref|XP_001609028.1|  DNL zinc finger domain containing protein        53.5    7e-06   
ref|XP_003570413.1|  PREDICTED: uncharacterized protein LOC100837...  54.3    8e-06   
ref|XP_010235979.1|  PREDICTED: uncharacterized protein LOC100837...  54.3    8e-06   
ref|XP_002064300.1|  GK20094                                          52.4    8e-06   
ref|XP_002044172.1|  GM22535                                          52.8    8e-06   
ref|XP_001966034.1|  GF19477                                          54.3    8e-06   
ref|XP_011442194.1|  PREDICTED: DNL-type zinc finger protein-like     53.9    9e-06   
ref|XP_001267979.1|  DNL zinc finger domain protein                   54.3    9e-06   
ref|XP_004307372.1|  PREDICTED: uncharacterized protein LOC101291376  55.1    1e-05   
ref|XP_001652366.1|  AAEL006952-PA                                    53.1    1e-05   
ref|XP_004714568.1|  PREDICTED: caspase recruitment domain-contai...  55.8    1e-05   
gb|KIY98188.1|  Hsp70 escorting protein 2                             54.3    1e-05   
emb|CEL61778.1|  DNL-type zinc finger protein OS=Mus musculus GN=...  53.5    1e-05   
ref|XP_008324040.1|  PREDICTED: DNL-type zinc finger protein          53.9    1e-05   
ref|XP_010681379.1|  PREDICTED: uncharacterized protein LOC104896...  52.8    1e-05   
ref|NP_001090392.1|  DNL-type zinc finger protein                     53.9    1e-05   
ref|XP_010569399.1|  PREDICTED: DNL-type zinc finger protein          52.8    1e-05   
ref|XP_009475380.1|  PREDICTED: DNL-type zinc finger protein          52.4    1e-05   
ref|XP_005055719.1|  PREDICTED: DNL-type zinc finger protein          52.4    1e-05   
ref|XP_007508671.1|  predicted protein                                53.9    1e-05   
ref|XP_009116161.1|  PREDICTED: uncharacterized protein LOC103841...  53.9    1e-05   
ref|XP_009116160.1|  PREDICTED: uncharacterized protein LOC103841...  53.9    1e-05   
ref|XP_010112217.1|  DNL-type zinc finger protein                     53.9    1e-05   
gb|EFW21924.1|  TIM23 translocase complex subunit Tim15               53.9    1e-05   
ref|XP_750712.1|  mitochondrial import protein Zim17                  53.9    1e-05   
gb|KGO65606.1|  Zinc finger, DNL-type                                 53.9    1e-05   
emb|CCW63414.1|  unnamed protein product                              53.9    1e-05   
ref|XP_002311410.2|  hypothetical protein POPTR_0008s11030g           52.8    1e-05   
ref|XP_009278935.1|  PREDICTED: DNL-type zinc finger protein          52.4    1e-05   
ref|XP_003066019.1|  DNL zinc finger family protein                   53.5    1e-05   
tpg|DAA34189.1|  TPA: hypothetical secreted protein 1840              53.1    1e-05   
ref|XP_009173620.1|  hypothetical protein T265_09323                  54.7    1e-05   
ref|XP_010203637.1|  PREDICTED: DNL-type zinc finger protein          52.4    1e-05   
ref|XP_001257939.1|  DNL zinc finger domain protein                   53.5    1e-05   
ref|XP_003955415.1|  hypothetical protein KAFR_0A08460                53.5    1e-05   
ref|XP_001247362.1|  hypothetical protein CIMG_01133                  53.5    1e-05   
gb|EYU22609.1|  hypothetical protein MIMGU_mgv1a026408mg              52.0    1e-05   
gb|EKC36353.1|  DNL-type zinc finger protein                          51.6    1e-05   
gb|ETO15024.1|  hypothetical protein RFI_22345                        53.1    1e-05   
gb|KFM08448.1|  DNL-type zinc finger protein                          52.0    1e-05   
tpg|DAA51711.1|  TPA: hypothetical protein ZEAMMB73_994626            54.7    2e-05   
ref|XP_007127321.1|  PREDICTED: DNL-type zinc finger protein          53.1    2e-05   
ref|XP_002541557.1|  predicted protein                                53.5    2e-05   
gb|EKG17804.1|  Signal recognition particle SRP14 subunit             52.0    2e-05   
gb|KFP33127.1|  DNL-type zinc finger protein                          52.0    2e-05   
ref|XP_001992035.1|  GH24435                                          52.8    2e-05   
ref|XP_002146741.1|  mitochondrial import protein Zim17, putative     53.5    2e-05   
ref|XP_002454792.1|  hypothetical protein SORBIDRAFT_04g037475        53.9    2e-05   
ref|XP_002011097.1|  GI16194                                          51.6    2e-05   
ref|XP_005825125.1|  hypothetical protein GUITHDRAFT_77430            50.8    2e-05   
ref|XP_009020084.1|  hypothetical protein HELRODRAFT_128195           51.2    2e-05   
ref|XP_003757539.1|  PREDICTED: DNL-type zinc finger protein          53.1    2e-05   
dbj|GAM35847.1|  mitochondrial import protein                         53.1    2e-05   
emb|CCE41063.1|  hypothetical protein CPAR2_300520                    52.8    2e-05   
gb|AAI23014.1|  LOC779561 protein                                     52.8    2e-05   
gb|EJK62092.1|  hypothetical protein THAOC_17311                      53.9    2e-05   
gb|EMG47278.1|  hypothetical protein G210_2410                        52.8    2e-05   
gb|KFP83013.1|  DNL-type zinc finger protein                          51.6    2e-05   
gb|KDN36909.1|  hypothetical protein RSAG8_10528                      52.8    3e-05   
gb|EAY88046.1|  hypothetical protein OsI_09474                        52.8    3e-05   
gb|EJK52589.1|  hypothetical protein THAOC_28119                      53.5    3e-05   
ref|XP_003871301.1|  Zim17 protein                                    52.4    3e-05   
gb|EPY24030.1|  hypothetical protein AGDE_12563                       53.1    3e-05   
ref|NP_001048537.1|  Os02g0819700                                     52.8    3e-05   
emb|CDI50951.1|  related to ZIM17-Zinc finger Motif protein, mito...  53.1    3e-05   
emb|CCD13482.1|  unnamed protein product                              52.8    3e-05   
ref|XP_001966562.1|  GF22240                                          52.4    3e-05   
gb|EUC59744.1|  DNL zinc finger protein                               52.4    3e-05   
ref|XP_003678598.1|  hypothetical protein TDEL_0A00550                52.4    3e-05   
ref|XP_009979529.1|  PREDICTED: DNL-type zinc finger protein          51.2    3e-05   
ref|XP_005299581.1|  PREDICTED: DNL-type zinc finger protein          52.4    3e-05   
ref|XP_002951711.1|  hypothetical protein VOLCADRAFT_117941           53.5    3e-05   
dbj|GAC73252.1|  uncharacterized conserved protein                    52.8    3e-05   
ref|XP_002935266.1|  PREDICTED: DNL-type zinc finger protein          52.4    3e-05   
ref|XP_001636345.1|  predicted protein                                50.8    3e-05   
ref|XP_005987447.1|  PREDICTED: uncharacterized protein LOC102356071  53.1    4e-05   
emb|CAF97135.1|  unnamed protein product                              50.8    4e-05   
gb|EWM23067.1|  zinc finger protein                                   53.1    4e-05   
ref|XP_009032242.1|  hypothetical protein AURANDRAFT_17910            50.4    4e-05   
ref|XP_004921710.1|  PREDICTED: mitochondrial protein import prot...  51.6    4e-05   
gb|EEQ46935.1|  conserved hypothetical protein                        52.4    4e-05   
ref|XP_006292193.1|  hypothetical protein CARUB_v10018399mg           52.4    4e-05   
emb|CDS33652.1|  RING finger protein 145                              53.9    4e-05   
ref|XP_002057102.1|  GJ16534                                          51.6    4e-05   
ref|XP_003426587.1|  PREDICTED: DNL-type zinc finger protein-like     52.4    4e-05   
ref|XP_007875933.1|  hypothetical protein PFL1_00245                  52.0    4e-05   
emb|CCW70893.1|  unnamed protein product                              52.4    4e-05   
ref|XP_006648130.1|  PREDICTED: DNL-type zinc finger protein-like     51.2    4e-05   
ref|XP_001215012.1|  predicted protein                                52.4    5e-05   
ref|XP_011166011.1|  PREDICTED: DNL-type zinc finger protein-like     51.6    5e-05   
ref|XP_006796841.1|  PREDICTED: DNL-type zinc finger protein-like     52.4    5e-05   
emb|CDY07518.1|  BnaC06g15460D                                        52.0    5e-05   
ref|XP_006900698.1|  PREDICTED: DNL-type zinc finger protein          53.1    5e-05   
gb|EMT16528.1|  hypothetical protein F775_30154                       52.0    5e-05   
ref|XP_009790582.1|  PREDICTED: uncharacterized protein LOC104238023  52.0    5e-05   
gb|AAO64784.1|  At3g54830                                             52.0    5e-05   
gb|EMS46743.1|  hypothetical protein TRIUR3_16284                     52.0    5e-05   
ref|XP_006955786.1|  zf-DNL-domain-containing protein                 51.2    6e-05   
ref|XP_007256624.1|  PREDICTED: DNL-type zinc finger protein-like     52.0    6e-05   
ref|XP_006827446.1|  hypothetical protein AMTR_s00009p00104670        52.0    6e-05   
ref|XP_001863982.1|  conserved hypothetical protein                   51.2    6e-05   
ref|XP_002550560.1|  hypothetical protein CTRG_04858                  51.6    6e-05   
gb|KGO43691.1|  Zinc finger, DNL-type                                 52.0    6e-05   
ref|XP_005720307.1|  PREDICTED: DNL-type zinc finger protein-like     52.0    6e-05   
emb|CDM36204.1|  Zinc finger, DNL-type                                52.0    6e-05   
dbj|GAC93970.1|  hypothetical protein PHSY_001539                     52.0    6e-05   
dbj|GAD93662.1|  mitochondrial import protein Zim17                   52.0    6e-05   
ref|XP_004549840.1|  PREDICTED: DNL-type zinc finger protein-like     52.0    7e-05   
ref|NP_001074117.1|  DNL-type zinc finger protein                     51.6    7e-05   
gb|ENN77479.1|  hypothetical protein YQE_06007                        50.8    7e-05   
ref|XP_010262345.1|  PREDICTED: uncharacterized protein LOC104600...  50.8    7e-05   
ref|XP_009620945.1|  PREDICTED: uncharacterized protein LOC104112666  52.0    7e-05   
ref|XP_005539537.1|  hypothetical protein, conserved                  52.0    7e-05   
gb|KIO03392.1|  hypothetical protein M404DRAFT_1001310                51.2    7e-05   
gb|KJB50818.1|  hypothetical protein B456_008G188300                  50.4    7e-05   
gb|EPX74981.1|  TIM23 translocase complex subunit Tim15               51.6    7e-05   
ref|XP_007363106.1|  zf-DNL-domain-containing protein                 50.4    7e-05   
ref|XP_009103937.1|  PREDICTED: uncharacterized protein LOC103829...  51.6    7e-05   
ref|XP_010925256.1|  PREDICTED: uncharacterized protein LOC105047...  50.4    7e-05   
gb|EKV04099.1|  Mitochondrial import protein Zim17, putative          51.6    7e-05   
ref|XP_002421339.1|  heat shock protein, mitochondrial protein im...  51.6    7e-05   
dbj|BAE99394.1|  hypothetical protein                                 51.6    7e-05   
gb|EJY75042.1|  DNL zinc finger family protein                        52.8    8e-05   
ref|XP_005529316.1|  PREDICTED: DNL-type zinc finger protein-like     51.6    8e-05   
ref|XP_009103936.1|  PREDICTED: uncharacterized protein LOC103829...  51.6    8e-05   
ref|XP_008817465.1|  hypothetical protein C922_03651                  52.4    8e-05   
ref|XP_008546021.1|  PREDICTED: DNL-type zinc finger protein-like     50.8    9e-05   
ref|XP_009075802.1|  PREDICTED: DNL-type zinc finger protein          51.6    9e-05   
ref|XP_008243140.1|  PREDICTED: uncharacterized protein LOC103341403  50.8    9e-05   
ref|XP_003861413.1|  hypothetical protein, conserved                  52.0    9e-05   
ref|XP_006278619.1|  PREDICTED: DNL-type zinc finger protein-like     50.1    9e-05   
ref|XP_010899415.1|  PREDICTED: DNL-type zinc finger protein          51.6    9e-05   



>ref|NP_001266237.1| Hop-interacting protein THI120 [Solanum lycopersicum]
 gb|AEW69817.1| Hop-interacting protein THI120 [Solanum lycopersicum]
Length=206

 Score =   278 bits (710),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 150/170 (88%), Gaps = 6/170 (4%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSND-SSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVP  515
            S + NGNE DL+S++ND +S+VPI     LS+DAAMGLVLSAANVRGWTTGSGMEGP VP
Sbjct  35   SRKNNGNESDLQSDANDNTSIVPIFNNPTLSKDAAMGLVLSAANVRGWTTGSGMEGPPVP  94

Query  514  AGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCC  335
            AGS+ E+  +Q+STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCC
Sbjct  95   AGSDSESNTDQISTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCC  154

Query  334  GCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDIP  185
            GCN++HKLVDNLNLFH+MKCYV+  FNPNPDN +GFKYFD+DDDN++  P
Sbjct  155  GCNVFHKLVDNLNLFHEMKCYVSPDFNPNPDNDIGFKYFDMDDDNDEVFP  204



>ref|XP_011074724.1| PREDICTED: DNL-type zinc finger protein-like [Sesamum indicum]
Length=213

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 146/161 (91%), Gaps = 5/161 (3%)
 Frame = -1

Query  655  EPDLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETG  491
            EPD++ +S+ S L P+L     S+DAAMGLVLSAANVRGWTTGSGMEGPS+PAGS+P+ G
Sbjct  49   EPDIKPDSSHSRLAPVLRNRTLSKDAAMGLVLSAANVRGWTTGSGMEGPSMPAGSDPDPG  108

Query  490  MEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKL  311
             E+VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKL
Sbjct  109  TERVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKL  168

Query  310  VDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDI  188
            VDNLNLFH+MKCYVNSSFNPNP++ +GFKYFDLD+DN DD+
Sbjct  169  VDNLNLFHEMKCYVNSSFNPNPNDVMGFKYFDLDEDNNDDM  209



>ref|XP_009776939.1| PREDICTED: uncharacterized protein LOC104226608 [Nicotiana sylvestris]
Length=207

 Score =   276 bits (705),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 148/169 (88%), Gaps = 6/169 (4%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSND-SSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVP  515
            S + NGNEPD +S++ D +S+VPIL     S+DAAMGLVLSAANVRGWTTGSGMEGP VP
Sbjct  35   SRKNNGNEPDFQSDAIDCTSIVPILNNPTLSKDAAMGLVLSAANVRGWTTGSGMEGPPVP  94

Query  514  AGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCC  335
            AGS+ E+  +Q+STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCC
Sbjct  95   AGSDSESNTDQISTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCC  154

Query  334  GCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDI  188
            GCN++HKLVDNLNLFH+MKCYV  +FNPNPDN +GFKYFDLDDDN D I
Sbjct  155  GCNVFHKLVDNLNLFHEMKCYVGPNFNPNPDNDIGFKYFDLDDDNNDGI  203



>ref|XP_009620058.1| PREDICTED: uncharacterized protein LOC104111945 [Nicotiana tomentosiformis]
Length=208

 Score =   276 bits (705),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 148/169 (88%), Gaps = 6/169 (4%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSND-SSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVP  515
            S + NGNEPD +S++ND +S+VPIL     S+D AMGLVLSAANVRGWTTGSGMEGP VP
Sbjct  36   SRKNNGNEPDFQSDANDCTSIVPILNNPTLSKDDAMGLVLSAANVRGWTTGSGMEGPPVP  95

Query  514  AGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCC  335
            AGS+ E+  +Q+STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCC
Sbjct  96   AGSDSESSTDQISTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCC  155

Query  334  GCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDI  188
            GCN++HKLVDNLNLFH+MKCYV  +FNPNPDN +GFKYFDLDDDN D I
Sbjct  156  GCNVFHKLVDNLNLFHEMKCYVGPNFNPNPDNDIGFKYFDLDDDNNDGI  204



>gb|EYU36814.1| hypothetical protein MIMGU_mgv1a013669mg [Erythranthe guttata]
Length=213

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 147/163 (90%), Gaps = 5/163 (3%)
 Frame = -1

Query  664  NGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNP  500
            +G EPD + +S++SSLVPI     +SQDAAMGLVLSAANVRGWTTGSGMEGPS+PAGS+P
Sbjct  45   SGGEPDFKPDSSESSLVPINRNRFISQDAAMGLVLSAANVRGWTTGSGMEGPSMPAGSDP  104

Query  499  ETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIY  320
             +GM++VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++
Sbjct  105  NSGMDRVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVF  164

Query  319  HKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDD  191
            HKLVDNLNLFH+MKCYV+ SF+PNP++ +GFK+FDL DD  +D
Sbjct  165  HKLVDNLNLFHEMKCYVDPSFDPNPNDQMGFKFFDLGDDTTND  207



>emb|CDP07337.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 9/162 (6%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSNDSS--LVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSV  518
            SP+ NGN+ D++S+SNDSS  LVP+L     S+DAAMGLVLSAANVRGWTTGSGMEGPSV
Sbjct  54   SPKNNGNQRDIQSDSNDSSTSLVPMLRNHTLSKDAAMGLVLSAANVRGWTTGSGMEGPSV  113

Query  517  PAG--SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFV  344
            PAG  S+ E+G E++STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFV
Sbjct  114  PAGAGSDSESGTERISTFPWSLFTKSPRRRMRVAFTCSVCGQRTTRAINPHAYTDGTVFV  173

Query  343  QCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYF  218
            QCCGCN++HKLVDNLNLFHDMKCYVN SFNPN +  LGFKYF
Sbjct  174  QCCGCNVFHKLVDNLNLFHDMKCYVNPSFNPNVNADLGFKYF  215



>ref|XP_011083416.1| PREDICTED: uncharacterized protein LOC105165954 [Sesamum indicum]
Length=212

 Score =   261 bits (668),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 151/173 (87%), Gaps = 10/173 (6%)
 Frame = -1

Query  676  SPRGNGNEP-----DLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEG  527
            SPR + N       DL+S+S+DS+LVP+L     S+DAAMGLVLSAANVRGWTTGSGMEG
Sbjct  36   SPRNDHNSNNDSGNDLKSDSSDSALVPVLRHQTLSKDAAMGLVLSAANVRGWTTGSGMEG  95

Query  526  PSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVF  347
            PSVPAGS+ ++GMEQVSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVF
Sbjct  96   PSVPAGSDSDSGMEQVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVF  155

Query  346  VQCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDI  188
            VQCCGCN++HKLVDNLNLFH+MKCYVN SFNPNP+N + FKYFDLD+D  DDI
Sbjct  156  VQCCGCNVFHKLVDNLNLFHEMKCYVNPSFNPNPNNDVNFKYFDLDEDKNDDI  208



>ref|NP_001274971.1| uncharacterized protein LOC102584137 [Solanum tuberosum]
 gb|AFX67003.1| hypothetical protein [Solanum tuberosum]
Length=206

 Score =   261 bits (666),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 139/159 (87%), Gaps = 6/159 (4%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSND-SSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVP  515
            S + NGNEPDL+S+ N+ +S+VPI     LS+DAAMGLVLSAANVRGWTTGSGMEGP VP
Sbjct  35   SRKNNGNEPDLQSDGNEGTSIVPIFNNPTLSKDAAMGLVLSAANVRGWTTGSGMEGPPVP  94

Query  514  AGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCC  335
            AGS+ E+  EQ+STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCC
Sbjct  95   AGSDSESSTEQISTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCC  154

Query  334  GCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYF  218
            GCN++HKLVDNLNLFH+MKCYV+  FNPN DN +GFKY 
Sbjct  155  GCNVFHKLVDNLNLFHEMKCYVSPDFNPNSDNDIGFKYL  193



>ref|XP_010664127.1| PREDICTED: uncharacterized protein LOC100243759 [Vitis vinifera]
 emb|CBI18909.3| unnamed protein product [Vitis vinifera]
Length=209

 Score =   249 bits (637),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 6/159 (4%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPA  512
            SP+ NGN+ D+RS S++SSLVPIL     S+DAAMGLVLSAA+VRGWTT SGMEGPSVPA
Sbjct  37   SPKDNGNDSDVRSESDESSLVPILTNRTLSKDAAMGLVLSAASVRGWTTDSGMEGPSVPA  96

Query  511  GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCG  332
             +   +  E++STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCG
Sbjct  97   AAEARSSTERISTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCG  156

Query  331  CNIYHKLVDNLNLFHDMKCYVNSSFN-PNPDNSLGFKYF  218
            CN++HKLVDNLNLFH+MKCYVN SFN  +P   +GFKY 
Sbjct  157  CNVFHKLVDNLNLFHEMKCYVNPSFNYSDPRGDVGFKYL  195



>ref|XP_010539089.1| PREDICTED: uncharacterized protein LOC104813220 [Tarenaya hassleriana]
Length=209

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 134/165 (81%), Gaps = 7/165 (4%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  506
            + N  E DL+S SN SSLVP+     LS+D AMGLVLS+A+VRGWTTGSGMEGPSVPAG+
Sbjct  41   KNNDKESDLQSESNSSSLVPLFGYRTLSRDEAMGLVLSSASVRGWTTGSGMEGPSVPAGA  100

Query  505  NPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCN  326
               +  E VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN
Sbjct  101  EERSVTENVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCN  160

Query  325  IYHKLVDNLNLFHDMKCYVNSSFNPNPDNS--LGFKYFDLDDDNE  197
            ++HKLVDNLNLFH+MKCYVN SFN     +   GF+ FD+DDD +
Sbjct  161  VFHKLVDNLNLFHEMKCYVNPSFNYRDQKTDISGFRLFDMDDDKD  205



>gb|EPS65916.1| hypothetical protein M569_08860, partial [Genlisea aurea]
Length=166

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 130/155 (84%), Gaps = 6/155 (4%)
 Frame = -1

Query  661  GNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPE  497
            G E DL SN ++ SLVPI     LS+DAAMG+VLSAANVRGWTTGSGMEGPS+P G +P 
Sbjct  12   GREADLSSNPSEFSLVPISKTYFLSEDAAMGMVLSAANVRGWTTGSGMEGPSIPLGPDPN  71

Query  496  TGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYH  317
            +  E  STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNIYH
Sbjct  72   SITETASTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIYH  131

Query  316  KLVDNLNLFHDMKCYVNSSFNP-NPDNSLGFKYFD  215
            KLVDNLNLFH+MKCYVNSSFNP NP + + F + D
Sbjct  132  KLVDNLNLFHEMKCYVNSSFNPKNPTDGMSFNFLD  166



>ref|XP_006435267.1| hypothetical protein CICLE_v10002475mg [Citrus clementina]
 ref|XP_006473726.1| PREDICTED: uncharacterized protein LOC102623239 [Citrus sinensis]
 gb|ESR48507.1| hypothetical protein CICLE_v10002475mg [Citrus clementina]
 gb|KDO84977.1| hypothetical protein CISIN_1g028299mg [Citrus sinensis]
Length=211

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 133/157 (85%), Gaps = 6/157 (4%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  506
            + NGN+ DL+SNS ++S+VP+     LS+D AMGLVLSAA+VRGWTTGSGMEGPSVPAG+
Sbjct  40   KKNGNDSDLQSNSKETSIVPLFGNQTLSKDEAMGLVLSAASVRGWTTGSGMEGPSVPAGA  99

Query  505  NPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCN  326
               +  E+VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN
Sbjct  100  EEGSSTEKVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCN  159

Query  325  IYHKLVDNLNLFHDMKCYVNSSFN-PNPDNSLGFKYF  218
            ++HKLVDNLNLFH+MKCYVN SFN  +    +GFK F
Sbjct  160  VFHKLVDNLNLFHEMKCYVNPSFNYRDAKWDVGFKLF  196



>gb|KHG11073.1| Mitochondrial import protein ZIM17 [Gossypium arboreum]
Length=206

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 8/169 (5%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  506
            + +GN+ D++S+ N+ S+VP++     SQDAAMGLVLSAA+VRGWTTGSGMEGPSVPA +
Sbjct  34   KKDGNDSDIQSDPNNISIVPLVGNQTFSQDAAMGLVLSAASVRGWTTGSGMEGPSVPART  93

Query  505  NP-ETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  329
            +  ++  EQVSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGC
Sbjct  94   DDDQSNTEQVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGC  153

Query  328  NIYHKLVDNLNLFHDMKCYVNSSFNPNPDNS--LGFKYFDLDDDNEDDI  188
            N++HKLVDNLNLFH MKCYVN SFN   D    +GFK FD +DD + ++
Sbjct  154  NVFHKLVDNLNLFHGMKCYVNPSFNYKRDGQWDVGFKLFDEEDDGDGNV  202



>ref|XP_007017922.1| Zim17-type zinc finger protein [Theobroma cacao]
 gb|EOY15147.1| Zim17-type zinc finger protein [Theobroma cacao]
Length=214

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 140/167 (84%), Gaps = 7/167 (4%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPA  512
            S + +GN+ DL+S++N++S+VP+      S+D AMGLVLSAA+VRGWTTGSGMEGPSVPA
Sbjct  39   SSKKDGNDSDLQSDANNTSIVPLFGNQTFSKDEAMGLVLSAASVRGWTTGSGMEGPSVPA  98

Query  511  GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCG  332
             ++ ++  E+VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCG
Sbjct  99   RTDDQSNTEKVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCG  158

Query  331  CNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNS--LGFKYFDLDDDNE  197
            CN++HKLVDNLNLFH+MKCYV+ SFN   D    +GFK F  ++D++
Sbjct  159  CNVFHKLVDNLNLFHEMKCYVSPSFNYKGDRQWDVGFKLFGEEEDDD  205



>gb|KJB14347.1| hypothetical protein B456_002G120700 [Gossypium raimondii]
Length=206

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 140/169 (83%), Gaps = 8/169 (5%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  506
            + +GN+ D++ + N++S+VP++     SQDAAMGLVLSAA+VRGWTTGSGMEGPSVPA +
Sbjct  34   KKDGNDSDIQYDPNNTSIVPLVGNQTFSQDAAMGLVLSAASVRGWTTGSGMEGPSVPART  93

Query  505  NP-ETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  329
            +  ++  EQVSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGC
Sbjct  94   DDDQSNTEQVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGC  153

Query  328  NIYHKLVDNLNLFHDMKCYVNSSFNPNPDNS--LGFKYFDLDDDNEDDI  188
            N++HKLVDNLNLFH MKCYVN SFN   D    +GFK FD +DD + ++
Sbjct  154  NVFHKLVDNLNLFHGMKCYVNPSFNYKRDGQWDVGFKLFDEEDDGDGNV  202



>gb|AIA63975.1| transcription factor ZFP130 [Gossypium hirsutum]
Length=206

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 140/169 (83%), Gaps = 8/169 (5%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  506
            + +GN+ D++ + N++S+VP++     SQDAAMGLVLSAA+VRGWTTGSGMEGPSVPA +
Sbjct  34   KKDGNDSDIQYDPNNTSIVPLVGNQTFSQDAAMGLVLSAASVRGWTTGSGMEGPSVPART  93

Query  505  NP-ETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  329
            +  ++  EQVSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGC
Sbjct  94   DDDQSNTEQVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGC  153

Query  328  NIYHKLVDNLNLFHDMKCYVNSSFNPNPDNS--LGFKYFDLDDDNEDDI  188
            N++HKLVDNLNLFH MKCYVN SFN   D    +GFK FD +DD + ++
Sbjct  154  NVFHKLVDNLNLFHGMKCYVNPSFNYKRDGQWDVGFKLFDEEDDGDGNV  202



>ref|XP_011003097.1| PREDICTED: uncharacterized protein LOC105109924 [Populus euphratica]
Length=219

 Score =   239 bits (610),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 134/161 (83%), Gaps = 6/161 (4%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA  512
            S + +  + DL+SNSNDSS+VP+     LS+DAAMGLVLSAA+VRGWTTGSGMEGPSVPA
Sbjct  40   SSKKDNKDSDLQSNSNDSSIVPLFNNPTLSKDAAMGLVLSAASVRGWTTGSGMEGPSVPA  99

Query  511  GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCG  332
            G+   +  E+VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCG
Sbjct  100  GAEDGSNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCG  159

Query  331  CNIYHKLVDNLNLFHDMKCYVNSSFN-PNPDNSLGFKYFDL  212
            CN++HKLVDNLNLFH+MKCYVN SFN  +     GFK FD+
Sbjct  160  CNVFHKLVDNLNLFHEMKCYVNPSFNYRDAKWDGGFKLFDM  200



>gb|KDP36867.1| hypothetical protein JCGZ_08158 [Jatropha curcas]
Length=213

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 132/159 (83%), Gaps = 6/159 (4%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA  512
            S + N +E DLRS SNDSS+VP      LS+DAAMGLVLSAA+VRGWTTGSGMEGP VPA
Sbjct  38   SSKKNESESDLRSESNDSSIVPFFNNPTLSKDAAMGLVLSAASVRGWTTGSGMEGPPVPA  97

Query  511  GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCG  332
            G++  +  E+VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCG
Sbjct  98   GADEGSNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCG  157

Query  331  CNIYHKLVDNLNLFHDMKCYVNSSFN-PNPDNSLGFKYF  218
            CNI+HKLVDNLNLFH+MKCYVN SFN  +     GFK+F
Sbjct  158  CNIFHKLVDNLNLFHEMKCYVNPSFNYRDAKWDGGFKFF  196



>ref|XP_008447918.1| PREDICTED: uncharacterized protein LOC103490262 [Cucumis melo]
Length=216

 Score =   238 bits (607),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 133/173 (77%), Gaps = 12/173 (7%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILSQ----------DAAMGLVLSAANVRGWTTGSGMEGPS  521
            +GN NE D +S+SN+   +PILS+          D AMG+VLSAA  RGWTTGSGMEGP 
Sbjct  40   KGNDNESDSQSDSNNIRNLPILSKRHLSLSPLSKDVAMGMVLSAATGRGWTTGSGMEGPP  99

Query  520  VPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  341
             PAG   ++G E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQ
Sbjct  100  APAGLEAKSGTENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQ  159

Query  340  CCGCNIYHKLVDNLNLFHDMKCYVNSSFN--PNPDNSLGFKYFDLDDDNEDDI  188
            CCGCN YHKLVDNLNLFH+MKCY+N SFN   N    + FKY D+++D  DDI
Sbjct  160  CCGCNAYHKLVDNLNLFHEMKCYINPSFNYGSNGWGDVNFKYLDVEEDGNDDI  212



>ref|XP_004144863.1| PREDICTED: uncharacterized protein LOC101212325 [Cucumis sativus]
 ref|XP_004167745.1| PREDICTED: uncharacterized LOC101212325 [Cucumis sativus]
 gb|KGN43276.1| hypothetical protein Csa_7G016610 [Cucumis sativus]
Length=216

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 133/173 (77%), Gaps = 12/173 (7%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILSQ----------DAAMGLVLSAANVRGWTTGSGMEGPS  521
            +GN NE D +S+S ++  +PILS+          D AMG+VLSAA  RGWTTGSGMEGP 
Sbjct  40   KGNDNESDSQSDSKNTRNLPILSKRHLSLSPLSKDVAMGMVLSAATGRGWTTGSGMEGPP  99

Query  520  VPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  341
             PAG   ++G E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQ
Sbjct  100  APAGMEAKSGTENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQ  159

Query  340  CCGCNIYHKLVDNLNLFHDMKCYVNSSFN--PNPDNSLGFKYFDLDDDNEDDI  188
            CCGCN YHKLVDNLNLFH+MKCY+N SFN   N    + FKY D+++D  DD+
Sbjct  160  CCGCNAYHKLVDNLNLFHEMKCYINPSFNYGSNGWGDVNFKYLDVEEDGNDDV  212



>ref|XP_002307755.2| hypothetical protein POPTR_0005s26750g [Populus trichocarpa]
 gb|EEE94751.2| hypothetical protein POPTR_0005s26750g [Populus trichocarpa]
Length=218

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 132/159 (83%), Gaps = 6/159 (4%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA  512
            S + +  + DL+SNSNDSS+VP+     LS+DAAMGLVLSAA+VRGWTTGSGMEGPSVPA
Sbjct  40   SSKKDNKDSDLQSNSNDSSIVPLFSNPTLSKDAAMGLVLSAASVRGWTTGSGMEGPSVPA  99

Query  511  GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCG  332
            G+   +  E+VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCG
Sbjct  100  GAEDGSNTEKVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCG  159

Query  331  CNIYHKLVDNLNLFHDMKCYVNSSFN-PNPDNSLGFKYF  218
            CN++HKLVDNLNLFH+MKCYVN SFN  +     GFK F
Sbjct  160  CNVFHKLVDNLNLFHEMKCYVNPSFNYRDAKWDGGFKLF  198



>ref|XP_002510604.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52791.1| conserved hypothetical protein [Ricinus communis]
Length=209

 Score =   235 bits (600),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 133/159 (84%), Gaps = 7/159 (4%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA  512
            S + + N+ DLRS+SNDSS+VP      LS+DAAMGLVLSAA+VRGWTTGSGMEGPSVPA
Sbjct  38   SSKKDENDSDLRSDSNDSSIVPFFNNSTLSKDAAMGLVLSAASVRGWTTGSGMEGPSVPA  97

Query  511  GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCG  332
            G++  +  E VST PWSLFTKSPRRRM VAFTC +CGQRTTRAINPHAYTDGTVFVQCCG
Sbjct  98   GTD-GSNTENVSTLPWSLFTKSPRRRMRVAFTCNICGQRTTRAINPHAYTDGTVFVQCCG  156

Query  331  CNIYHKLVDNLNLFHDMKCYVNSSFN-PNPDNSLGFKYF  218
            CN++HKLVDNLNLFH+MKCYVN SFN  +    +GFK F
Sbjct  157  CNVFHKLVDNLNLFHEMKCYVNPSFNYRDAKWDVGFKLF  195



>ref|XP_010063286.1| PREDICTED: uncharacterized protein LOC104450433 [Eucalyptus grandis]
 gb|KCW70496.1| hypothetical protein EUGRSUZ_F03705 [Eucalyptus grandis]
Length=222

 Score =   233 bits (595),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 133/165 (81%), Gaps = 6/165 (4%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILS-----QDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  506
            + N  +  LRS+S + +L+P+LS     +DAAMGLVLSAA+VRGWTT SGMEGP  PAG+
Sbjct  51   KKNDGDSGLRSDSGEPNLLPVLSNRTLSKDAAMGLVLSAASVRGWTTDSGMEGPVAPAGA  110

Query  505  NPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCN  326
               +G E+VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN
Sbjct  111  EGGSGTERVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCN  170

Query  325  IYHKLVDNLNLFHDMKCYVNSSFN-PNPDNSLGFKYFDLDDDNED  194
            I+HKLVDNLNLFH+MKCYVN +FN   P   +GF Y ++ DD ++
Sbjct  171  IFHKLVDNLNLFHEMKCYVNPTFNYKEPKWDVGFNYLNITDDGDE  215



>ref|XP_010266915.1| PREDICTED: uncharacterized protein LOC104604317 [Nelumbo nucifera]
Length=210

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 10/152 (7%)
 Frame = -1

Query  643  RSNSNDSSLVPIL---------SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETG  491
            ++NSN+ ++VP+L         S+DAAMGLVLSAA  RGWTTGSGMEGPSVPAG+  E+ 
Sbjct  46   QTNSNEMNIVPLLNNRMPLSPLSKDAAMGLVLSAAAGRGWTTGSGMEGPSVPAGAESESS  105

Query  490  MEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKL  311
             E++STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKL
Sbjct  106  TEKISTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKL  165

Query  310  VDNLNLFHDMKCYVNSSFN-PNPDNSLGFKYF  218
            VDNLNLFH+MKCYVN SF+  +P+  + FKY 
Sbjct  166  VDNLNLFHEMKCYVNPSFSYRDPNGDVSFKYL  197



>ref|XP_011034950.1| PREDICTED: uncharacterized protein LOC105132906 [Populus euphratica]
Length=206

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 128/160 (80%), Gaps = 6/160 (4%)
 Frame = -1

Query  646  LRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQ  482
            L+S+S+DSS+VP+      S+DAAMGLVLSAA+VRGWTTGSGMEGPSV A S      E+
Sbjct  46   LQSSSHDSSIVPLFNNHSFSKDAAMGLVLSAASVRGWTTGSGMEGPSVTAVSEDGFNTEK  105

Query  481  VSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDN  302
            VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDN
Sbjct  106  VSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDN  165

Query  301  LNLFHDMKCYVNSSFN-PNPDNSLGFKYFDLDDDNEDDIP  185
            LNLFH+MKCYVN  FN  +     GFK FD+DD   +  P
Sbjct  166  LNLFHEMKCYVNPGFNYRDAKWDGGFKLFDVDDGGSNVFP  205



>ref|XP_010086843.1| Mitochondrial protein import protein ZIM17 [Morus notabilis]
 gb|EXB24041.1| Mitochondrial protein import protein ZIM17 [Morus notabilis]
Length=211

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 129/173 (75%), Gaps = 14/173 (8%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPIL----------SQDAAMGLVLSAANVRGWTTGSGMEGPS  521
            + N +E D  S S D   VPIL          S+DAAMGLVLSAA  RGWTTGSGMEGP 
Sbjct  37   KSNDSEADPESASKDVKSVPILKNLNLSLSPLSKDAAMGLVLSAAAGRGWTTGSGMEGPP  96

Query  520  VPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  341
            VP GS  ++  E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQ
Sbjct  97   VPDGSEAKSSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQ  156

Query  340  CCGCNIYHKLVDNLNLFHDMKCYVNSSFN--PNPDNSLGFKYFDLDDDNEDDI  188
            CCGC+ +HKLVDNLNLFH+M CYVN SF+   N    + FKY D++D  EDDI
Sbjct  157  CCGCSAFHKLVDNLNLFHEMNCYVNPSFSYGGNGWEDMNFKYMDVED--EDDI  207



>ref|XP_008806155.1| PREDICTED: uncharacterized protein LOC103718920 [Phoenix dactylifera]
Length=209

 Score =   224 bits (571),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 129/170 (76%), Gaps = 11/170 (6%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPIL---------SQDAAMGLVLSAANVRGWTTGSGMEGPSV  518
            + N  E D+ S+S  ++LVP L         S+DAAMGLVLSAA  RGWTTGSGMEGP +
Sbjct  38   KHNEGESDIHSDSESTNLVPFLNNSASISPLSKDAAMGLVLSAAAGRGWTTGSGMEGPPI  97

Query  517  PAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQC  338
            PA S+ ++    VSTFPWSLFTKSPRRRMLVAFTC VCGQRTTRAINPHAYTDGTVFVQC
Sbjct  98   PAESDSDSTDRTVSTFPWSLFTKSPRRRMLVAFTCNVCGQRTTRAINPHAYTDGTVFVQC  157

Query  337  CGCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDI  188
            CGCN++HKLVDNLNLFH+MKCYVN SF    D    F Y   DD ++++I
Sbjct  158  CGCNVFHKLVDNLNLFHEMKCYVNPSFRYKGDTP--FNYLGEDDGDDENI  205



>ref|XP_008358361.1| PREDICTED: uncharacterized protein LOC103422104 [Malus domestica]
Length=217

 Score =   223 bits (567),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 126/165 (76%), Gaps = 12/165 (7%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILS----------QDAAMGLVLSAANVRGWTTGSGMEGPS  521
            +GN NE + +S+S + + +PILS          +DAAMGLV+ AA  RGWTTGSGMEGP 
Sbjct  40   KGNENESNPKSDSKEINRLPILSNRHLSLSPLSKDAAMGLVMGAATGRGWTTGSGMEGPP  99

Query  520  VPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  341
             PAG   E+  E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQ
Sbjct  100  APAGVQTESSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQ  159

Query  340  CCGCNIYHKLVDNLNLFHDMKCYVNSSFN--PNPDNSLGFKYFDL  212
            CCGCN +HKLVDNLNLFH+MKCYV+  FN   N   S+ FKY ++
Sbjct  160  CCGCNAFHKLVDNLNLFHEMKCYVSPGFNYKGNGWESVNFKYLEM  204



>ref|XP_009355592.1| PREDICTED: uncharacterized protein LOC103946591 [Pyrus x bretschneideri]
Length=216

 Score =   222 bits (565),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 131/172 (76%), Gaps = 13/172 (8%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILS----------QDAAMGLVLSAANVRGWTTGSGMEGPS  521
            +GN NE + +S+S + + +PILS          +DAAMGLV+ AA  RGWTTGSGMEGP 
Sbjct  40   KGNENESNPKSDSKEINRLPILSNRHLSLSPLSKDAAMGLVMGAATGRGWTTGSGMEGPP  99

Query  520  VPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  341
             PAG   ++  E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQ
Sbjct  100  APAGVQTQS-TENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQ  158

Query  340  CCGCNIYHKLVDNLNLFHDMKCYVNSSFN--PNPDNSLGFKYFDLDDDNEDD  191
            CCGCN +HKLVD+LNLFH+MKCYV+  FN   N   ++ FKY ++DDD  +D
Sbjct  159  CCGCNAFHKLVDHLNLFHEMKCYVSPGFNYKGNGWEAVNFKYLEMDDDKGND  210



>ref|XP_010941361.1| PREDICTED: uncharacterized protein LOC105059672 [Elaeis guineensis]
Length=207

 Score =   220 bits (561),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 129/170 (76%), Gaps = 13/170 (8%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPIL---------SQDAAMGLVLSAANVRGWTTGSGMEGPSV  518
            +  G+E DL S+S  ++LVP L         S+DAAMGLVL+AA  RGWTTGSGMEGPS+
Sbjct  38   KHKGDEADLHSDSESTNLVPFLNNNASISPLSKDAAMGLVLNAAAGRGWTTGSGMEGPSM  97

Query  517  PAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQC  338
            PA  + E+    VSTFP SLFTKSPRRRMLVAFTC VCGQRTTRAINPHAYTDGTVFVQC
Sbjct  98   PA--DLESPDRTVSTFPLSLFTKSPRRRMLVAFTCNVCGQRTTRAINPHAYTDGTVFVQC  155

Query  337  CGCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDI  188
            CGCN++HKLVDNLNLFH+MKCYVN SF    D    F Y D DD ++ +I
Sbjct  156  CGCNVFHKLVDNLNLFHEMKCYVNPSFRYKGDTP--FNYLDEDDGDDQNI  203



>ref|XP_007200461.1| hypothetical protein PRUPE_ppa011293mg [Prunus persica]
 gb|EMJ01660.1| hypothetical protein PRUPE_ppa011293mg [Prunus persica]
Length=216

 Score =   220 bits (561),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 125/165 (76%), Gaps = 12/165 (7%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILS----------QDAAMGLVLSAANVRGWTTGSGMEGPS  521
            +GN NE    S+S D   VP+LS          +DAAMGLV+SAA  RGWTTGSGMEGP 
Sbjct  40   KGNENESSPSSDSKDIKNVPVLSNRHLSLSPLSKDAAMGLVMSAATGRGWTTGSGMEGPP  99

Query  520  VPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  341
             PAG +  +  E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQ
Sbjct  100  APAGIHTHSSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQ  159

Query  340  CCGCNIYHKLVDNLNLFHDMKCYVNSSFN--PNPDNSLGFKYFDL  212
            CCGCN +HKLVDNLNLFH+MKCYV+  FN   N  +++ FKY ++
Sbjct  160  CCGCNAFHKLVDNLNLFHEMKCYVSPGFNYKGNGWDAVNFKYLEM  204



>ref|XP_008348928.1| PREDICTED: uncharacterized protein LOC103412108 [Malus domestica]
 ref|XP_008365921.1| PREDICTED: uncharacterized protein LOC103429551 [Malus domestica]
Length=216

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 130/172 (76%), Gaps = 13/172 (8%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILS----------QDAAMGLVLSAANVRGWTTGSGMEGPS  521
            +GN NE + + +S + + +PILS          +DAAMGLV+ AA  RGWTTGSGMEGP 
Sbjct  40   KGNENEXNPKLDSKEINRLPILSNRHLSLSPLSKDAAMGLVMGAATGRGWTTGSGMEGPP  99

Query  520  VPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  341
             PAG   ++  E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQ
Sbjct  100  APAGVQTQS-TENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQ  158

Query  340  CCGCNIYHKLVDNLNLFHDMKCYVNSSFN--PNPDNSLGFKYFDLDDDNEDD  191
            CCGCN +HKLVD+LNLFH+MKCYV+  FN   N   ++ FKY ++DDD  +D
Sbjct  159  CCGCNAFHKLVDHLNLFHEMKCYVSPGFNYKGNGWEAVNFKYLEMDDDKGND  210



>gb|KFK32942.1| hypothetical protein AALP_AA6G309400 [Arabis alpina]
Length=207

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 130/165 (79%), Gaps = 11/165 (7%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPI---LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNP  500
            + +  + D +S SN SSLVP+   LS D AMGLVLSAA+VRGWTTGSGMEGPS+PA S+ 
Sbjct  41   KKDDTDHDPQSESNSSSLVPMFRTLSNDEAMGLVLSAASVRGWTTGSGMEGPSLPAKSDS  100

Query  499  ETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIY  320
            ET    VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGC ++
Sbjct  101  ET----VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCYVF  156

Query  319  HKLVDNLNLFHDMKCYVNSSFN---PNPDNSLGFKYFDLDDDNED  194
            HKLVDNL+LFH++K YV+SSFN     PD   GF  FD D+D  D
Sbjct  157  HKLVDNLDLFHEVKYYVSSSFNDRDAKPDVG-GFNLFDDDNDGGD  200



>ref|XP_002300678.2| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 ref|XP_006386157.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 gb|EEE79951.2| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 gb|ERP63954.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
Length=210

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 122/149 (82%), Gaps = 6/149 (4%)
 Frame = -1

Query  646  LRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQ  482
            L+S+S+DSS+VP+      S+DAAMGLVLSAA+VRGWTTGSGMEGPSV A S      E+
Sbjct  46   LQSSSHDSSIVPLFNNPSFSKDAAMGLVLSAASVRGWTTGSGMEGPSVTAVSEDGFNTEK  105

Query  481  VSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDN  302
            VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDN
Sbjct  106  VSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDN  165

Query  301  LNLFHDMKCYVNSSFN-PNPDNSLGFKYF  218
            LNLFH+MKCYVN  FN  +     GFK F
Sbjct  166  LNLFHEMKCYVNPGFNYRDAKWDGGFKLF  194



>ref|XP_008236070.1| PREDICTED: uncharacterized protein LOC103334867 [Prunus mume]
Length=254

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 126/165 (76%), Gaps = 12/165 (7%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILS----------QDAAMGLVLSAANVRGWTTGSGMEGPS  521
            +GN NE +  S+S D   +P+LS          +DAAMGLV+SAA  RGWTTGSGMEGP 
Sbjct  78   KGNENESNPSSDSKDIKNLPVLSNRHLSLSPLSKDAAMGLVMSAATGRGWTTGSGMEGPP  137

Query  520  VPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  341
             PAG +  +  E VSTFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQ
Sbjct  138  APAGIHTHSSTENVSTFPWSLFTKSPRRRMLVAFTCNICGQRTTRAINPHAYTDGTVFVQ  197

Query  340  CCGCNIYHKLVDNLNLFHDMKCYVNSSFN--PNPDNSLGFKYFDL  212
            CCGCN +HKLVDNLNLFH+MKCYV+  FN   N  +++ FKY ++
Sbjct  198  CCGCNAFHKLVDNLNLFHEMKCYVSPGFNYKGNGWDAVNFKYLEM  242



>ref|XP_008811782.1| PREDICTED: uncharacterized protein LOC103722853 isoform X2 [Phoenix 
dactylifera]
Length=181

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 127/166 (77%), Gaps = 13/166 (8%)
 Frame = -1

Query  658  NEPDLRSNSNDSSLVPIL---------SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  506
            +E +L S+S  ++++P L         S+DAAMGLVL+A   RGWTTGSGMEGPS+PA  
Sbjct  16   DEANLHSDSKSTNIIPFLNNSTSISPLSKDAAMGLVLNAVAGRGWTTGSGMEGPSMPA--  73

Query  505  NPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCN  326
            +PE+    VST PWSLFTKSPRRRMLVAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN
Sbjct  74   DPESPDRTVSTVPWSLFTKSPRRRMLVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCN  133

Query  325  IYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDI  188
            ++HKLVDNLNLFH MKCYVN SF    D    F Y D DD ++++I
Sbjct  134  VFHKLVDNLNLFHGMKCYVNPSFRYKGDKP--FNYLDEDDGDDENI  177



>ref|XP_008811775.1| PREDICTED: uncharacterized protein LOC103722853 isoform X1 [Phoenix 
dactylifera]
Length=210

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 127/166 (77%), Gaps = 13/166 (8%)
 Frame = -1

Query  658  NEPDLRSNSNDSSLVPIL---------SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  506
            +E +L S+S  ++++P L         S+DAAMGLVL+A   RGWTTGSGMEGPS+PA  
Sbjct  45   DEANLHSDSKSTNIIPFLNNSTSISPLSKDAAMGLVLNAVAGRGWTTGSGMEGPSMPA--  102

Query  505  NPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCN  326
            +PE+    VST PWSLFTKSPRRRMLVAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN
Sbjct  103  DPESPDRTVSTVPWSLFTKSPRRRMLVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCN  162

Query  325  IYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDI  188
            ++HKLVDNLNLFH MKCYVN SF    D    F Y D DD ++++I
Sbjct  163  VFHKLVDNLNLFHGMKCYVNPSFRYKGDKP--FNYLDEDDGDDENI  206



>ref|XP_010935184.1| PREDICTED: uncharacterized protein LOC105055145 [Elaeis guineensis]
Length=207

 Score =   214 bits (544),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 127/166 (77%), Gaps = 13/166 (8%)
 Frame = -1

Query  658  NEPDLRSNSNDSSLVPIL---------SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  506
            +E DL ++S  ++LVP L         S+DAAMGLVL+AA  RGWTTGSGMEGP +PA S
Sbjct  42   DEADLHADSESTNLVPFLKNSTSVSPLSKDAAMGLVLNAAAGRGWTTGSGMEGPPIPADS  101

Query  505  NPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCN  326
              ++    VSTFPWSLFTKSPRRRMLVAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN
Sbjct  102  --DSTNRTVSTFPWSLFTKSPRRRMLVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCN  159

Query  325  IYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDI  188
            ++HKLVDNLNLFH++KCYVN +F    D    F Y   DD ++++I
Sbjct  160  VFHKLVDNLNLFHEIKCYVNPNFLHKGDTP--FNYLGEDDGDDENI  203



>ref|XP_009391023.1| PREDICTED: uncharacterized protein LOC103977279 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=207

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 121/168 (72%), Gaps = 15/168 (9%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILSQ-----------DAAMGLVLSAANVRGWTTGSGMEGP  524
            +   N+ DL S S  +SLVP L             D AMGLVLSAA  RGWTTGSGMEGP
Sbjct  38   KSRENDADLNSVSESTSLVPFLGNRARAPLSPFPNDTAMGLVLSAAAGRGWTTGSGMEGP  97

Query  523  SVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFV  344
             +PA S  ++  + V TFPWSL+T+SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFV
Sbjct  98   RIPAYS--DSADQTVLTFPWSLYTRSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFV  155

Query  343  QCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDN  200
            QCCGCN++HKLVDNLNLFH+MKCYVN SF    D  + F Y D DDD 
Sbjct  156  QCCGCNVFHKLVDNLNLFHEMKCYVNPSFRYKGD--VSFNYMDADDDQ  201



>ref|XP_009391021.1| PREDICTED: uncharacterized protein LOC103977279 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=246

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 120/164 (73%), Gaps = 15/164 (9%)
 Frame = -1

Query  658  NEPDLRSNSNDSSLVPILSQ-----------DAAMGLVLSAANVRGWTTGSGMEGPSVPA  512
            N+ DL S S  +SLVP L             D AMGLVLSAA  RGWTTGSGMEGP +PA
Sbjct  81   NDADLNSVSESTSLVPFLGNRARAPLSPFPNDTAMGLVLSAAAGRGWTTGSGMEGPRIPA  140

Query  511  GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCG  332
             S  ++  + V TFPWSL+T+SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCG
Sbjct  141  YS--DSADQTVLTFPWSLYTRSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCG  198

Query  331  CNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDN  200
            CN++HKLVDNLNLFH+MKCYVN SF    D  + F Y D DDD 
Sbjct  199  CNVFHKLVDNLNLFHEMKCYVNPSFRYKGD--VSFNYMDADDDQ  240



>ref|XP_009391022.1| PREDICTED: uncharacterized protein LOC103977279 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=245

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 121/168 (72%), Gaps = 15/168 (9%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILSQ-----------DAAMGLVLSAANVRGWTTGSGMEGP  524
            +   N+ DL S S  +SLVP L             D AMGLVLSAA  RGWTTGSGMEGP
Sbjct  76   KSRENDADLNSVSESTSLVPFLGNRARAPLSPFPNDTAMGLVLSAAAGRGWTTGSGMEGP  135

Query  523  SVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFV  344
             +PA S  ++  + V TFPWSL+T+SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFV
Sbjct  136  RIPAYS--DSADQTVLTFPWSLYTRSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFV  193

Query  343  QCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDN  200
            QCCGCN++HKLVDNLNLFH+MKCYVN SF    D  + F Y D DDD 
Sbjct  194  QCCGCNVFHKLVDNLNLFHEMKCYVNPSFRYKGD--VSFNYMDADDDQ  239



>ref|XP_009418558.1| PREDICTED: uncharacterized protein LOC103998726 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 123/164 (75%), Gaps = 13/164 (8%)
 Frame = -1

Query  661  GNEPDLRSNSNDSSLVPILS---------QDAAMGLVLSAANVRGWTTGSGMEGPSVPAG  509
            G++ DL S+S  +SLVP L          +D AMGLVLSAA  RGWTTGSGMEGP +PA 
Sbjct  41   GDDADLNSDSESTSLVPFLGNRAPISPLPKDKAMGLVLSAAAGRGWTTGSGMEGPPIPAD  100

Query  508  SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  329
            S  ++    V TFPWSL+T+SPRRRM VAFTC +CGQRTTRAINPHAYTDGTVFVQCCGC
Sbjct  101  S--DSADRTVLTFPWSLYTRSPRRRMRVAFTCNICGQRTTRAINPHAYTDGTVFVQCCGC  158

Query  328  NIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNE  197
            N++HKLVDNLNLFH+MKCYVN SF    D  + F + D DDD +
Sbjct  159  NVFHKLVDNLNLFHEMKCYVNPSFRYKGD--MPFNHIDADDDQD  200



>ref|XP_007142794.1| hypothetical protein PHAVU_007G017400g [Phaseolus vulgaris]
 gb|ESW14788.1| hypothetical protein PHAVU_007G017400g [Phaseolus vulgaris]
Length=214

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 122/149 (82%), Gaps = 7/149 (5%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKS  446
            SL P LS+DAAMGLVLSAA  RGWTTGSGMEGPSVPA G + E+G   +STFPWSLFTKS
Sbjct  68   SLSP-LSKDAAMGLVLSAAVGRGWTTGSGMEGPSVPAVGRDNESG--NISTFPWSLFTKS  124

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY+N
Sbjct  125  PRRRMLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCYLN  184

Query  265  SSFNPNPD--NSLGFKYFDLDDDNEDDIP  185
            SSF    +  + L F+Y D D+D+ED  P
Sbjct  185  SSFKYKGEGWDDLKFRYMD-DNDDEDTFP  212



>ref|XP_010421645.1| PREDICTED: uncharacterized protein LOC104707070 isoform X1 [Camelina 
sativa]
Length=234

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 116/137 (85%), Gaps = 9/137 (7%)
 Frame = -1

Query  655  EPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETG  491
            +P  +S SN SSLVP+     LS D AMGLVLSAA+V+GWTTGSGMEGPS+PA  + ET 
Sbjct  61   DPPQQSESNSSSLVPLFQNRTLSNDEAMGLVLSAASVKGWTTGSGMEGPSLPAKPDTET-  119

Query  490  MEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKL  311
               VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKL
Sbjct  120  ---VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKL  176

Query  310  VDNLNLFHDMKCYVNSS  260
            VDNLNLFH++K YV+SS
Sbjct  177  VDNLNLFHEVKYYVSSS  193



>ref|XP_010421646.1| PREDICTED: uncharacterized protein LOC104707070 isoform X2 [Camelina 
sativa]
Length=223

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 116/137 (85%), Gaps = 9/137 (7%)
 Frame = -1

Query  655  EPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETG  491
            +P  +S SN SSLVP+     LS D AMGLVLSAA+V+GWTTGSGMEGPS+PA  + ET 
Sbjct  50   DPPQQSESNSSSLVPLFQNRTLSNDEAMGLVLSAASVKGWTTGSGMEGPSLPAKPDTET-  108

Query  490  MEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKL  311
               VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKL
Sbjct  109  ---VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKL  165

Query  310  VDNLNLFHDMKCYVNSS  260
            VDNLNLFH++K YV+SS
Sbjct  166  VDNLNLFHEVKYYVSSS  182



>ref|NP_001235094.1| uncharacterized protein LOC100527113 [Glycine max]
 gb|ACU16158.1| unknown [Glycine max]
 gb|KHN11510.1| Hypothetical protein glysoja_015405 [Glycine soja]
Length=215

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 115/138 (83%), Gaps = 4/138 (3%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKS  446
            SL P LS+DAAMGLVLSAA  RGWTTGSGMEGPSVPA G + E+G   +STFPWSLFTKS
Sbjct  67   SLSP-LSKDAAMGLVLSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKS  125

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY+N
Sbjct  126  PRRRMLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCYLN  185

Query  265  SSFNPNPD--NSLGFKYF  218
            SSFN   +  + L F+Y 
Sbjct  186  SSFNYKGEGWDDLKFRYM  203



>gb|KHN37381.1| Hypothetical protein glysoja_013596 [Glycine soja]
Length=217

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 115/138 (83%), Gaps = 4/138 (3%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKS  446
            SL P LS+DAAMGLVLSAA  RGWTTGSGMEGPSVPA G + E+G   +STFPWSLFTKS
Sbjct  68   SLSP-LSKDAAMGLVLSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKS  126

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY+N
Sbjct  127  PRRRMLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCYLN  186

Query  265  SSFNPNPD--NSLGFKYF  218
            SSFN   +  + L F+Y 
Sbjct  187  SSFNYKGEGWDDLKFRYM  204



>ref|XP_006588421.1| PREDICTED: uncharacterized protein LOC100527474 isoform X2 [Glycine 
max]
Length=210

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 115/138 (83%), Gaps = 4/138 (3%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKS  446
            SL P LS+DAAMGLVLSAA  RGWTTGSGMEGPSVPA G + E+G   +STFPWSLFTKS
Sbjct  61   SLSP-LSKDAAMGLVLSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKS  119

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY+N
Sbjct  120  PRRRMLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCYLN  179

Query  265  SSFNPNPD--NSLGFKYF  218
            SSFN   +  + L F+Y 
Sbjct  180  SSFNYKGEGWDDLKFRYM  197



>ref|XP_002874388.1| hypothetical protein ARALYDRAFT_489599 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50647.1| hypothetical protein ARALYDRAFT_489599 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 9/133 (7%)
 Frame = -1

Query  643  RSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQV  479
            +S SN SSLVP+     LS D AMGLVLSAA+V+GWTTGSGMEGPS+PA  + ET    V
Sbjct  53   QSESNSSSLVPLFRNRTLSNDEAMGLVLSAASVKGWTTGSGMEGPSLPAKPDTET----V  108

Query  478  STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
            STFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNL
Sbjct  109  STFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNL  168

Query  298  NLFHDMKCYVNSS  260
            NLFH++K YV+SS
Sbjct  169  NLFHEVKYYVSSS  181



>ref|XP_011458699.1| PREDICTED: uncharacterized protein LOC105349780 [Fragaria vesca 
subsp. vesca]
Length=211

 Score =   209 bits (532),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSP  443
            SL P LS+DAAMGLV+ AA  RGWTTGSGMEGP  PAG +  +  E VSTFPWSLFTKSP
Sbjct  62   SLSP-LSKDAAMGLVMGAATGRGWTTGSGMEGPPTPAGIDSRSSTENVSTFPWSLFTKSP  120

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNS  263
            RRRMLVAFTC +CGQRTTRAINPHA+TDGTVFVQCCGCN +HKLVDNLNLFH+MKCYV+ 
Sbjct  121  RRRMLVAFTCNICGQRTTRAINPHAFTDGTVFVQCCGCNAFHKLVDNLNLFHEMKCYVSP  180

Query  262  SFN--PNPDNSLGFKYFDL  212
             F+   N  +++ FKY ++
Sbjct  181  GFDYKGNGWDAVNFKYLEM  199



>ref|NP_001236547.1| uncharacterized protein LOC100527474 [Glycine max]
 gb|ACU16568.1| unknown [Glycine max]
Length=217

 Score =   209 bits (532),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 115/138 (83%), Gaps = 4/138 (3%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKS  446
            SL P LS+DAAMGLVLSAA  RGWTTGSGMEGPSVPA G + E+G   +STFPWSLFTKS
Sbjct  68   SLSP-LSKDAAMGLVLSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKS  126

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRRRML+AFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY+N
Sbjct  127  PRRRMLMAFTCTICGQRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCYLN  186

Query  265  SSFNPNPD--NSLGFKYF  218
            SSFN   +  + L F+Y 
Sbjct  187  SSFNYKGEGWDDLKFRYM  204



>ref|XP_006588420.1| PREDICTED: uncharacterized protein LOC100527474 isoform X1 [Glycine 
max]
Length=222

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 120/159 (75%), Gaps = 18/159 (11%)
 Frame = -1

Query  640  SNSNDSSLVPILS---------------QDAAMGLVLSAANVRGWTTGSGMEGPSVPA-G  509
            S+S + + +PILS               QDAAMGLVLSAA  RGWTTGSGMEGPSVPA G
Sbjct  51   SDSKEKNKLPILSDRCLSLSPLSKKLWGQDAAMGLVLSAATGRGWTTGSGMEGPSVPAVG  110

Query  508  SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  329
             + E+G   +STFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGC
Sbjct  111  RDSESGTGNISTFPWSLFTKSPRRRMLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGC  170

Query  328  NIYHKLVDNLNLFHDMKCYVNSSFNPNPD--NSLGFKYF  218
            N YHKLVD+LNLF +  CY+NSSFN   +  + L F+Y 
Sbjct  171  NAYHKLVDHLNLFQETNCYLNSSFNYKGEGWDDLKFRYM  209



>ref|XP_004497201.1| PREDICTED: uncharacterized protein LOC101505438 [Cicer arietinum]
Length=231

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 126/170 (74%), Gaps = 20/170 (12%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSNDS--------------SLVPILSQDAAMGLVLSAANVRGWTTGS  539
            S R +G++ D +S S D               SL P LS DAAMGLVLSAA  RGWTTGS
Sbjct  42   SKRDDGHDLDSKSKSKDEINNINLPILSHRRLSLSP-LSNDAAMGLVLSAATGRGWTTGS  100

Query  538  GMEGPSVPA-GSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYT  362
            GMEGPSVPA GS+ + G   +STFPWSLFTKSPRRRMLVAFTC +CGQRTTRAINPHAYT
Sbjct  101  GMEGPSVPAVGSDDQLGTGNISTFPWSLFTKSPRRRMLVAFTCTICGQRTTRAINPHAYT  160

Query  361  DGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFN---PNPDNSLGFKY  221
            DGTVFVQCCGCN YHKLVD+LNLF +  CY+NSSFN   P  D+ L F+Y
Sbjct  161  DGTVFVQCCGCNAYHKLVDHLNLFQETNCYLNSSFNYKGPGWDD-LKFRY  209



>ref|XP_006405268.1| hypothetical protein EUTSA_v10027929mg [Eutrema salsugineum]
 gb|ESQ46721.1| hypothetical protein EUTSA_v10027929mg [Eutrema salsugineum]
Length=215

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 114/134 (85%), Gaps = 9/134 (7%)
 Frame = -1

Query  640  SNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVS  476
            S  N SSLVP+      S D AMGLVL+AA+VRGWTTGSGMEGPS+PA ++ ET    VS
Sbjct  51   SELNSSSLVPLFQNRTFSDDEAMGLVLNAASVRGWTTGSGMEGPSLPAKADTET----VS  106

Query  475  TFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLN  296
            TFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAY+DGTVFVQCCGCN++HKLVDNLN
Sbjct  107  TFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYSDGTVFVQCCGCNVFHKLVDNLN  166

Query  295  LFHDMKCYVNSSFN  254
            LFH++K YV+SSFN
Sbjct  167  LFHEVKYYVSSSFN  180



>ref|XP_006605315.1| PREDICTED: uncharacterized protein LOC100527113 isoform X1 [Glycine 
max]
Length=220

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 111/134 (83%), Gaps = 3/134 (2%)
 Frame = -1

Query  610  ILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKSPRRR  434
            +  QDAAMGLVLSAA  RGWTTGSGMEGPSVPA G + E+G   +STFPWSLFTKSPRRR
Sbjct  75   LWGQDAAMGLVLSAATGRGWTTGSGMEGPSVPAVGRDSESGTGNISTFPWSLFTKSPRRR  134

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFN  254
            MLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY+NSSFN
Sbjct  135  MLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCYLNSSFN  194

Query  253  PNPD--NSLGFKYF  218
               +  + L F+Y 
Sbjct  195  YKGEGWDDLKFRYM  208



>ref|XP_010455141.1| PREDICTED: uncharacterized protein LOC104736783 isoform X1 [Camelina 
sativa]
Length=229

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 115/137 (84%), Gaps = 9/137 (7%)
 Frame = -1

Query  655  EPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETG  491
            +P  +S SN SSLVP+     LS D AMGLVLSAA+V+GWTTGSGMEGPS+PA  + ET 
Sbjct  61   DPPQQSESNSSSLVPLFQNRTLSNDEAMGLVLSAASVKGWTTGSGMEGPSLPAKPDTET-  119

Query  490  MEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKL  311
               VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKL
Sbjct  120  ---VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKL  176

Query  310  VDNLNLFHDMKCYVNSS  260
            VDNLNLFH++K  V+SS
Sbjct  177  VDNLNLFHEVKYNVSSS  193



>ref|XP_009414426.1| PREDICTED: uncharacterized protein LOC103995548 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 120/167 (72%), Gaps = 13/167 (8%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILS---------QDAAMGLVLSAANVRGWTTGSGMEGPSV  518
            +   +E DL S S  +SLVP LS         +D AMGLVLSAA  RGWTTGSGMEGP V
Sbjct  38   KNREDEADLSSKSESTSLVPFLSNRAPISPLPKDTAMGLVLSAATGRGWTTGSGMEGPPV  97

Query  517  PAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQC  338
            PA +  ++  + V TFPWSL+T+SPRRRM V FTC VCGQRTTRAINPHAYTDGTVFVQC
Sbjct  98   PADT--DSADQAVLTFPWSLYTRSPRRRMRVVFTCNVCGQRTTRAINPHAYTDGTVFVQC  155

Query  337  CGCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNE  197
            CGCN++HKLVDNLNLFH MKCYV+ SF    D  +   Y D D D +
Sbjct  156  CGCNVFHKLVDNLNLFHGMKCYVSPSFRYKGD--MPIDYTDADGDQD  200



>ref|XP_010455142.1| PREDICTED: uncharacterized protein LOC104736783 isoform X2 [Camelina 
sativa]
Length=218

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 115/137 (84%), Gaps = 9/137 (7%)
 Frame = -1

Query  655  EPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETG  491
            +P  +S SN SSLVP+     LS D AMGLVLSAA+V+GWTTGSGMEGPS+PA  + ET 
Sbjct  50   DPPQQSESNSSSLVPLFQNRTLSNDEAMGLVLSAASVKGWTTGSGMEGPSLPAKPDTET-  108

Query  490  MEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKL  311
               VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKL
Sbjct  109  ---VSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKL  165

Query  310  VDNLNLFHDMKCYVNSS  260
            VDNLNLFH++K  V+SS
Sbjct  166  VDNLNLFHEVKYNVSSS  182



>ref|XP_010690316.1| PREDICTED: uncharacterized protein LOC104903883 [Beta vulgaris 
subsp. vulgaris]
Length=237

 Score =   207 bits (527),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 126/171 (74%), Gaps = 12/171 (7%)
 Frame = -1

Query  676  SPRGNGNEPDLRSNSNDSSLVPI----------LSQDAAMGLVLSAANVRGWTTGSGMEG  527
            S +G  +E  ++S S D  +VP+          LS+D AMGLVL+AA  +GWTTGSGMEG
Sbjct  63   SSKGRDDESHIQSESKDMRIVPLADNQRLSLSPLSKDCAMGLVLNAATGKGWTTGSGMEG  122

Query  526  PSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVF  347
            P   AG + E+   ++STFPWSLFTKSPRRRML+AFTC +C QRTTRAINPHAYTDGTVF
Sbjct  123  PPESAG-DAESSNAKISTFPWSLFTKSPRRRMLIAFTCNICSQRTTRAINPHAYTDGTVF  181

Query  346  VQCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNS-LGFKYFDLDDDNE  197
            VQCCGCN YHKLVDNLNLF  MKCY+NSSF    +   + F+Y D+D+ ++
Sbjct  182  VQCCGCNAYHKLVDNLNLFDGMKCYLNSSFKYGGNGGDVNFEYRDVDNGDD  232



>gb|AFK34110.1| unknown [Lotus japonicus]
Length=244

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 114/139 (82%), Gaps = 5/139 (4%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKS  446
            SL P LS+DAAMGLVLSAA  RGWTTGSGMEGPS PA G + E+G   +STFPWSLFTKS
Sbjct  90   SLSP-LSKDAAMGLVLSAAMGRGWTTGSGMEGPSAPAAGRDNESGTGNISTFPWSLFTKS  148

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRRRMLVAFTC +CGQRTTRAINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY+N
Sbjct  149  PRRRMLVAFTCTICGQRTTRAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCYLN  208

Query  265  SSFN---PNPDNSLGFKYF  218
            SSFN   P  ++ L  +Y 
Sbjct  209  SSFNYKGPVWNDELKLRYM  227



>ref|XP_008643737.1| PREDICTED: LOC100283270 isoform X1 [Zea mays]
 gb|AFW69541.1| DNL zinc finger family protein [Zea mays]
Length=208

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 117/164 (71%), Gaps = 5/164 (3%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPI--LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPE  497
            +G+G+EP     S     + I  LS+DAAMGLV+SAA   GWTTGSGMEGP   A     
Sbjct  47   KGSGSEPRREPTSLAPYGISISPLSKDAAMGLVVSAATGSGWTTGSGMEGPPT-ASKAGG  105

Query  496  TGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYH  317
             G  +VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++H
Sbjct  106  AGRPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFH  165

Query  316  KLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDIP  185
            KLVDNLNLFH+MKCYV   F    D    F Y D ++DN+   P
Sbjct  166  KLVDNLNLFHEMKCYVGPDFRYQGDAP--FNYLDPNEDNDTTFP  207



>ref|XP_010028773.1| PREDICTED: uncharacterized protein LOC104418983 [Eucalyptus grandis]
 gb|KCW55588.1| hypothetical protein EUGRSUZ_I01459 [Eucalyptus grandis]
Length=220

 Score =   205 bits (521),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 118/152 (78%), Gaps = 15/152 (10%)
 Frame = -1

Query  658  NEPDLRSNSNDSSLVPI----------LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAG  509
            NE D++S+S D S+ P+          LS++ AMGLVL+AA  RGWTTGSG+EGP VPA 
Sbjct  53   NEADVQSDSRDLSIAPVRKDRSLSISPLSKETAMGLVLNAAVGRGWTTGSGLEGPPVPAE  112

Query  508  SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  329
            +  E+  E  ST P+SLFTKSPRRRMLVAFTC +C QRTTRAINPHAYTDGTVFVQCCGC
Sbjct  113  T--ESSSEDTSTLPFSLFTKSPRRRMLVAFTCNICRQRTTRAINPHAYTDGTVFVQCCGC  170

Query  328  NIYHKLVDNLNLFHDMKCYVNSSFN---PNPD  242
            N YHKLVDNLNLFH+M CY+NSSFN   PN D
Sbjct  171  NAYHKLVDNLNLFHEMNCYINSSFNYSGPNLD  202



>ref|NP_198080.1| Zim17-type zinc finger protein [Arabidopsis thaliana]
 gb|AAB61076.1| A_TM021B04.14 gene product [Arabidopsis thaliana]
 gb|AAL24413.1| unknown protein [Arabidopsis thaliana]
 gb|AAM10131.1| unknown protein [Arabidopsis thaliana]
 gb|AED93666.1| Zim17-type zinc finger protein [Arabidopsis thaliana]
Length=212

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 111/129 (86%), Gaps = 6/129 (5%)
 Frame = -1

Query  640  SNSNDSSLVP--ILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFP  467
            S SN SSL     LS D AMGLVLSAA+V+GWTTGSGMEGPS+PA ++ +T    VSTFP
Sbjct  54   SESNSSSLFRNRTLSNDEAMGLVLSAASVKGWTTGSGMEGPSLPAKTDTDT----VSTFP  109

Query  466  WSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFH  287
            WSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH
Sbjct  110  WSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFH  169

Query  286  DMKCYVNSS  260
            ++K YV+SS
Sbjct  170  EVKYYVSSS  178



>gb|AAM64347.1| unknown [Arabidopsis thaliana]
Length=212

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 111/129 (86%), Gaps = 6/129 (5%)
 Frame = -1

Query  640  SNSNDSSLVP--ILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFP  467
            S SN  SL    ILS D AMGLVLSAA+V+GWTTGSGMEGPS+PA ++ +T    VSTFP
Sbjct  54   SESNSPSLFRNRILSNDEAMGLVLSAASVKGWTTGSGMEGPSLPAKTDTDT----VSTFP  109

Query  466  WSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFH  287
            WSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH
Sbjct  110  WSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFH  169

Query  286  DMKCYVNSS  260
            ++K YV+SS
Sbjct  170  EVKYYVSSS  178



>ref|XP_006288620.1| hypothetical protein CARUB_v10001922mg [Capsella rubella]
 gb|EOA21518.1| hypothetical protein CARUB_v10001922mg [Capsella rubella]
Length=220

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 9/143 (6%)
 Frame = -1

Query  664  NGNEPDLRSNSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNP  500
            N  +P    +++ SSLVP+     LS D AMGLVLSAA+V+GWTTGSGMEGPS+PA  + 
Sbjct  47   NDYDPQQSESNSSSSLVPLFQNRTLSNDEAMGLVLSAASVKGWTTGSGMEGPSLPAKPD-  105

Query  499  ETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIY  320
              G E VSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++
Sbjct  106  --GTETVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVF  163

Query  319  HKLVDNLNLFHDMKCYVN-SSFN  254
            HKLVDNLNLFH++K YV+ SSFN
Sbjct  164  HKLVDNLNLFHEVKYYVSRSSFN  186



>gb|AFK39869.1| unknown [Lotus japonicus]
Length=243

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 114/139 (82%), Gaps = 5/139 (4%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKS  446
            SL P LS+DAAMGLVLSAA  RGWTTGSG+EGPS PA G + E+G   +STFPWSLFTKS
Sbjct  89   SLSP-LSKDAAMGLVLSAAMGRGWTTGSGVEGPSAPAAGRDNESGTGDISTFPWSLFTKS  147

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRRRMLVAFTC +CGQRTT+AINPHAYTDGTVFVQCCGCN YHKLVD+LNLF +  CY+N
Sbjct  148  PRRRMLVAFTCTICGQRTTQAINPHAYTDGTVFVQCCGCNAYHKLVDHLNLFQETNCYLN  207

Query  265  SSFN---PNPDNSLGFKYF  218
            SSFN   P  ++ L  +Y 
Sbjct  208  SSFNYKGPVWNDELKLRYM  226



>ref|XP_003563260.1| PREDICTED: uncharacterized protein LOC100844750 [Brachypodium 
distachyon]
Length=210

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 109/145 (75%), Gaps = 7/145 (5%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSP  443
            SL P  S+DAAMGLV+SAA   GWTTGSGMEGP     +N      +VST PWSLFTKSP
Sbjct  69   SLSP-FSKDAAMGLVMSAATGSGWTTGSGMEGPPTAGAAN----RPEVSTLPWSLFTKSP  123

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNS  263
            RRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCYV  
Sbjct  124  RRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCYVGP  183

Query  262  SFNPNPDNSLGFKYFDLDDDNEDDI  188
             F    D    F Y D D+D E +I
Sbjct  184  DFRYEGDAP--FNYLDGDEDGEGNI  206



>ref|XP_002439041.1| hypothetical protein SORBIDRAFT_10g030440 [Sorghum bicolor]
 gb|EER90408.1| hypothetical protein SORBIDRAFT_10g030440 [Sorghum bicolor]
Length=214

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 114/161 (71%), Gaps = 4/161 (2%)
 Frame = -1

Query  667  GNGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGM  488
            G G EP   +     S+ P LS+DAAMGLV+SAA   GWTTGSGMEGP   A      G 
Sbjct  57   GPGREPTSLAPYGGLSISP-LSKDAAMGLVVSAATGSGWTTGSGMEGPPT-ASKAGGAGR  114

Query  487  EQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLV  308
             +VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLV
Sbjct  115  PEVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLV  174

Query  307  DNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDIP  185
            DNLNLFH+MKCYV   F    D    F Y D ++D +   P
Sbjct  175  DNLNLFHEMKCYVGPDFRYEGDAP--FNYLDRNEDGDTIFP  213



>gb|EAZ38321.1| hypothetical protein OsJ_22696 [Oryza sativa Japonica Group]
Length=205

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 111/146 (76%), Gaps = 6/146 (4%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSP  443
            S++P LS+DAAMGLV+SAA  RGWTTGSGMEGP   AG        +VST PWSLFTKSP
Sbjct  64   SILP-LSKDAAMGLVVSAATGRGWTTGSGMEGPPKAAGGGDR---PEVSTLPWSLFTKSP  119

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNS  263
            RRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCYV  
Sbjct  120  RRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCYVGP  179

Query  262  SFNPNPDNSLGFKYFDLDDDNEDDIP  185
             F    D    F Y D  +D ++  P
Sbjct  180  DFRYEGDAP--FNYLDRGEDGDNIFP  203



>gb|KEH44399.1| DNL zinc finger protein [Medicago truncatula]
Length=231

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 103/118 (87%), Gaps = 1/118 (1%)
 Frame = -1

Query  607  LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKSPRRRM  431
            LS DAAMGLVLSAA  RGWTTGSGMEGP VPA G + ++G E +STFPWSLFTKSPRRRM
Sbjct  85   LSNDAAMGLVLSAATGRGWTTGSGMEGPPVPAVGKDGQSGTENISTFPWSLFTKSPRRRM  144

Query  430  LVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            L+AFTC +CGQRTTRAINPHAYTDGTVFVQCC CN YHKLVD+LNLF +  CY+NSSF
Sbjct  145  LIAFTCTICGQRTTRAINPHAYTDGTVFVQCCECNAYHKLVDHLNLFQETNCYLNSSF  202



>ref|NP_001131303.1| uncharacterized protein LOC100192616 [Zea mays]
 gb|ACF79647.1| unknown [Zea mays]
Length=211

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 117/169 (69%), Gaps = 13/169 (8%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPI------LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAG  509
            +G+ +EP        +SL P       LS+DAAMGLV+SAA   GWTTGSGMEGP   A 
Sbjct  50   KGSSSEP----RREPTSLAPYGLSISPLSKDAAMGLVVSAATGSGWTTGSGMEGPPT-AS  104

Query  508  SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGC  329
                 G  +VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGC
Sbjct  105  KAGGAGRPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGC  164

Query  328  NIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDIPQ  182
            N++HKLVDNLNLFH+MKCYV   F    D    F Y D ++D +   P+
Sbjct  165  NVFHKLVDNLNLFHEMKCYVGPDFRYEGDAP--FNYLDRNEDGDSIFPR  211



>gb|AFK48753.1| unknown [Medicago truncatula]
Length=230

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 103/118 (87%), Gaps = 1/118 (1%)
 Frame = -1

Query  607  LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPA-GSNPETGMEQVSTFPWSLFTKSPRRRM  431
            LS DAAMGLVLSAA  RGWTTGSGMEGP VPA G + ++G E +STFPWSLFTKSPRRRM
Sbjct  85   LSNDAAMGLVLSAATGRGWTTGSGMEGPPVPAVGKDGQSGTENISTFPWSLFTKSPRRRM  144

Query  430  LVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            L+AFTC +CGQRTTRAINPHAYTDGTVFVQCC CN YHKLVD+LNLF +  CY+NSSF
Sbjct  145  LIAFTCTICGQRTTRAINPHAYTDGTVFVQCCECNAYHKLVDHLNLFQETNCYLNSSF  202



>ref|NP_001058612.2| Os06g0724400 [Oryza sativa Japonica Group]
 dbj|BAD61688.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD62532.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20526.2| Os06g0724400 [Oryza sativa Japonica Group]
Length=205

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 107/141 (76%), Gaps = 5/141 (4%)
 Frame = -1

Query  607  LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRML  428
            LS+DAAMGLV+SAA  RGWTTGSGMEGP   AG        +VST PWSLFTKSPRRRM 
Sbjct  68   LSKDAAMGLVVSAATGRGWTTGSGMEGPPKAAGGGDR---PEVSTLPWSLFTKSPRRRMR  124

Query  427  VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPN  248
            VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCYV   F   
Sbjct  125  VAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCYVGPDFRYE  184

Query  247  PDNSLGFKYFDLDDDNEDDIP  185
             D    F Y D  +D ++  P
Sbjct  185  GDAP--FNYLDRGEDGDNIFP  203



>ref|XP_010494029.1| PREDICTED: uncharacterized protein LOC104771232 [Camelina sativa]
Length=223

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 9/125 (7%)
 Frame = -1

Query  619  LVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLF  455
            LVP+     LS D AMGLVLSAA+V+GWTTGSGMEGPS+PA  + ET    VSTFPWSLF
Sbjct  62   LVPLFQNRTLSNDEAMGLVLSAASVKGWTTGSGMEGPSLPAKPDTET----VSTFPWSLF  117

Query  454  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKC  275
            TKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH++K 
Sbjct  118  TKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEVKY  177

Query  274  YVNSS  260
            Y++SS
Sbjct  178  YLSSS  182



>gb|EAZ02398.1| hypothetical protein OsI_24501 [Oryza sativa Indica Group]
Length=205

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 107/141 (76%), Gaps = 5/141 (4%)
 Frame = -1

Query  607  LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRML  428
            LS+DAAMGLV+SAA  RGWTTGSGMEGP   AG        +VST PWSLFTKSPRRRM 
Sbjct  68   LSKDAAMGLVVSAATGRGWTTGSGMEGPPKAAGGGDR---PEVSTLPWSLFTKSPRRRMR  124

Query  427  VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPN  248
            VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCYV   F   
Sbjct  125  VAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCYVGPDFRYE  184

Query  247  PDNSLGFKYFDLDDDNEDDIP  185
             D    F Y D  +D ++  P
Sbjct  185  GDAP--FNYLDRGEDGDNIFP  203



>emb|CDY12988.1| BnaC02g29950D [Brassica napus]
Length=214

 Score =   199 bits (507),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 108/128 (84%), Gaps = 9/128 (7%)
 Frame = -1

Query  637  NSNDSSLVPI-----LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVST  473
             S+  SLVP+     LS D AMGLVLSAA+VRGWTTGSGMEGPS+PA ++ ET    +ST
Sbjct  52   ESDSLSLVPLFQNRTLSNDEAMGLVLSAASVRGWTTGSGMEGPSLPAKADAET----IST  107

Query  472  FPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            FPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGC ++HKLVDNLNL
Sbjct  108  FPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCYVFHKLVDNLNL  167

Query  292  FHDMKCYV  269
            FH++K YV
Sbjct  168  FHEVKYYV  175



>ref|XP_004966483.1| PREDICTED: uncharacterized protein LOC101768670 [Setaria italica]
Length=209

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 116/162 (72%), Gaps = 6/162 (4%)
 Frame = -1

Query  667  GNGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETG-  491
            G G EP   +     S+ P LS+DAAMGLV+SAA   GWTTGSGMEGP  PA S      
Sbjct  52   GPGREPTSLAPYGGLSISP-LSKDAAMGLVVSAATGSGWTTGSGMEGP--PAASRAGGAD  108

Query  490  MEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKL  311
              +VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKL
Sbjct  109  RPEVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKL  168

Query  310  VDNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDIP  185
            VDNLNLFH+MKCYV+  F    D    F Y D ++D +   P
Sbjct  169  VDNLNLFHEMKCYVSPDFRYEGDAP--FNYLDNNEDGDTIFP  208



>ref|XP_006656504.1| PREDICTED: uncharacterized protein LOC102700628 [Oryza brachyantha]
Length=205

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 114/161 (71%), Gaps = 6/161 (4%)
 Frame = -1

Query  667  GNGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGM  488
            G G+E    +     SL P LS+DAAMGLV+SAA   GWTTGSGMEGP   AG       
Sbjct  49   GAGHEHTSLAPYAGLSLSP-LSKDAAMGLVVSAATGSGWTTGSGMEGPPKAAGGADR---  104

Query  487  EQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLV  308
             +VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLV
Sbjct  105  PEVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLV  164

Query  307  DNLNLFHDMKCYVNSSFNPNPDNSLGFKYFDLDDDNEDDIP  185
            DNLNLFH+MKCYV   F    D    F Y D  +D ++  P
Sbjct  165  DNLNLFHEMKCYVGPDFRYEGDAP--FNYLDRGEDGDNIFP  203



>ref|XP_006828828.1| hypothetical protein AMTR_s00001p00142230 [Amborella trichopoda]
 gb|ERM96244.1| hypothetical protein AMTR_s00001p00142230 [Amborella trichopoda]
Length=201

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 112/154 (73%), Gaps = 3/154 (2%)
 Frame = -1

Query  664  NGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGME  485
            N  EP+  S     S  P  S+DAAMGLVLSAA  RGWTTGSGMEGP V + ++     +
Sbjct  46   NHGEPENTSIVPQVSFAP-FSKDAAMGLVLSAATGRGWTTGSGMEGPPV-SEADVSNAQQ  103

Query  484  QVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVD  305
             VSTFPWSLFT+SPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQC GCNI+HKLVD
Sbjct  104  PVSTFPWSLFTRSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCAGCNIFHKLVD  163

Query  304  NLNLFHDMKCYVNSSF-NPNPDNSLGFKYFDLDD  206
            NLNLFH+M  YV+  F    P     F Y D+DD
Sbjct  164  NLNLFHEMTGYVHPKFIRREPKRDGPFDYLDIDD  197



>gb|ABK21254.1| unknown [Picea sitchensis]
Length=214

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = -1

Query  652  PDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVST  473
            P ++ +   S+ +  LS++ AMGLVL AA  RGWTTGSGMEGP+V AG    T M + S 
Sbjct  61   PLIKFHGKHSTSLQPLSKEVAMGLVLKAAGGRGWTTGSGMEGPAVSAGPKENTEMAEKSI  120

Query  472  FPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            +PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQC GC+++HKLVDNLNL
Sbjct  121  YPWSLFTKSPRRRMRVAFTCGVCGQRTTRAINPHAYTDGTVFVQCAGCDVFHKLVDNLNL  180

Query  292  FHDMKCYVNSSF-NPNPDNSLGFKYFDLDD  206
            FH++K  +   F N +      FK+ D+DD
Sbjct  181  FHELKGSIYPIFGNTSSKKPPSFKFLDMDD  210



>dbj|BAJ94825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=245

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 103/136 (76%), Gaps = 5/136 (4%)
 Frame = -1

Query  607  LSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRML  428
             S+DAAMGLV+SAA   GWTTGSGMEGP    G+       +VST PWSLFTKSPRRRM 
Sbjct  106  FSKDAAMGLVMSAATGSGWTTGSGMEGPPTAGGA---ANRPEVSTLPWSLFTKSPRRRMR  162

Query  427  VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPN  248
            VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVDNLNLFH+MKCYV   F   
Sbjct  163  VAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVDNLNLFHEMKCYVGPDFRYE  222

Query  247  PDNSLGFKYFDLDDDN  200
             D    F Y D  DD+
Sbjct  223  GDAP--FNYLDSGDDD  236



>ref|NP_001149644.1| LOC100283270 [Zea mays]
 gb|ACG36220.1| DNL zinc finger family protein [Zea mays]
 gb|AFW69540.1| DNL zinc finger family protein [Zea mays]
Length=133

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = -1

Query  589  MGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCK  410
            MGLV+SAA   GWTTGSGMEGP   A      G  +VST PWSLFTKSPRRRM VAFTC 
Sbjct  1    MGLVVSAATGSGWTTGSGMEGPPT-ASKAGGAGRPEVSTLPWSLFTKSPRRRMRVAFTCN  59

Query  409  VCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPNPDNSLG  230
            VCGQRTTRAINPHAYTDGTVFVQCCGCN++HKLVDNLNLFH+MKCYV   F    D    
Sbjct  60   VCGQRTTRAINPHAYTDGTVFVQCCGCNVFHKLVDNLNLFHEMKCYVGPDFRYQGDAP--  117

Query  229  FKYFDLDDDNEDDIP  185
            F Y D ++DN+   P
Sbjct  118  FNYLDPNEDNDTTFP  132



>gb|KJB14348.1| hypothetical protein B456_002G120700 [Gossypium raimondii]
Length=154

 Score =   171 bits (433),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 6/117 (5%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGS  506
            + +GN+ D++ + N++S+VP++     SQDAAMGLVLSAA+VRGWTTGSGMEGPSVPA +
Sbjct  34   KKDGNDSDIQYDPNNTSIVPLVGNQTFSQDAAMGLVLSAASVRGWTTGSGMEGPSVPART  93

Query  505  NP-ETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQC  338
            +  ++  EQVSTFPWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQ 
Sbjct  94   DDDQSNTEQVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQV  150



>gb|EMS65438.1| hypothetical protein TRIUR3_05242 [Triticum urartu]
Length=543

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 94/135 (70%), Gaps = 17/135 (13%)
 Frame = -1

Query  589  MGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCK  410
            MGLV+SAA   GWTTGSGMEGP +  G+       +VST PWSLFTKSPRRRM VAFTC 
Sbjct  1    MGLVMSAATGSGWTTGSGMEGPPMAGGA---ANRPEVSTLPWSLFTKSPRRRMRVAFTCN  57

Query  409  VCGQRTTRAINPHAYTDGTVFVQ--------------CCGCNIYHKLVDNLNLFHDMKCY  272
            VCGQRTTRAINPHAYTDGTVFVQ              CCGCNI+HKLVDNLNLFH+MKCY
Sbjct  58   VCGQRTTRAINPHAYTDGTVFVQNLPFHISVALNLKKCCGCNIFHKLVDNLNLFHEMKCY  117

Query  271  VNSSFNPNPDNSLGF  227
            V   F    D    +
Sbjct  118  VGPDFRYEGDAPFNY  132



>ref|XP_006386156.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
 gb|ERP63953.1| hypothetical protein POPTR_0002s01730g [Populus trichocarpa]
Length=189

 Score =   164 bits (416),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 91/108 (84%), Gaps = 5/108 (5%)
 Frame = -1

Query  646  LRSNSNDSSLVPIL-----SQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQ  482
            L+S+S+DSS+VP+      S+DAAMGLVLSAA+VRGWTTGSGMEGPSV A S      E+
Sbjct  46   LQSSSHDSSIVPLFNNPSFSKDAAMGLVLSAASVRGWTTGSGMEGPSVTAVSEDGFNTEK  105

Query  481  VSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQC  338
            VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQC
Sbjct  106  VSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQC  153



>ref|XP_002977585.1| hypothetical protein SELMODRAFT_58719, partial [Selaginella moellendorffii]
 gb|EFJ21589.1| hypothetical protein SELMODRAFT_58719, partial [Selaginella moellendorffii]
Length=105

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 83/109 (76%), Gaps = 4/109 (4%)
 Frame = -1

Query  610  ILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRM  431
            +LSQ+ AMGLVL AA+ +GWTT SG+EGP+  +  N     E      W L +KSPRRRM
Sbjct  1    LLSQEMAMGLVLQAASGKGWTTDSGLEGPAFTSKENSSLSEEN----QWPLLSKSPRRRM  56

Query  430  LVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
             VAFTC VCG RT RAINPHAYTDGTVFVQC GCN++HKLVDNLNLF++
Sbjct  57   RVAFTCNVCGARTMRAINPHAYTDGTVFVQCKGCNVFHKLVDNLNLFYE  105



>gb|EMT02176.1| hypothetical protein F775_14553 [Aegilops tauschii]
Length=564

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  484  QVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVD  305
            +VST PWSLFTKSPRRRM VAFTC VCGQRTTRAINPHAYTDGTVFVQCCGCNI+HKLVD
Sbjct  10   EVSTLPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNIFHKLVD  69

Query  304  NLNLFHDMKCYVNSSFNPNPDNSLGF  227
            NLNLFH+MKCYV   F    D    +
Sbjct  70   NLNLFHEMKCYVGPDFRYEGDAPFNY  95



>ref|XP_001760208.1| predicted protein [Physcomitrella patens]
 gb|EDQ74964.1| predicted protein [Physcomitrella patens]
Length=283

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 86/118 (73%), Gaps = 10/118 (8%)
 Frame = -1

Query  601  QDAAMGLVLSAA-NVRGWTTGSGMEGPSVPAGSNPETGMEQVS-TFPWSLFTKSPRRRML  428
             D AMG++L+AA +  GWTTGSG+EGPS P        ME+ +   P  +F+KSPRRRM 
Sbjct  160  HDEAMGIILNAAGSTAGWTTGSGLEGPSYP--------MEEAANEMPGPIFSKSPRRRMR  211

Query  427  VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFN  254
            VAFTC VCG R+ RAINPHAYTDGTVFVQC GC+++HKLVDNL LFH++K  +   + 
Sbjct  212  VAFTCNVCGHRSIRAINPHAYTDGTVFVQCEGCDVFHKLVDNLKLFHELKGRIYKGYE  269



>gb|EYU17552.1| hypothetical protein MIMGU_mgv1a023730mg [Erythranthe guttata]
Length=154

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 84/145 (58%), Gaps = 32/145 (22%)
 Frame = -1

Query  607  LSQDAAMGLVLSAANVRGWTTGSGMEG-PSVPAGSNPETGMEQVSTFPWSLFTKSPRRRM  431
            L QD AMGLVLSAANVRGWTTGSG+ G P+ PA +  + G                    
Sbjct  41   LLQDDAMGLVLSAANVRGWTTGSGIYGRPTCPAPAGSDMG--------------------  80

Query  430  LVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFNP  251
                      +RTTRA+NPHAYTDGTVFVQ   C+    +++ L+L   MKCYVNSSFNP
Sbjct  81   ----------RRTTRAVNPHAYTDGTVFVQVRICHCVMCIIE-LHLLLRMKCYVNSSFNP  129

Query  250  NPDNSLGFKYFDLDDDNEDDIPQHF  176
            NP+N   F YFD +D   DDI   F
Sbjct  130  NPNNDASFNYFDSEDGKNDDIFPFF  154



>emb|CAO02549.1| putative zinc finger (DNL type) family protein [Vigna unguiculata]
Length=113

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 59/80 (74%), Gaps = 5/80 (6%)
 Frame = +3

Query  375  GLMARVVRCPQTLQVKATSIRRRGDFVKRDQGKVDTC--SIPVSGFEPAGTDGPSIPDPV  548
            GL+ARVVR PQ +QVKATSI   GDFVKRD GKV+    S+P      AGT+GPSIP+PV
Sbjct  2    GLIARVVRWPQMVQVKATSILLLGDFVKRDHGKVEMFPDSLP---LPTAGTEGPSIPEPV  58

Query  549  VHPRTFAALRTNPIAASWER  608
            VHP   AAL T+PIAAS +R
Sbjct  59   VHPLPTAALSTSPIAASLDR  78



>ref|XP_005652036.1| zf-DNL-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27492.1| zf-DNL-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=208

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 2/69 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK--  278
            K+PRR   V FTC +CG+ TT+ +NPHA+ +GTVF +C GC + HKL+DNL LFH+++  
Sbjct  110  KNPRRTRKVQFTCNLCGETTTKRVNPHAWENGTVFAECSGCRVKHKLIDNLKLFHELRGP  169

Query  277  CYVNSSFNP  251
             Y  +  NP
Sbjct  170  VYPAAPMNP  178



>gb|ABK26747.1| unknown [Picea sitchensis]
Length=156

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 43/70 (61%), Gaps = 6/70 (9%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRR ++V+F C  CG RT R +N HAY  GTVFVQC GC  YHKLVDNL L       V 
Sbjct  86   PRRSLMVSFNCDACGTRTKRIVNRHAYERGTVFVQCAGCEAYHKLVDNLGLI------VE  139

Query  265  SSFNPNPDNS  236
              F  +PD S
Sbjct  140  YDFRDDPDGS  149



>tpg|DAA58876.1| TPA: etched1 isoform 1 [Zea mays]
 tpg|DAA58877.1| TPA: etched1 isoform 2 [Zea mays]
Length=86

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  10   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGLVVEYDLR  69



>ref|XP_004969096.1| PREDICTED: DNL-type zinc finger protein-like [Setaria italica]
Length=162

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 9/86 (10%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL+L  +    
Sbjct  86   KLPRRSLLVQFTCNKCGERTQRLINRLAYERGTVFLQCAGCQVYHKFVDNLDLVVE----  141

Query  271  VNSSFNPNPDNSLGFKYFDLDDDNED  194
                F+   +N+L  +   ++ D+ED
Sbjct  142  ----FDLREENALQEENV-VNTDSED  162



>ref|NP_001150527.1| zinc ribbon 1 [Zea mays]
 gb|ACG39419.1| zinc ribbon 1 [Zea mays]
Length=161

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  85   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGLVVEYDLR  144



>ref|XP_002458121.1| hypothetical protein SORBIDRAFT_03g027210 [Sorghum bicolor]
 gb|EES03241.1| hypothetical protein SORBIDRAFT_03g027210 [Sorghum bicolor]
Length=163

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  87   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGLVVEYDLR  146



>tpg|DAA58878.1| TPA: etched1 [Zea mays]
Length=166

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  90   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGLVVEYDLR  149



>ref|NP_001043517.2| Os01g0605200 [Oryza sativa Japonica Group]
 dbj|BAD52669.1| putative zinc ribbon 1 [Oryza sativa Japonica Group]
 gb|EAZ12620.1| hypothetical protein OsJ_02531 [Oryza sativa Japonica Group]
 dbj|BAF05431.2| Os01g0605200 [Oryza sativa Japonica Group]
Length=154

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 11/81 (14%)
 Frame = -1

Query  514  AGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCC  335
            AGS P       STF  +L    PRR +LV FTC  CG+RT R IN  AY  GT+F+QC 
Sbjct  72   AGSAPAE-----STFDLNL----PRRSLLVQFTCNACGERTKRLINRVAYERGTIFLQCA  122

Query  334  GCNIYHKLVDNLNLF--HDMK  278
            GC +YHK VDNL L   +D++
Sbjct  123  GCQVYHKFVDNLGLVVEYDLR  143



>ref|XP_008446529.1| PREDICTED: uncharacterized protein C24H6.02c isoform X2 [Cucumis 
melo]
Length=170

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 66/128 (52%), Gaps = 4/128 (3%)
 Frame = -1

Query  673  PRGNGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPET  494
            P  N  +P L S +N S+ V I S++     V      +  T  S ++G +   G + E+
Sbjct  28   PSINSFKPILSSKANPSNGVFIRSRNFCTAPVTRGRRYKVLTVSSLVDGYT---GDDDES  84

Query  493  GMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHK  314
                  T   ++  K PRR ++V FTC  C +RT R IN  AY  G VFVQC GC  YHK
Sbjct  85   SQRNSDT-GAAIDIKLPRRSLMVTFTCNQCSERTKRLINRLAYERGLVFVQCAGCQKYHK  143

Query  313  LVDNLNLF  290
            LVDNL L 
Sbjct  144  LVDNLGLI  151



>ref|NP_001105722.1| etched1 [Zea mays]
 emb|CAD45038.1| ETCHED1 protein [Zea mays]
 emb|CAD45039.1| ETCHED1 protein [Zea mays]
Length=163

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  87   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGLVVEYDLR  146



>gb|EEC71043.1| hypothetical protein OsI_02763 [Oryza sativa Indica Group]
Length=154

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 46/69 (67%), Gaps = 6/69 (9%)
 Frame = -1

Query  478  STFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
            STF  +L    PRR +LV FTC  CG+RT R IN  AY  GT+F+QC GC +YHK VDNL
Sbjct  79   STFDLNL----PRRSLLVQFTCNACGERTKRLINRVAYERGTIFLQCAGCQVYHKFVDNL  134

Query  298  NLF--HDMK  278
             L   +D++
Sbjct  135  GLVVEYDLR  143



>ref|XP_002438978.1| hypothetical protein SORBIDRAFT_10g029320 [Sorghum bicolor]
 gb|EER90345.1| hypothetical protein SORBIDRAFT_10g029320 [Sorghum bicolor]
Length=164

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -1

Query  481  VSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDN  302
            +S+   ++  K PRR +LV FTC  CG+RT R IN  AY  G++F+QC GC +YHK VDN
Sbjct  78   LSSTEATIDIKLPRRSLLVQFTCNACGERTKRLINRVAYERGSIFLQCAGCQVYHKFVDN  137

Query  301  LNLF--HDMK  278
            L L   +D++
Sbjct  138  LGLVVEYDLR  147



>ref|NP_001105159.1| zinc ribbon 1 [Zea mays]
 emb|CAD45040.1| zinc ribbon 1 [Zea mays]
 gb|ACN34374.1| unknown [Zea mays]
 gb|AFW69400.1| Zinc ribbon 1 [Zea mays]
Length=162

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  CG+RT R IN  AY  GT+F+QC GC +YHK VDNL L   +D++
Sbjct  86   KLPRRSLLVQFTCNACGERTKRLINRVAYERGTIFLQCAGCQVYHKFVDNLGLVVEYDLR  145



>ref|XP_002888678.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64937.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=171

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            S+  K PRR +LV F+C  CG+RT R IN HAY +G VFVQC GC  +HKLVDNL L   
Sbjct  97   SIDIKLPRRSLLVEFSCDSCGERTKRLINRHAYENGLVFVQCAGCLQHHKLVDNLGLI--  154

Query  283  MKCYVNSSFNPNPDNS  236
                V   F   P +S
Sbjct  155  ----VEYDFRETPKDS  166



>ref|XP_009392908.1| PREDICTED: uncharacterized protein LOC103978730 [Musa acuminata 
subsp. malaccensis]
Length=159

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 61/118 (52%), Gaps = 5/118 (4%)
 Frame = -1

Query  646  LRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFP  467
            LR  +N    VP       +GLV   A +      +G +G +  +  +  +      TF 
Sbjct  25   LRHRANQPWAVPPAFARLRLGLVRPTARLFPLVCATG-DGAAAESKPSSSSASPPDITFD  83

Query  466  WSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
              L    PRR +LV FTC +CG+RT R IN  AY  GT+F+QC GC +YHK VDNL L
Sbjct  84   IKL----PRRNLLVEFTCDLCGERTKRLINRVAYEKGTIFLQCAGCQVYHKFVDNLGL  137



>ref|XP_010066771.1| PREDICTED: uncharacterized protein LOC104453845 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64808.1| hypothetical protein EUGRSUZ_G02379 [Eucalyptus grandis]
Length=166

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 66/133 (50%), Gaps = 15/133 (11%)
 Frame = -1

Query  670  RGNGNEPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETG  491
            R   +EP L S+    SL  +  +   +GL L   ++ G +       PS          
Sbjct  40   RPPRDEPALASSRLRVSLPTVGPRKRGLGLPLVLCSLEGQSETDQASPPSD---------  90

Query  490  MEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKL  311
                ST    L  + PRRR+LV FTC  CG+RT R +N  AY  G +FVQC GC  +HKL
Sbjct  91   ----STARLHLNLEHPRRRLLVQFTCNECGERTQRLVNKLAYERGLIFVQCAGCLRHHKL  146

Query  310  VDNLNLF--HDMK  278
            VDNL L   +D++
Sbjct  147  VDNLGLVVEYDLR  159



>gb|EPS62111.1| hypothetical protein M569_12682, partial [Genlisea aurea]
Length=70

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            K PRR +LV+FTC  CG R+ R IN  AY  G V+VQC GC+ YHKLVDNL L
Sbjct  7    KFPRRNLLVSFTCNACGARSQRLINRLAYERGLVYVQCSGCSRYHKLVDNLGL  59



>gb|KFK41298.1| hypothetical protein AALP_AA2G112200 [Arabis alpina]
Length=167

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 52/87 (60%), Gaps = 8/87 (9%)
 Frame = -1

Query  550  TTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPH  371
            T GSG+     P   + ++   QV+    S+  K PRR +LV F+C  CG+RT R IN H
Sbjct  72   TDGSGLN----PEEESKDSSEGQVA----SVDIKLPRRSLLVEFSCNSCGERTKRLINRH  123

Query  370  AYTDGTVFVQCCGCNIYHKLVDNLNLF  290
            AY  G VFVQC GC  +HKLVDNL L 
Sbjct  124  AYERGLVFVQCGGCLQHHKLVDNLGLI  150



>gb|AFW81000.1| putative tify domain/CCT motif transcription factor family protein 
[Zea mays]
Length=253

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  508  SNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQ  341
             +P   M  V T PWSL TKSPR  M VAF C VCGQ TTRAINPHAYT+ TVFVQ
Sbjct  152  KSPRWHMRVVLTLPWSLLTKSPRWHMRVAFACSVCGQCTTRAINPHAYTNETVFVQ  207



>ref|XP_010511888.1| PREDICTED: uncharacterized protein LOC104787925 isoform X2 [Camelina 
sativa]
Length=174

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
            S+ TK PRR + + FTC  CG+RT R IN HAY  G VFVQC GC  YHKLVDNL
Sbjct  100  SVDTKLPRRSLQLEFTCNSCGERTKRLINRHAYERGLVFVQCAGCLQYHKLVDNL  154



>ref|XP_002280593.1| PREDICTED: mitochondrial protein import protein ZIM17 [Vitis 
vinifera]
 emb|CBI27106.3| unnamed protein product [Vitis vinifera]
Length=173

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            S+  K PRR ++V FTC  CG+RT R IN  A+  GTVFVQC GC  +HKLVDNL L  +
Sbjct  98   SIDIKLPRRSLIVQFTCDACGERTERLINRLAFERGTVFVQCAGCLQHHKLVDNLGLVVE  157

Query  283  MKCYVNSSFNPNPDN  239
                 N S + N D 
Sbjct  158  YDLRENISADSNTDQ  172



>ref|XP_010511887.1| PREDICTED: uncharacterized protein LOC104787925 isoform X1 [Camelina 
sativa]
Length=176

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
            S+ TK PRR + + FTC  CG+RT R IN HAY  G VFVQC GC  YHKLVDNL
Sbjct  102  SVDTKLPRRSLQLEFTCNSCGERTKRLINRHAYERGLVFVQCAGCLQYHKLVDNL  156



>ref|XP_001777870.1| predicted protein [Physcomitrella patens]
 gb|EDQ57298.1| predicted protein [Physcomitrella patens]
Length=189

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            PRR  L+ FTC VC  RT R INP A+  GTV+VQC GC  YH+LVDNLNL  +
Sbjct  120  PRRSALLEFTCNVCKARTQRMINPEAFRRGTVYVQCGGCQAYHQLVDNLNLVKE  173



>ref|XP_006301666.1| hypothetical protein CARUB_v10022115mg [Capsella rubella]
 gb|EOA34564.1| hypothetical protein CARUB_v10022115mg [Capsella rubella]
Length=184

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
            S+  K PRRR+ V FTC  CG+RT R IN HAY  G VFVQC GC  +HKLVDNL
Sbjct  110  SVDIKLPRRRLQVEFTCNSCGERTKRLINRHAYERGLVFVQCAGCLQHHKLVDNL  164



>ref|XP_008777543.1| PREDICTED: uncharacterized protein LOC103697463 isoform X2 [Phoenix 
dactylifera]
Length=179

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  105  PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  155



>ref|XP_010470860.1| PREDICTED: uncharacterized protein LOC104750716 [Camelina sativa]
Length=174

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
            S+ TK PRR + V FTC  CG+RT R IN HAY  G VFVQC GC  +HKLVDNL
Sbjct  100  SVDTKLPRRSLQVEFTCDSCGERTKRLINRHAYERGLVFVQCAGCLQHHKLVDNL  154



>ref|XP_004135125.1| PREDICTED: uncharacterized protein LOC101206910 [Cucumis sativus]
 gb|KGN52030.1| hypothetical protein Csa_5G608180 [Cucumis sativus]
Length=173

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 65/126 (52%), Gaps = 12/126 (10%)
 Frame = -1

Query  655  EPDLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPS----VPAGSNPETGM  488
            +P + S +N S+ V I S++     V      +  T  S ++G +     P+  N +TG 
Sbjct  37   KPIVSSKANPSNGVFIRSRNFCTAPVSRERRYKVLTVSSLVDGYTGDDDEPSQRNSDTGA  96

Query  487  EQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLV  308
                    ++  K PRR ++V FTC  C +RT R IN  AY  G VFVQC GC  YHKLV
Sbjct  97   --------AIDIKLPRRSLMVTFTCNQCSERTKRLINRLAYERGLVFVQCAGCQKYHKLV  148

Query  307  DNLNLF  290
            DNL L 
Sbjct  149  DNLGLI  154



>ref|XP_008777542.1| PREDICTED: uncharacterized protein LOC103697463 isoform X1 [Phoenix 
dactylifera]
Length=180

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  105  PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  155



>ref|XP_010925225.1| PREDICTED: uncharacterized protein LOC105047826 isoform X1 [Elaeis 
guineensis]
Length=171

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_010925248.1| PREDICTED: uncharacterized protein LOC105047826 isoform X4 [Elaeis 
guineensis]
Length=168

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_010925233.1| PREDICTED: uncharacterized protein LOC105047826 isoform X2 [Elaeis 
guineensis]
Length=170

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_006644344.1| PREDICTED: uncharacterized protein C24H6.02c-like [Oryza brachyantha]
Length=151

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            PRR +LV FTC  CG+RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  83   PRRSLLVQFTCNACGERTKRLINRVAYERGTVFLQCGGCQVYHKFVDNLGLVVEYDLR  140



>ref|XP_010925241.1| PREDICTED: uncharacterized protein LOC105047826 isoform X3 [Elaeis 
guineensis]
Length=169

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            PRR ++V FTC  CG+RT R IN  AY  GTVFVQC GC +YHK VDNL L
Sbjct  94   PRRSLMVQFTCDACGERTRRLINRLAYERGTVFVQCAGCLVYHKFVDNLGL  144



>ref|XP_010470865.1| PREDICTED: uncharacterized protein LOC104750723 [Camelina sativa]
Length=176

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
            S+ TK PRR + V FTC  CG+RT R IN HAY  G VFVQC GC  +HKLVDNL
Sbjct  102  SVDTKLPRRSLQVEFTCDSCGERTKRLINRHAYERGLVFVQCAGCLQHHKLVDNL  156



>ref|NP_177040.2| Zim17-type zinc finger protein [Arabidopsis thaliana]
 gb|AAD49972.1|AC008075_5 F24J5.3 [Arabidopsis thaliana]
 gb|AAG52044.1|AC011914_14 putative transcription factor; 86360-87167 [Arabidopsis thaliana]
 dbj|BAH30365.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34833.1| Zim17-type zinc finger protein [Arabidopsis thaliana]
Length=170

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  290
            S+  K PRR + V FTC  CG+RT R IN HAY  G VFVQC GC  +HKLVDNL L 
Sbjct  96   SIDIKLPRRSLQVEFTCNSCGERTKRLINRHAYEKGLVFVQCAGCLKHHKLVDNLGLI  153



>ref|XP_004238981.1| PREDICTED: uncharacterized protein C24H6.02c [Solanum lycopersicum]
Length=177

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K PRR +L  FTC  CG R+ R IN  AY  GTVF+QC GC+ YHKLVDNL L  +    
Sbjct  106  KLPRRSLLATFTCNACGARSQRLINRLAYERGTVFIQCSGCSQYHKLVDNLGLVVEYNFK  165

Query  271  VNSSFNPNPDN  239
               S +P+ D 
Sbjct  166  EEISMDPDADQ  176



>ref|XP_002314899.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF01070.2| zinc finger family protein [Populus trichocarpa]
Length=169

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 60/107 (56%), Gaps = 6/107 (6%)
 Frame = -1

Query  559  RGWTTGSGM-EGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRA  383
            RG    SG+ +G S    + PE     ++    ++  K PRR +LV FTC  CG+R+ R 
Sbjct  64   RGLFVVSGLVDGNS---ETYPEVESNDLNEESATIDIKLPRRSLLVQFTCNECGERSQRL  120

Query  382  INPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMKCYVNSSFNPN  248
            IN  AY  G VFVQC GC  YHKL DNL L   +D++  +++  N +
Sbjct  121  INRLAYERGLVFVQCAGCERYHKLADNLGLIVEYDLREEISAESNAD  167



>ref|XP_006348591.1| PREDICTED: uncharacterized protein C24H6.02c-like [Solanum tuberosum]
Length=177

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K PRR +L  FTC  CG R+ R IN  AY  GTVF+QC GC+ YHKLVDNL L  +    
Sbjct  106  KLPRRSLLATFTCNACGARSQRLINRLAYERGTVFIQCSGCSQYHKLVDNLGLVVEYNFK  165

Query  271  VNSSFNPNPDN  239
               S +P+ D 
Sbjct  166  DEISMDPDADQ  176



>ref|XP_010096705.1| DNL-type zinc finger protein [Morus notabilis]
 gb|EXB65557.1| DNL-type zinc finger protein [Morus notabilis]
Length=173

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  +HKLVDNL L   +D++
Sbjct  102  KLPRRSLLVQFTCDLCGERTQRLVNRLAYERGLIYVQCAGCLQHHKLVDNLGLVVEYDLR  161

Query  277  CYVNSSFNPN  248
              +N+  N +
Sbjct  162  EEINADRNED  171



>ref|XP_010681378.1| PREDICTED: DNL-type zinc finger protein isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=150

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  454  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            T+ PRR +LV FTC  CG+RT R IN  AY  GTVFVQC GC  +HKLVDNL L
Sbjct  84   TQLPRRSLLVQFTCDACGERTKRLINRLAYERGTVFVQCAGCLQHHKLVDNLGL  137



>ref|XP_011008859.1| PREDICTED: mitochondrial protein import protein ZIM17 [Populus 
euphratica]
Length=171

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -1

Query  502  PETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNI  323
            PE     ++    ++  K PRR +LV FTC  CG+R+ R IN  AY  G VFVQC GC  
Sbjct  83   PEVESNDLNEESATIDIKLPRRSLLVQFTCNECGERSQRLINRLAYERGLVFVQCAGCER  142

Query  322  YHKLVDNLNLF--HDMKCYVNSSFN  254
            YHKL DNL L   +D++  +++  N
Sbjct  143  YHKLADNLGLIVEYDLREEISAESN  167



>ref|XP_011070860.1| PREDICTED: DNL-type zinc finger protein isoform X2 [Sesamum indicum]
Length=128

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = -1

Query  541  SGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYT  362
            S +   S       E  + + S    ++  K PRR +LV FTC  CG R+ R IN  AY 
Sbjct  27   SSLLEDSYEEYQETEQSVSKNSQQEAAIDLKLPRRSLLVTFTCGACGVRSQRLINRLAYE  86

Query  361  DGTVFVQCCGCNIYHKLVDNLNL  293
             G V+VQC GC+ YHKLVDNL L
Sbjct  87   RGLVYVQCSGCSKYHKLVDNLGL  109



>gb|KEH29577.1| DNL zinc finger protein [Medicago truncatula]
Length=158

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRR +LV FTC +CG+RT R +N  AY  G VFVQC GC  +HKLVDNL L  +      
Sbjct  89   PRRSLLVQFTCDLCGERTERLVNRLAYERGAVFVQCAGCQRHHKLVDNLGLITEYDFREK  148

Query  265  SSFNPNPDN  239
            ++ +P  D 
Sbjct  149  TNTDPEIDQ  157



>ref|XP_003518825.1| PREDICTED: DNL-type zinc finger protein-like [Glycine max]
 gb|KHN07723.1| DNL-type zinc finger protein [Glycine soja]
Length=161

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 5/93 (5%)
 Frame = -1

Query  538  GMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTD  359
            G+ G        PET   +  T   S+    PRR +LV FTC +CG+RT R +N  AY  
Sbjct  64   GLLGHDSGTAPQPETPNSEAGT---SIDLNLPRRSLLVQFTCNLCGERTERLVNRLAYER  120

Query  358  GTVFVQCCGCNIYHKLVDNLNLF--HDMKCYVN  266
            G VFVQC GC  +HKLVDNL L   +D +  +N
Sbjct  121  GAVFVQCAGCLQHHKLVDNLGLITEYDFREKIN  153



>ref|XP_008360068.1| PREDICTED: uncharacterized protein LOC103423766 [Malus domestica]
 ref|XP_008360187.1| PREDICTED: uncharacterized protein LOC103423888 [Malus domestica]
Length=177

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKLVDNL L  +     +
Sbjct  108  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLVDNLGLVVEYDLRED  167

Query  265  SSFNPNPD  242
               + N D
Sbjct  168  FDVDTNAD  175



>ref|XP_007153312.1| hypothetical protein PHAVU_003G024500g [Phaseolus vulgaris]
 gb|ESW25306.1| hypothetical protein PHAVU_003G024500g [Phaseolus vulgaris]
Length=155

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 57/112 (51%), Gaps = 11/112 (10%)
 Frame = -1

Query  595  AAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFT  416
            AA  L      V G   G   E    P   N E G    +T   +L    PRR +LV FT
Sbjct  45   AAPSLARRVFRVHGLI-GDDSETAPEPESPNSEAG----ATIDLNL----PRRSLLVQFT  95

Query  415  CKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMKCYVN  266
            C VCG+RT R +N  AY  G VFVQC GC  +HKLVDNL L   +D +  +N
Sbjct  96   CGVCGERTKRLVNRLAYERGAVFVQCAGCLRHHKLVDNLGLITEYDFREKIN  147



>ref|XP_010262339.1| PREDICTED: uncharacterized protein LOC104600883 isoform X1 [Nelumbo 
nucifera]
Length=165

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  CG+R+ R +N  AY  GTVFVQC GC  +HKLVDNL L   +D++
Sbjct  94   KLPRRSLLVQFTCNACGERSQRLVNRLAYERGTVFVQCAGCLQHHKLVDNLGLVVEYDLR  153



>ref|XP_009355956.1| PREDICTED: uncharacterized protein LOC103946868 [Pyrus x bretschneideri]
Length=176

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMKCY  272
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKL DNL L   +D++  
Sbjct  107  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLADNLGLVVEYDLRED  166

Query  271  VNSSFN  254
            +N   N
Sbjct  167  INVDTN  172



>ref|XP_009356516.1| PREDICTED: uncharacterized protein LOC103947335 [Pyrus x bretschneideri]
 ref|XP_009356525.1| PREDICTED: uncharacterized protein LOC103947342 [Pyrus x bretschneideri]
Length=177

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKLVDNL L  +     +
Sbjct  108  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLVDNLGLVVEYDLRED  167

Query  265  SSFNPNPD  242
               + N D
Sbjct  168  FDVDTNAD  175



>ref|XP_009614441.1| PREDICTED: uncharacterized protein C24H6.02c [Nicotiana tomentosiformis]
Length=173

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K PRR +LV FTC  CG R+ R IN  AY  GTVF+QC GC+ YHK VDNL L  +    
Sbjct  102  KLPRRSLLVTFTCNACGVRSQRFINRLAYERGTVFIQCSGCSQYHKFVDNLGLVVEYNFK  161

Query  271  VNSSFNPNPD  242
               + +P+ D
Sbjct  162  DEINMDPDAD  171



>gb|KJB50817.1| hypothetical protein B456_008G188300 [Gossypium raimondii]
Length=148

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  454  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            TK PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC  YHKL DNL L
Sbjct  85   TKLPRRSLLVQFTCGECGERTERLINRLAYERGLVYVQCAGCLQYHKLADNLGL  138



>ref|XP_008361865.1| PREDICTED: uncharacterized protein LOC103425553 [Malus domestica]
Length=199

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKL DNL L  +     +
Sbjct  130  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLADNLGLVVEYDLRED  189

Query  265  SSFNPNPDN  239
               + N D 
Sbjct  190  IDLDTNTDE  198



>ref|XP_009791194.1| PREDICTED: uncharacterized protein C24H6.02c [Nicotiana sylvestris]
Length=178

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            K PRR +LV FTC  CG R+ R IN  AY  GTVF+QC GC+ YHK VDNL L
Sbjct  107  KLPRRSLLVTFTCNACGVRSQRLINRLAYERGTVFIQCSGCSQYHKFVDNLGL  159



>emb|CDP00540.1| unnamed protein product [Coffea canephora]
Length=174

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC +CG R+ + +N  AY  GTVFVQC GC  +HKLVDNL L   +D +
Sbjct  103  KLPRRSLLVKFTCNLCGSRSEKLVNRLAYERGTVFVQCSGCRQHHKLVDNLGLVVEYDFR  162

Query  277  CYVNSSFNPN  248
              ++S  N N
Sbjct  163  EEMDSDSNAN  172



>ref|XP_003569318.1| PREDICTED: uncharacterized protein C24H6.02c-like [Brachypodium 
distachyon]
 ref|XP_010231998.1| PREDICTED: uncharacterized protein C24H6.02c-like [Brachypodium 
distachyon]
 ref|XP_010231999.1| PREDICTED: uncharacterized protein C24H6.02c-like [Brachypodium 
distachyon]
Length=148

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  C  RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  78   KLPRRSLLVQFTCNKCDARTNRLINRVAYERGTVFLQCAGCQVYHKFVDNLGLIVEYDLR  137



>emb|CDM83104.1| unnamed protein product [Triticum aestivum]
Length=153

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  C  RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  83   KLPRRSLLVQFTCNKCDARTKRLINRVAYERGTVFLQCAGCQVYHKFVDNLGLIVEYDLR  142



>ref|XP_006437770.1| hypothetical protein CICLE_v10032948mg [Citrus clementina]
 ref|XP_006484383.1| PREDICTED: mitochondrial protein import protein ZIM17-like [Citrus 
sinensis]
 gb|ESR51010.1| hypothetical protein CICLE_v10032948mg [Citrus clementina]
 gb|KDO70144.1| hypothetical protein CISIN_1g031397mg [Citrus sinensis]
Length=160

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC  +HKLVDNL L  +    
Sbjct  89   KLPRRSLLVQFTCDGCGERTQRLINRLAYERGLVYVQCAGCLRHHKLVDNLGLVVEYDLR  148

Query  271  VNSSFNPNPDN  239
               S   N D 
Sbjct  149  EEISMESNTDQ  159



>ref|NP_001239683.1| uncharacterized protein LOC100786955 [Glycine max]
 gb|ACU19834.1| unknown [Glycine max]
 gb|KHM98964.1| DNL-type zinc finger protein [Glycine soja]
Length=159

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMKCY  272
            PRR +LV FTC +CG+RT R +N  AY  G VFVQC GC  +HKLVDNL L   +D +  
Sbjct  90   PRRSLLVQFTCNLCGERTKRLVNRLAYERGAVFVQCAGCLRHHKLVDNLGLITEYDFREK  149

Query  271  VNS  263
            +N 
Sbjct  150  INK  152



>ref|XP_008339721.1| PREDICTED: uncharacterized protein LOC103402741 [Malus domestica]
Length=176

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMKCY  272
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  YHKL DNL L   +D++  
Sbjct  107  PRRSLLVKFTCNLCGERTNRLVNRLAYERGLIYVQCAGCQKYHKLADNLGLVVEYDLRED  166

Query  271  VNSSFN  254
            ++   N
Sbjct  167  IDXDTN  172



>ref|XP_006391103.1| hypothetical protein EUTSA_v10019239mg [Eutrema salsugineum]
 gb|ESQ28389.1| hypothetical protein EUTSA_v10019239mg [Eutrema salsugineum]
Length=166

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -1

Query  514  AGSNPET-GMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQC  338
            +G NPE    +       S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC
Sbjct  74   SGLNPEEESKDSAEGQVASIDIKLPRRSLLVEFSCNSCGERTKRLINRLAYERGLVFVQC  133

Query  337  CGCNIYHKLVDNLNLF  290
             GC  +HKLVDNL L 
Sbjct  134  AGCLRHHKLVDNLGLI  149



>ref|XP_010425752.1| PREDICTED: uncharacterized protein LOC104710796 [Camelina sativa]
 ref|XP_010425753.1| PREDICTED: uncharacterized protein LOC104710796 [Camelina sativa]
 ref|XP_010425754.1| PREDICTED: uncharacterized protein LOC104710796 [Camelina sativa]
Length=177

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 57/110 (52%), Gaps = 9/110 (8%)
 Frame = -1

Query  622  SLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSV--PAGSNPETGMEQVSTFPWSLFTK  449
            +L P L   + M L+     +R W T S M       P  +N      QV++       K
Sbjct  55   ALYPYLPLGSVMDLI--GLFIRMWCTLSRMILLMFLWPIYTNDSVE-GQVASVD----IK  107

Query  448  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
             PRR + V FTC +CG+RT R IN HA+  G VFVQC GC  YHKL DNL
Sbjct  108  LPRRSLQVEFTCNLCGERTKRLINRHAHERGLVFVQCAGCLQYHKLFDNL  157



>ref|XP_004505313.1| PREDICTED: mitochondrial protein import protein ZIM17-like isoform 
X1 [Cicer arietinum]
 ref|XP_004505314.1| PREDICTED: mitochondrial protein import protein ZIM17-like isoform 
X2 [Cicer arietinum]
 ref|XP_004505315.1| PREDICTED: mitochondrial protein import protein ZIM17-like isoform 
X3 [Cicer arietinum]
Length=157

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  290
            PRR +LV FTC +CG+RT + +N  AY  GT+F+QC GC  +HKLVDNL L 
Sbjct  86   PRRSLLVQFTCDLCGERTKKLVNRLAYERGTIFIQCAGCKRHHKLVDNLGLI  137



>ref|XP_011070859.1| PREDICTED: uncharacterized protein LOC105156436 isoform X1 [Sesamum 
indicum]
Length=188

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            K PRR +LV FTC  CG R+ R IN  AY  G V+VQC GC+ YHKLVDNL L
Sbjct  117  KLPRRSLLVTFTCGACGVRSQRLINRLAYERGLVYVQCSGCSKYHKLVDNLGL  169



>gb|KHG19418.1| DNL-type zinc finger [Gossypium arboreum]
Length=149

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            K PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC  YHKL DNL L
Sbjct  87   KLPRRSLLVQFTCGECGERTERLINRLAYERGLVYVQCAGCLQYHKLADNLGL  139



>gb|EMT29434.1| hypothetical protein F775_05239 [Aegilops tauschii]
Length=149

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--  290
            S   K PRR +LV FTC  C  RT R IN   Y  GTVF+QC GC +YHK VDNL L   
Sbjct  75   SFDIKLPRRSLLVQFTCNKCDARTKRLINRVGYERGTVFLQCAGCQVYHKFVDNLGLIVE  134

Query  289  HDMK  278
            +D++
Sbjct  135  YDLR  138



>dbj|BAJ89579.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=158

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  C  RT R IN  AY  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  88   KLPRRSLLVQFTCNKCDARTERLINRVAYERGTVFLQCAGCQVYHKFVDNLGLIVEYDLR  147



>ref|XP_008246043.1| PREDICTED: mitochondrial protein import protein ZIM17-like [Prunus 
mume]
Length=182

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = -1

Query  505  NPETGMEQVSTFP---WSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCC  335
            N ET  E     P    ++  K PRR +LV FTC +CG+RT R +N  AY  G ++VQC 
Sbjct  90   NFETDGELEQNIPNTDATIDIKIPRRSLLVKFTCDLCGERTDRLVNRLAYERGLIYVQCA  149

Query  334  GCNIYHKLVDNLNLF--HDMKCYVNS  263
            GC  +HKLVDNL L   +D++  +++
Sbjct  150  GCLKHHKLVDNLGLVVEYDLRKDIDA  175



>ref|XP_010523289.1| PREDICTED: DNL-type zinc finger protein [Tarenaya hassleriana]
Length=170

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 47/80 (59%), Gaps = 9/80 (11%)
 Frame = -1

Query  514  AGSNPETGME-----QVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTV  350
            +G NPE   E     Q+++    L    PRR +LV FTC  CG+RT R +N  AY  G V
Sbjct  78   SGPNPEEESEDPKEGQIASTDIKL----PRRSLLVQFTCNSCGERTNRLVNRLAYERGLV  133

Query  349  FVQCCGCNIYHKLVDNLNLF  290
            FVQC GC  +HKLVDNL L 
Sbjct  134  FVQCGGCLRHHKLVDNLGLI  153



>ref|XP_010227814.1| PREDICTED: DNL-type zinc finger protein-like [Brachypodium distachyon]
Length=148

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            K PRR +LV FTC  C  RT R IN  A+  GTVF+QC GC +YHK VDNL L   +D++
Sbjct  78   KLPRRSLLVQFTCNKCDARTKRLINRVAHERGTVFLQCAGCQVYHKFVDNLGLIVEYDLR  137



>ref|XP_005847953.1| hypothetical protein CHLNCDRAFT_52093 [Chlorella variabilis]
 gb|EFN55851.1| hypothetical protein CHLNCDRAFT_52093 [Chlorella variabilis]
Length=288

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  454  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM  281
            +K PRR   + FTC +CG+    A+NPHA+  G+VF +C GC   HKL DNLN+FH++
Sbjct  202  SKHPRRTQQLRFTCNLCGEVNDAAVNPHAWKAGSVFARCQGCTAVHKLKDNLNIFHEL  259



>ref|XP_006858707.1| hypothetical protein AMTR_s00066p00105400 [Amborella trichopoda]
 gb|ERN20174.1| hypothetical protein AMTR_s00066p00105400 [Amborella trichopoda]
Length=186

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            PRR ++V FTC  CG R+ R IN  AY  GTVF+QC GC  YHK VDNL L
Sbjct  119  PRRSLMVQFTCDACGVRSQRIINRVAYERGTVFLQCSGCEQYHKFVDNLGL  169



>ref|XP_004297161.1| PREDICTED: uncharacterized protein LOC101312048 [Fragaria vesca 
subsp. vesca]
Length=166

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMKCY  272
            PRR +LV FTC +C +RT++ +N  AY  G ++VQC GC  YHKLVDNL L   +D++  
Sbjct  97   PRRSLLVKFTCDLCNERTSKLVNRLAYEKGLIYVQCAGCLKYHKLVDNLGLVVEYDLRGD  156

Query  271  VNSSFNPN  248
            ++S  N +
Sbjct  157  MDSDSNAD  164



>ref|XP_007046358.1| Zim17-type zinc finger protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY02190.1| Zim17-type zinc finger protein, putative isoform 1 [Theobroma 
cacao]
Length=143

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNL  293
            K PRR +LV FTC  CG+RT R IN  AY  G V+VQC GC  YHKL DNL L
Sbjct  81   KLPRRSLLVQFTCGECGERTERLINRLAYERGLVYVQCAGCLQYHKLADNLGL  133



>ref|XP_007223547.1| hypothetical protein PRUPE_ppa012145mg [Prunus persica]
 gb|EMJ24746.1| hypothetical protein PRUPE_ppa012145mg [Prunus persica]
Length=182

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF--HDMK  278
            PRR +LV FTC +CG+RT R +N  AY  G ++VQC GC  +HKLVDNL L   +D++
Sbjct  113  PRRSLLVKFTCDLCGERTDRLVNRLAYERGLIYVQCAGCLKHHKLVDNLGLVVEYDLR  170



>ref|XP_009127663.1| PREDICTED: uncharacterized protein LOC103852518 isoform X1 [Brassica 
rapa]
Length=160

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L   
Sbjct  85   SVDIKLPRRSLLVEFSCNSCGERTKRLINQLAYERGLVFVQCGGCLQHHQLVDNLGLI--  142

Query  283  MKCYVNSSFNPNPDNSLGF  227
                V   F       LG 
Sbjct  143  ----VEYDFRQKTSKDLGL  157



>ref|XP_009127664.1| PREDICTED: uncharacterized protein LOC103852518 isoform X2 [Brassica 
rapa]
Length=158

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L   
Sbjct  83   SVDIKLPRRSLLVEFSCNSCGERTKRLINQLAYERGLVFVQCGGCLQHHQLVDNLGLI--  140

Query  283  MKCYVNSSFNPNPDNSLGF  227
                V   F       LG 
Sbjct  141  ----VEYDFRQKTSKDLGL  155



>emb|CDY54500.1| BnaA02g35640D [Brassica napus]
Length=164

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L   
Sbjct  89   SVDIKLPRRSLLVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLQHHQLVDNLGLI--  146

Query  283  MKCYVNSSFNPNPDNSLGF  227
                V   F       LG 
Sbjct  147  ----VEYDFRQETSKDLGI  161



>emb|CDX81538.1| BnaC02g18420D [Brassica napus]
Length=164

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            S+  K PRR +LV F+C  CG+RT R IN  AY  G VFVQC GC  +H+LVDNL L   
Sbjct  89   SVDIKLPRRSLLVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLQHHQLVDNLGLI--  146

Query  283  MKCYVNSSFNPNPDNSLGF  227
                V   F       LG 
Sbjct  147  ----VEYDFRQETSKDLGI  161



>emb|CDX95993.1| BnaA07g27380D [Brassica napus]
Length=165

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  290
            S+  K PRR + V F+C  CG+RT R IN  AY  G VFVQC GC  +HKLVDNL L 
Sbjct  90   SVDIKLPRRSLQVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLKHHKLVDNLGLI  147



>emb|CDY38613.1| BnaC06g30360D [Brassica napus]
Length=164

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  290
            S+  K PRR + V F+C  CG+RT R IN  AY  G VFVQC GC  +HKLVDNL L 
Sbjct  89   SVDIKLPRRSLQVEFSCNSCGERTKRLINRLAYERGLVFVQCGGCLKHHKLVDNLGLI  146



>ref|XP_003063279.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52415.1| predicted protein [Micromonas pusilla CCMP1545]
Length=209

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -1

Query  469  PWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  290
            P ++    P+RR  + FTC  C  R+T+ +NP AY  GT+FVQC  C ++HK+VDNL + 
Sbjct  101  PDAIQIPMPKRRAQLTFTCDKCEARSTKMVNPDAYKRGTMFVQCPNCEVWHKIVDNLGMI  160

Query  289  HD  284
             +
Sbjct  161  FE  162



>emb|CDY28109.1| BnaC06g02900D [Brassica napus]
 emb|CDY08090.1| BnaA06g16360D [Brassica napus]
Length=65

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -1

Query  451  KSPRRRML-VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
            K PRRR L V F+C  CG+RT R IN  AY  G VFVQC GC  +HKLVDNL
Sbjct  11   KLPRRRSLQVEFSCNSCGERTKRLINRLAYERGIVFVQCGGCLKHHKLVDNL  62



>ref|XP_009105422.1| PREDICTED: mitochondrial protein import protein ZIM17-like [Brassica 
rapa]
Length=165

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  463  SLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  290
            S+  K PRR + V F+C  CG RT R IN  AY  G VFVQC GC  +HKLVDNL L 
Sbjct  90   SVDIKLPRRSLQVEFSCNSCGVRTKRLINRLAYERGLVFVQCGGCLKHHKLVDNLGLI  147



>ref|XP_005844772.1| hypothetical protein CHLNCDRAFT_138626 [Chlorella variabilis]
 gb|EFN52670.1| hypothetical protein CHLNCDRAFT_138626 [Chlorella variabilis]
Length=152

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 55/105 (52%), Gaps = 12/105 (11%)
 Frame = -1

Query  583  LVLSAANVRGWTTGSGMEGPSVP---AGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTC  413
            L+LS+++  G +T SG  G S     AGS    G+        S+    PRR +LV FTC
Sbjct  50   LLLSSSDEPG-STSSGYSGDSEDGSLAGSADGDGV--------SIDLHLPRRSLLVKFTC  100

Query  412  KVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
             +C  R+ R +NP A+  G V  QC  C  +HKL D  NL  +++
Sbjct  101  NLCSGRSERLVNPVAWNKGMVIAQCQHCQAWHKLADAANLVEEIR  145



>gb|EXX72907.1| Zim17p [Rhizophagus irregularis DAOM 197198w]
Length=212

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            P  R+++AFTCKVC  R+T+ ++ HAY  G V +QC  CN +H + D+L  F D
Sbjct  89   PNTRLMIAFTCKVCSLRSTKTMSKHAYNHGVVIIQCSSCNNHHLIADHLGWFRD  142



>emb|CEI97298.1| Putative Zf-DNL-domain-containing protein [Rhizopus microsporus]
Length=192

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL  F D K  
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNLGWFRDSKTT  132

Query  271  VN  266
            V 
Sbjct  133  VE  134



>gb|EIF45938.1| zim17p [Brettanomyces bruxellensis AWRI1499]
Length=189

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -1

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFN  254
            +L+AFTCK CG R++  I+  AY  G+V VQC GC   H + D+LN+FHD K  +     
Sbjct  74   LLLAFTCKKCGTRSSHIISKQAYLTGSVLVQCPGCKNRHLIADHLNIFHDGKINIEDILQ  133

Query  253  PNPDN  239
                N
Sbjct  134  AKGQN  138



>emb|CEG63113.1| Putative Zf-DNL-domain-containing protein [Rhizopus microsporus]
Length=192

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL  F D K  
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNLGWFRDSKTT  132

Query  271  VN  266
            V 
Sbjct  133  VE  134



>emb|CEI95525.1| Putative Piso0_002320 protein [Rhizopus microsporus]
Length=192

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL  F D K  
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNLGWFRDSKTT  132

Query  271  VN  266
            V 
Sbjct  133  VE  134



>emb|CEG80750.1| hypothetical protein RMATCC62417_15046 [Rhizopus microsporus]
Length=181

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K+ +R+ML+ FTCKVC +R+   ++  AYT G V +QC GC   H + DNL  F D K  
Sbjct  73   KATKRQMLIGFTCKVCEERSHHVMSKLAYTKGVVLIQCPGCKNRHLIADNLGWFRDSKTT  132

Query  271  VN  266
            V 
Sbjct  133  VE  134



>gb|KHJ41186.1| ribosomal protein S15 [Trichuris suis]
Length=290

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  469  PWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  290
            P +L T +   +ML+A+TCKVCG R ++ I+   Y +G V VQC GC  YH + DNL  F
Sbjct  35   PQALGTIASSGKMLLAYTCKVCGSRQSKLISKVGYREGVVLVQCSGCANYHIIADNLGWF  94

Query  289  HDM  281
             D+
Sbjct  95   SDL  97



>emb|CCK72609.1| hypothetical protein KNAG_0K02460 [Kazachstania naganishii CBS 
8797]
Length=176

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -1

Query  538  GMEGPSVPAGSN-PETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYT  362
            G + P+V + SN P    ++ S  P S      + ++++AFTCK C  R++  I+  AYT
Sbjct  40   GPDKPAVTSRSNTPAAADKKGSVGPSSAKLAMDKPQLMIAFTCKKCDTRSSHTISKQAYT  99

Query  361  DGTVFVQCCGCNIYHKLVDNLNLFHD  284
             GTV +QC GC   H + D+L +F D
Sbjct  100  GGTVLIQCPGCQNRHLIADHLKIFAD  125



>dbj|GAN02263.1| conserved hypothetical protein [Mucor ambiguus]
Length=199

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  448  SPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYV  269
            S + +ML+ FTCKVC +R+   ++ H+YT G V +QC GC   H + DNL  F D +  V
Sbjct  76   SKQHQMLIGFTCKVCNERSHHTMSKHSYTKGVVLIQCPGCKNRHLIADNLGWFKDSRTTV  135

Query  268  N  266
             
Sbjct  136  E  136



>dbj|BAJ23062.1| hypothetical protein [Pseudocentrotus depressus]
Length=196

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  290
            ++ +AFTCKVCG RT R+I+ HAY  G V V+C GC+  H + DNL+ F
Sbjct  102  KLHLAFTCKVCGMRTARSISKHAYEKGVVIVKCSGCDNNHLIADNLDWF  150



>ref|NP_081104.1| DNL-type zinc finger protein isoform 1 [Mus musculus]
 sp|Q9D113.1|DNLZ_MOUSE RecName: Full=DNL-type zinc finger protein; AltName: Full=Hsp70-escort 
protein 1; Short=HEP1; AltName: Full=mtHsp70-escort 
protein; Flags: Precursor [Mus musculus]
 dbj|BAB23162.1| unnamed protein product [Mus musculus]
 dbj|BAE24931.1| unnamed protein product [Mus musculus]
 gb|AAI39335.1| DNA segment, Chr 2, Brigham & Women's Genetics 1335 expressed 
[Mus musculus]
 gb|AAI39334.1| D2Bwg1335e protein [Mus musculus]
Length=177

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 50/105 (48%), Gaps = 13/105 (12%)
 Frame = -1

Query  574  SAANVRGWTTG--SGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCG  401
            +A  +RGW  G  SG    S   GS     + +V    + L            +TCKVCG
Sbjct  35   TAERLRGWAWGWASGWRSSSSAPGSGRAAALGRVEADHYQLV-----------YTCKVCG  83

Query  400  QRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
             R+++ I+  AY  G V V C GC  +H + DNL+ F D+K   N
Sbjct  84   TRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLSWFSDLKGKRN  128



>ref|XP_001421744.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00038.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=181

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM  281
            RRR+ + FTC  C  RT R INP     GT++VQC  C ++H++VDNL L  D 
Sbjct  104  RRRVQMTFTCNKCEGRTMRMINPEVLERGTMWVQCGECEVWHQIVDNLGLIFDF  157



>ref|XP_011397348.1| Fructose-1-phosphate phosphatase YqaB [Auxenochlorella protothecoides]
 gb|KFM24460.1| Fructose-1-phosphate phosphatase YqaB [Auxenochlorella protothecoides]
Length=326

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  454  TKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            T   RR   V FTC +CG + T+ +NPHA+  G+VF +C GC   HKL DNL +F +
Sbjct  236  TNHARRTRKVRFTCNLCGTQNTKRVNPHAWHAGSVFARCAGCQGVHKLQDNLEVFFE  292



>gb|EPB86614.1| hypothetical protein HMPREF1544_06590 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=176

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            + +ML+ FTCKVC +R+   ++ H+YT G V +QC GC   H + DNL  F D +  V 
Sbjct  55   KHQMLIGFTCKVCNERSHHTMSKHSYTKGVVLIQCPGCKNRHLIADNLGWFKDSRTTVE  113



>emb|CDX97891.1| BnaC04g40480D [Brassica napus]
Length=66

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -1

Query  451  KSPRRRML-VAFTCKVCGQR-TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
            K PRRR L V F+C  CG+R T R IN  AY  G VFVQC GC  +HKLV+NL
Sbjct  11   KLPRRRSLQVEFSCNSCGERRTKRLINRLAYERGLVFVQCGGCLKHHKLVENL  63



>ref|XP_007637235.1| PREDICTED: LOW QUALITY PROTEIN: DNL-type zinc finger protein 
isoform X2 [Cricetulus griseus]
Length=156

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 47/99 (47%), Gaps = 13/99 (13%)
 Frame = -1

Query  574  SAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQR  395
            +A   RGW  G      S   GS P   + +V              R  + +TCKVCG R
Sbjct  35   TAERRRGWAWG--WRSSSTAQGSGPVAALGRVEAD-----------RYQLVYTCKVCGTR  81

Query  394  TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
            ++++I+  AY  G V V C GC  +H + DNL  F D+K
Sbjct  82   SSKSISKLAYHHGVVIVTCPGCQNHHIIADNLGWFSDLK  120



>ref|XP_007901069.1| PREDICTED: DNL-type zinc finger protein isoform X2 [Callorhinchus 
milii]
Length=159

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 58/117 (50%), Gaps = 22/117 (19%)
 Frame = -1

Query  562  VRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRA  383
            VRG+T G  +   + P    P T  +                   +++TCKVC  R+T+ 
Sbjct  42   VRGFTPGRTLRA-AAPLAETPPTHYQ-------------------LSYTCKVCNTRSTKN  81

Query  382  INPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM--KCYVNSSFNPNPDNSLGFKYF  218
            I+  AY +G V V+C GC+ +H + DNL  F D+  K ++ S+ + NP NS   + F
Sbjct  82   ISKLAYHNGVVIVKCPGCDNHHIIADNLRWFADLEGKNFLGSNIHKNPINSKLLRLF  138



>gb|ERE70542.1| DNL-type zinc finger protein [Cricetulus griseus]
Length=198

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 47/99 (47%), Gaps = 13/99 (13%)
 Frame = -1

Query  574  SAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQR  395
            +A   RGW  G      S   GS P   + +V    + L            +TCKVCG R
Sbjct  60   TAERRRGWAWG--WRSSSTAQGSGPVAALGRVEADRYQLV-----------YTCKVCGTR  106

Query  394  TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
            ++++I+  AY  G V V C GC  +H + DNL  F D+K
Sbjct  107  SSKSISKLAYHHGVVIVTCPGCQNHHIIADNLGWFSDLK  145



>pdb|2E2Z|A Chain A, Solution Nmr Structure Of Yeast Tim15, Co-Chaperone 
Of Mitochondrial Hsp70
Length=100

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  9    KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  68

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  69   KANGEQVSQ----DVGDLEFEDIP  88



>gb|AJT21325.1| Zim17p [Saccharomyces cerevisiae YJM1341]
Length=174

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVRQ----DVGDLEFEDIP  147



>ref|XP_001691699.1| Hsp70 escorting protein 2 [Chlamydomonas reinhardtii]
 gb|ABS84949.1| HSP70 escort protein [Chlamydomonas reinhardtii]
 gb|EDP04807.1| Hsp70 escorting protein 2 [Chlamydomonas reinhardtii]
Length=205

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 42/82 (51%), Gaps = 5/82 (6%)
 Frame = -1

Query  487  EQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLV  308
            ++V   P S      RR  LV FTC  CG R+ R +NP A+  G VF QC  C+++H L 
Sbjct  99   KKVVRIPLSAMGDGARRSKLVLFTCNKCGGRSARLVNPVAWEKGVVFGQCSKCSVWHVLQ  158

Query  307  DNLNLFHDMKCYVNSSFNPNPD  242
             N     + K Y    +N +P+
Sbjct  159  AN-----NKKIYEEVRYNEDPE  175



>ref|XP_003083615.1| ETCHED1 protein (ISS) [Ostreococcus tauri]
 emb|CAL58164.1| Mitochondrial import protein TIM15 [Ostreococcus tauri]
Length=184

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -1

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            RRR+ + FTC  C  RT R INP     GT++VQC  C ++H++VDNL L  D
Sbjct  107  RRRVQMTFTCNKCEGRTMRMINPDVLERGTMWVQCGECEVWHQIVDNLGLIFD  159



>emb|CDW52158.1| Coq4 and Ribosomal S13 N and Ribosomal S15 and zf-DNL domain 
containing protein [Trichuris trichiura]
Length=488

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 8/67 (12%)
 Frame = -1

Query  457  FTKSPRR--------RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDN  302
            F  SP+R        +ML+A+TCKVCG R ++ I+   Y  G V VQC GC  YH + DN
Sbjct  31   FCSSPQRVGTIASSGKMLLAYTCKVCGSRQSKLISKVGYHQGVVLVQCSGCANYHIIADN  90

Query  301  LNLFHDM  281
            L  F D+
Sbjct  91   LGWFSDL  97



>ref|XP_005083712.1| PREDICTED: DNL-type zinc finger protein [Mesocricetus auratus]
Length=173

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 46/99 (46%), Gaps = 13/99 (13%)
 Frame = -1

Query  574  SAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQR  395
            +A   RGW  G      S   GS P   + +V    + L            +TCKVCG R
Sbjct  35   TAERRRGWAWG--WRSSSSAQGSGPGAALGRVEADRYQLV-----------YTCKVCGTR  81

Query  394  TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
            +++ I+  AY  G V V C GC  +H + DNL  F D+K
Sbjct  82   SSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLK  120



>gb|EGW12770.1| DNL-type zinc finger protein [Cricetulus griseus]
Length=163

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 45/94 (48%), Gaps = 13/94 (14%)
 Frame = -1

Query  559  RGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAI  380
            RGW  G      S   GS P   + +V              R  + +TCKVCG R++++I
Sbjct  30   RGWAWG--WRSSSTAQGSGPVAALGRVEA-----------DRYQLVYTCKVCGTRSSKSI  76

Query  379  NPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
            +  AY  G V V C GC  +H + DNL  F D+K
Sbjct  77   SKLAYHHGVVIVTCPGCQNHHIIADNLGWFSDLK  110



>ref|XP_003510907.1| PREDICTED: DNL-type zinc finger protein isoform X1 [Cricetulus 
griseus]
Length=188

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 45/94 (48%), Gaps = 13/94 (14%)
 Frame = -1

Query  559  RGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQRTTRAI  380
            RGW  G      S   GS P   + +V              R  + +TCKVCG R++++I
Sbjct  55   RGWAWG--WRSSSTAQGSGPVAALGRVEA-----------DRYQLVYTCKVCGTRSSKSI  101

Query  379  NPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
            +  AY  G V V C GC  +H + DNL  F D+K
Sbjct  102  SKLAYHHGVVIVTCPGCQNHHIIADNLGWFSDLK  135



>ref|XP_008191756.1| PREDICTED: DNL-type zinc finger protein-like [Tribolium castaneum]
 gb|EFA01426.1| hypothetical protein TcasGA2_TC030565 [Tribolium castaneum]
Length=160

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM  281
            ++++ FTCKVC  R T+ I+  AY  G V V+C GCN  H + DNLN F D+
Sbjct  72   KLMLGFTCKVCSARNTKFISKVAYQKGVVIVKCSGCNNNHLIADNLNWFTDL  123



>gb|AJT03343.1| Zim17p [Saccharomyces cerevisiae YJM270]
Length=174

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>gb|AJT25380.1| Zim17p [Saccharomyces cerevisiae YJM1399]
Length=174

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>gb|AJT02226.1| Zim17p [Saccharomyces cerevisiae YJM195]
 gb|AJT17234.1| Zim17p [Saccharomyces cerevisiae YJM1248]
 gb|AJT28723.1| Zim17p [Saccharomyces cerevisiae YJM1439]
Length=174

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>gb|AJT21703.1| Zim17p [Saccharomyces cerevisiae YJM1342]
Length=174

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>gb|AJT18360.1| Zim17p [Saccharomyces cerevisiae YJM1273]
Length=174

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>ref|NP_014089.2| Zim17p [Saccharomyces cerevisiae S288c]
 sp|P42844.2|ZIM17_YEAST RecName: Full=Mitochondrial protein import protein ZIM17; AltName: 
Full=Mitochondrial import inner membrane translocase subunit 
TIM15; AltName: Full=mtHsp70 escort protein 1; AltName: 
Full=mtHsp70-associated motor and chaperone protein TIM15/ZIM17; 
Short=MMC; Flags: Precursor [Saccharomyces cerevisiae 
S288c]
 sp|B3LPE4.2|ZIM17_YEAS1 RecName: Full=Mitochondrial protein import protein ZIM17; AltName: 
Full=Mitochondrial import inner membrane translocase subunit 
TIM15; AltName: Full=mtHsp70 escort protein 1; AltName: 
Full=mtHsp70-associated motor and chaperone protein TIM15/ZIM17; 
Short=MMC; Flags: Precursor [Saccharomyces cerevisiae 
RM11-1a]
 sp|B5VQB0.2|ZIM17_YEAS6 RecName: Full=Mitochondrial protein import protein ZIM17; AltName: 
Full=Mitochondrial import inner membrane translocase subunit 
TIM15; AltName: Full=mtHsp70 escort protein 1; AltName: 
Full=mtHsp70-associated motor and chaperone protein TIM15/ZIM17; 
Short=MMC; Flags: Precursor [Saccharomyces cerevisiae 
AWRI1631]
 sp|A6ZSH0.2|ZIM17_YEAS7 RecName: Full=Mitochondrial protein import protein ZIM17; AltName: 
Full=Mitochondrial import inner membrane translocase subunit 
TIM15; AltName: Full=mtHsp70 escort protein 1; AltName: 
Full=mtHsp70-associated motor and chaperone protein TIM15/ZIM17; 
Short=MMC; Flags: Precursor [Saccharomyces cerevisiae 
YJM789]
 gb|EEU04769.1| Zim17p [Saccharomyces cerevisiae JAY291]
 tpg|DAA10251.1| TPA: Zim17p [Saccharomyces cerevisiae S288c]
 dbj|GAA25801.1| K7_Zim17p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EIW07985.1| Zim17p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG83568.1| Zim17p [Saccharomyces cerevisiae R008]
 gb|EWG88974.1| Zim17p [Saccharomyces cerevisiae P301]
 gb|EWG93872.1| Zim17p [Saccharomyces cerevisiae R103]
 gb|EWH16328.1| Zim17p [Saccharomyces cerevisiae P283]
 gb|AHY76803.1| Zim17p [Saccharomyces cerevisiae YJM993]
 gb|AJP41041.1| Zim17p [Saccharomyces cerevisiae YJM1078]
 gb|AJT01478.1| Zim17p [Saccharomyces cerevisiae YJM189]
 gb|AJT01848.1| Zim17p [Saccharomyces cerevisiae YJM193]
 gb|AJT02591.1| Zim17p [Saccharomyces cerevisiae YJM244]
 gb|AJT02972.1| Zim17p [Saccharomyces cerevisiae YJM248]
 gb|AJT03710.1| Zim17p [Saccharomyces cerevisiae YJM271]
 gb|AJT04464.1| Zim17p [Saccharomyces cerevisiae YJM326]
 gb|AJT04835.1| Zim17p [Saccharomyces cerevisiae YJM428]
 gb|AJT05588.1| Zim17p [Saccharomyces cerevisiae YJM451]
 gb|AJT05953.1| Zim17p [Saccharomyces cerevisiae YJM453]
 gb|AJT06333.1| Zim17p [Saccharomyces cerevisiae YJM456]
 gb|AJT06706.1| Zim17p [Saccharomyces cerevisiae YJM470]
 gb|AJT07073.1| Zim17p [Saccharomyces cerevisiae YJM541]
 gb|AJT07442.1| Zim17p [Saccharomyces cerevisiae YJM554]
 gb|AJT07816.1| Zim17p [Saccharomyces cerevisiae YJM555]
 gb|AJT08189.1| Zim17p [Saccharomyces cerevisiae YJM627]
 gb|AJT04088.1| Zim17p [Saccharomyces cerevisiae YJM320]
 gb|AJT08560.1| Zim17p [Saccharomyces cerevisiae YJM681]
 gb|AJT08936.1| Zim17p [Saccharomyces cerevisiae YJM682]
 gb|AJT09307.1| Zim17p [Saccharomyces cerevisiae YJM683]
 gb|AJT09680.1| Zim17p [Saccharomyces cerevisiae YJM689]
 gb|AJT10055.1| Zim17p [Saccharomyces cerevisiae YJM693]
 gb|AJT10436.1| Zim17p [Saccharomyces cerevisiae YJM969]
 gb|AJT10815.1| Zim17p [Saccharomyces cerevisiae YJM972]
 gb|AJT11197.1| Zim17p [Saccharomyces cerevisiae YJM975]
 gb|AJT11577.1| Zim17p [Saccharomyces cerevisiae YJM978]
 gb|AJT11961.1| Zim17p [Saccharomyces cerevisiae YJM981]
 gb|AJT12342.1| Zim17p [Saccharomyces cerevisiae YJM984]
 gb|AJT12724.1| Zim17p [Saccharomyces cerevisiae YJM987]
 gb|AJT13109.1| Zim17p [Saccharomyces cerevisiae YJM990]
 gb|AJT13490.1| Zim17p [Saccharomyces cerevisiae YJM996]
 gb|AJT13874.1| Zim17p [Saccharomyces cerevisiae YJM1083]
 gb|AJT14244.1| Zim17p [Saccharomyces cerevisiae YJM1129]
 gb|AJT14618.1| Zim17p [Saccharomyces cerevisiae YJM1133]
 gb|AJT15364.1| Zim17p [Saccharomyces cerevisiae YJM1199]
 gb|AJT15737.1| Zim17p [Saccharomyces cerevisiae YJM1202]
 gb|AJT16111.1| Zim17p [Saccharomyces cerevisiae YJM1208]
 gb|AJT16479.1| Zim17p [Saccharomyces cerevisiae YJM1242]
 gb|AJT16856.1| Zim17p [Saccharomyces cerevisiae YJM1244]
 gb|AJT17603.1| Zim17p [Saccharomyces cerevisiae YJM1250]
 gb|AJT17983.1| Zim17p [Saccharomyces cerevisiae YJM1252]
 gb|AJT18726.1| Zim17p [Saccharomyces cerevisiae YJM1304]
 gb|AJT19096.1| Zim17p [Saccharomyces cerevisiae YJM1307]
 gb|AJT19463.1| Zim17p [Saccharomyces cerevisiae YJM1311]
 gb|AJT19831.1| Zim17p [Saccharomyces cerevisiae YJM1326]
 gb|AJT20205.1| Zim17p [Saccharomyces cerevisiae YJM1332]
 gb|AJT20580.1| Zim17p [Saccharomyces cerevisiae YJM1336]
 gb|AJT20957.1| Zim17p [Saccharomyces cerevisiae YJM1338]
 gb|AJT22400.1| Zim17p [Saccharomyces cerevisiae YJM1356]
 gb|AJT22783.1| Zim17p [Saccharomyces cerevisiae YJM1381]
 gb|AJT23535.1| Zim17p [Saccharomyces cerevisiae YJM1385]
 gb|AJT23911.1| Zim17p [Saccharomyces cerevisiae YJM1386]
 gb|AJT24280.1| Zim17p [Saccharomyces cerevisiae YJM1387]
 gb|AJT25748.1| Zim17p [Saccharomyces cerevisiae YJM1400]
 gb|AJT26481.1| Zim17p [Saccharomyces cerevisiae YJM1402]
 gb|AJT26849.1| Zim17p [Saccharomyces cerevisiae YJM1415]
 gb|AJT27223.1| Zim17p [Saccharomyces cerevisiae YJM1417]
 gb|AJT27600.1| Zim17p [Saccharomyces cerevisiae YJM1418]
 gb|AJT27970.1| Zim17p [Saccharomyces cerevisiae YJM1419]
 gb|AJT28343.1| Zim17p [Saccharomyces cerevisiae YJM1433]
 gb|AJT29094.1| Zim17p [Saccharomyces cerevisiae YJM1443]
 gb|AJT29430.1| Zim17p [Saccharomyces cerevisiae YJM1444]
 gb|AJT29803.1| Zim17p [Saccharomyces cerevisiae YJM1447]
 gb|AJT30155.1| Zim17p [Saccharomyces cerevisiae YJM1450]
 gb|AJT30527.1| Zim17p [Saccharomyces cerevisiae YJM1460]
 gb|AJT31254.1| Zim17p [Saccharomyces cerevisiae YJM1477]
 gb|AJT32006.1| Zim17p [Saccharomyces cerevisiae YJM1479]
 gb|AJT31635.1| Zim17p [Saccharomyces cerevisiae YJM1478]
 gb|AJT32372.1| Zim17p [Saccharomyces cerevisiae YJM1526]
 gb|AJT33124.1| Zim17p [Saccharomyces cerevisiae YJM1549]
 gb|AJT33502.1| Zim17p [Saccharomyces cerevisiae YJM1573]
 gb|AJT33868.1| Zim17p [Saccharomyces cerevisiae YJM1574]
 gb|AJT34609.1| Zim17p [Saccharomyces cerevisiae YJM1615]
Length=174

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>gb|AJT30888.1| Zim17p [Saccharomyces cerevisiae YJM1463]
Length=174

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>gb|EGA73237.1| Zim17p [Saccharomyces cerevisiae AWRI796]
Length=106

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 42/83 (51%), Gaps = 4/83 (5%)
 Frame = -1

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFN  254
            M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V     
Sbjct  1    MMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLMK  60

Query  253  PNPDNSLGFKYFDLDDDNEDDIP  185
             N +        D+ D   +DIP
Sbjct  61   ANGEQVSQ----DVGDLEFEDIP  79



>gb|AJT26115.1| Zim17p [Saccharomyces cerevisiae YJM1401]
Length=174

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>gb|AJT05212.1| Zim17p [Saccharomyces cerevisiae YJM450]
 gb|AJT14991.1| Zim17p [Saccharomyces cerevisiae YJM1190]
 gb|AJT32750.1| Zim17p [Saccharomyces cerevisiae YJM1527]
Length=174

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>emb|CAA86385.1| NO381 [Saccharomyces cerevisiae]
 emb|CAA96239.1| unnamed protein product [Saccharomyces cerevisiae]
 gb|AAS56692.1| YNL310C [Saccharomyces cerevisiae]
 gb|EDN62518.1| Zinc finger motif protein [Saccharomyces cerevisiae YJM789]
 gb|EDV12539.1| hypothetical protein SCRG_03434 [Saccharomyces cerevisiae RM11-1a]
 gb|EDZ69887.1| YNL310Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EGA57086.1| Zim17p [Saccharomyces cerevisiae FostersB]
 gb|EGA77245.1| Zim17p [Saccharomyces cerevisiae Vin13]
 gb|EGA85119.1| Zim17p [Saccharomyces cerevisiae VL3]
Length=205

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  99   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  158

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  159  KANGEQVSQ----DVGDLEFEDIP  178



>emb|CAY82303.1| Zim17p [Saccharomyces cerevisiae EC1118]
 gb|EHN05122.1| Zim17p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=205

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  99   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  158

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  159  KANGEQVSQ----DVGDLEFEDIP  178



>gb|EGA81223.1| Zim17p [Saccharomyces cerevisiae Lalvin QA23]
Length=205

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  99   KMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  158

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  159  KANGEQVSQ----DVGDLEFEDIP  178



>gb|EIE86935.1| hypothetical protein RO3G_11646 [Rhizopus delemar RA 99-880]
Length=188

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -1

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            +R+ML+ FTCKVC +R+   ++  AYT G V +QC  C   H + DNL  F D K  V 
Sbjct  70   KRQMLIGFTCKVCEERSHHVMSRLAYTKGVVLIQCPSCKNRHLIADNLGWFKDSKTTVE  128



>ref|XP_002495780.1| ZYRO0C02882p [Zygosaccharomyces rouxii]
 emb|CAR26847.1| ZYRO0C02882p [Zygosaccharomyces rouxii]
Length=152

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 4/84 (5%)
 Frame = -1

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFN  254
            M++AFTCK C  R++  ++  AYT GTV +QC  C + H + D+L +F D    +     
Sbjct  55   MMIAFTCKKCNDRSSHTMSKQAYTKGTVLIQCPSCQVRHLIADHLKIFSDEHITIEDILR  114

Query  253  PNPDNSLGFKYFDLDDDNEDDIPQ  182
               +++        DD   +DIP+
Sbjct  115  AKGESA----SLTADDLAFEDIPE  134



>emb|CEP62412.1| LALA0S05e05072g1_1 [Lachancea lanzarotensis]
Length=183

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 4/90 (4%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K+ +  M++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +F D    
Sbjct  60   KTDKPAMMIAFTCKKCNTRSSHTMSKQAYTGGTVLIQCPGCKSRHLIADHLKIFSDDHIT  119

Query  271  VNSSFNPNPDNSLGFKYFDLDDDNEDDIPQ  182
            +    +   ++         DD   +DIP+
Sbjct  120  IQDILSAKGESV----ALTTDDLAFEDIPE  145



>ref|XP_002555014.1| KLTH0F19052p [Lachancea thermotolerans]
 emb|CAR24577.1| KLTH0F19052p [Lachancea thermotolerans CBS 6340]
Length=180

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (52%), Gaps = 4/87 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            ++++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +F D    V    
Sbjct  64   QLMIAFTCKKCNNRSSHTMSKQAYTKGTVLIQCPGCKSRHLIADHLKIFSDDHITVEDIM  123

Query  256  NPNPDNSLGFKYFDLDDDNEDDIPQHF  176
            N   ++         DD   +DIP+  
Sbjct  124  NAKGESVSS----TTDDLAFEDIPEKL  146



>emb|CDY36477.1| BnaC03g48360D [Brassica napus]
Length=133

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = -1

Query  463  SLFTKSPRRRML-VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNL  299
            S+  K PRRR L V F+   CG RT R IN  AY  G VFVQC GC  +HKLVDNL
Sbjct  75   SVDIKLPRRRSLQVEFSYNSCGDRTKRLINRLAYECGLVFVQCGGCLKHHKLVDNL  130



>emb|CEP08401.1| hypothetical protein [Parasitella parasitica]
Length=192

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -1

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            + +ML+ FTCKVC +R+   ++ H+YT G V +QC GC   H + DNL  F D +  V 
Sbjct  72   QHQMLIGFTCKVCNERSHHTMSKHSYTKGVVLIQCPGCKNRHLIADNLGWFKDSRTTVE  130



>emb|CDH58781.1| hypothetical protein RO3G_11646 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=187

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            P+++ML+ FTC+VC +R+   ++  AYT G V ++C GC   H + DNL  F D
Sbjct  66   PKQQMLIGFTCEVCKERSHHVMSKLAYTKGVVLIECPGCKNRHLIADNLGWFRD  119



>emb|CDH12975.1| related to Mitochondrial protein import protein ZIM17 [Zygosaccharomyces 
bailii ISA1307]
Length=163

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = -1

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFN  254
            +++AFTCK C  R++  ++  AYT+GTV +QC  C+  H + D+L +F+D    +     
Sbjct  57   LMIAFTCKKCNHRSSHTMSKQAYTNGTVLIQCPTCHARHLIADHLKIFNDDHITIEDILK  116

Query  253  PNPDNSLGFKYFDLDDDNEDDIPQHF*GEV*GTRKQKK  140
               +++        DD   +DIP+   G V G   +KK
Sbjct  117  AKGESA----SLTTDDLAFEDIPEKLRG-VLGKYAKKK  149



>emb|CDS07381.1| hypothetical protein LRAMOSA01330 [Absidia idahoensis var. thermophila]
Length=186

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  445  PRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            P+++ML+ FTC+VC +R+   ++  AYT G V ++C GC   H + DNL  F D
Sbjct  65   PKQQMLIGFTCEVCKERSHHVMSKLAYTKGVVLIECPGCKNRHLIADNLGWFRD  118



>gb|AGO11609.1| AaceriADL173Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=190

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            M++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +F D
Sbjct  71   MMIAFTCKKCDTRSSHTMSKQAYTKGTVLIQCPGCKNRHLIADHLKIFRD  120



>gb|EJT44486.1| ZIM17-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=175

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 45/89 (51%), Gaps = 4/89 (4%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            K  + +M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    
Sbjct  63   KVEKPKMMIAFTCKKCDTRSSHTMSKQAYEKGTVMISCPHCKVRHLIADHLKIFHDNHVT  122

Query  271  VNSSFNPNPDNSLGFKYFDLDDDNEDDIP  185
            V      N +        D+ D   +DIP
Sbjct  123  VEQLMKANGEKVSQ----DVGDLEFEDIP  147



>ref|XP_006687723.1| zf-DNL-domain-containing protein [Candida tenuis ATCC 10573]
 gb|EGV61553.1| zf-DNL-domain-containing protein [Candida tenuis ATCC 10573]
Length=178

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
            ++++AFTCK C  R++   +  AYT GTV +QC GC   H + DNL +F D K
Sbjct  64   QLMIAFTCKKCDTRSSHTFSKQAYTKGTVAIQCPGCKNRHLIADNLKIFKDDK  116



>gb|EEH05800.1| DNL zinc finger domain-containing protein [Histoplasma capsulatum 
G186AR]
Length=219

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 43/85 (51%), Gaps = 3/85 (4%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            ++  R   + FTCK CG R++  I+ H Y  GTV + C GC   H + D+LN+F D K  
Sbjct  81   RAEERAFQITFTCKPCGHRSSHRISQHGYYKGTVLISCPGCRNRHVISDHLNIFMDKKST  140

Query  271  VNSSFNPNPDNSLGFKYFDLDDDNE  197
            +    + +    L  K   LD D E
Sbjct  141  LEDILSEHGQTLLKGK---LDGDVE  162



>ref|XP_002493869.1| Heat shock protein with a zinc finger motif [Komagataella pastoris 
GS115]
 emb|CAY71690.1| Heat shock protein with a zinc finger motif [Komagataella pastoris 
GS115]
 emb|CCA40707.1| DNL-type zinc finger protein [Komagataella pastoris CBS 7435]
Length=169

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVN  266
            ++++AFTCK C  R++   +  AYT+GTV +QC GC   H + D+L +F D +  + 
Sbjct  53   QLMIAFTCKKCDTRSSHTFSKQAYTNGTVLIQCPGCKNRHLIADHLKIFSDERVNIQ  109



>ref|XP_002024413.1| GL15020 [Drosophila persimilis]
 gb|EDW29829.1| GL15020 [Drosophila persimilis]
Length=187

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -1

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNS  263
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL LF +++   ++
Sbjct  99   QRRMELVYRCKLCNTRNTKTISEEAYYSGVVILQCDGCAVDHLIKDNLGLFTNIEGTNST  158

Query  262  SFNPNPDNSLGFKY  221
            S   N D  L  ++
Sbjct  159  STGKNIDQLLSERH  172



>ref|XP_001354904.1| GA20897 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL31960.1| GA20897 [Drosophila pseudoobscura pseudoobscura]
Length=187

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -1

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNS  263
            +RRM + + CK+C  R T+ I+  AY  G V +QC GC + H + DNL LF +++   ++
Sbjct  99   QRRMELVYRCKLCNTRNTKTISEEAYYSGVVILQCDGCAVDHLIKDNLGLFANIEGTNST  158

Query  262  SFNPNPDNSLGFKY  221
            S   N D  L  ++
Sbjct  159  STGKNIDQLLSERH  172



>ref|NP_983923.1| ADL173Cp [Ashbya gossypii ATCC 10895]
 gb|AAS51747.1| ADL173Cp [Ashbya gossypii ATCC 10895]
 gb|AEY96044.1| FADL173Cp [Ashbya gossypii FDAG1]
Length=190

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -1

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            M++AFTCK C  R++  ++  AYT GTV +QC GC   H + D+L +F D
Sbjct  71   MMIAFTCKKCDTRSSHTMSKQAYTKGTVLIQCPGCKNRHLIADHLKIFRD  120



>ref|XP_003725494.1| PREDICTED: DNL-type zinc finger protein-like [Strongylocentrotus 
purpuratus]
Length=196

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  290
            ++ +AFTCKVCG RT R+I+  AY  G V V+C GC   H + DNL+ F
Sbjct  102  KLHLAFTCKVCGMRTARSISKQAYEKGVVIVKCGGCENNHLIADNLDWF  150



>ref|XP_002614239.1| hypothetical protein CLUG_05725 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ41597.1| hypothetical protein CLUG_05725 [Clavispora lusitaniae ATCC 42720]
Length=172

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            ++++AFTCK C  R++   +  AYT G+V +QC GC   H + DNL +F D
Sbjct  58   QLMIAFTCKKCETRSSHVFSKQAYTKGSVLIQCPGCKGRHLIADNLKIFRD  108



>emb|CDF87706.1| BN860_12596g1_1 [Zygosaccharomyces bailii CLIB 213]
 emb|CDH09544.1| related to Mitochondrial protein import protein ZIM17 [Zygosaccharomyces 
bailii ISA1307]
Length=167

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = -1

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFN  254
            +++AFTCK C  R++  ++  AYT+GTV +QC  C+  H + D+L +F+D    +     
Sbjct  61   LMIAFTCKKCNHRSSHTMSKQAYTNGTVLIQCPTCHARHLIADHLKIFNDDHITIEDILK  120

Query  253  PNPDNSLGFKYFDLDDDNEDDIPQHF*GEV*GTRKQKK  140
               +++        DD   +DIP+   G V G   +KK
Sbjct  121  AKGESA----SLTTDDLAFEDIPEKLRG-VLGEYAKKK  153



>ref|XP_008840170.1| PREDICTED: DNL-type zinc finger protein isoform X2 [Nannospalax 
galili]
Length=202

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 53/113 (47%), Gaps = 14/113 (12%)
 Frame = -1

Query  613  PILSQDAAMGLVLSAANVR-GWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRR  437
            P L Q    G+ L AA  R GW  G      S  +GS P   + +V    + L       
Sbjct  21   PRLGQLWGPGVRLRAAERRRGWAWG--WRSWSSASGSGPGAALGRVEAAHYRLV------  72

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
                 +TCKVCG R+++ I+   Y  G V V C GC+ +H + DNL  F D++
Sbjct  73   -----YTCKVCGTRSSKHISKLGYHQGVVIVTCPGCHNHHIIADNLGWFSDLE  120



>gb|EHN00667.1| Zim17p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=107

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 42/83 (51%), Gaps = 4/83 (5%)
 Frame = -1

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFN  254
            M++AFTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V     
Sbjct  1    MMIAFTCKKCDTRSSHTMSKQAYEKGTVMISCPHCKVRHLIADHLKIFHDNHVTVEQLMK  60

Query  253  PNPDNSLGFKYFDLDDDNEDDIP  185
             N +        D+ D   +DIP
Sbjct  61   ANGEKVSQ----DVGDLEFEDIP  79



>gb|AJT25018.1| Zim17p [Saccharomyces cerevisiae YJM1389]
 gb|AJT24655.1| Zim17p [Saccharomyces cerevisiae YJM1388]
 gb|AJT34246.1| Zim17p [Saccharomyces cerevisiae YJM1592]
Length=174

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++ FTCK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIVFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>ref|XP_004198925.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
 emb|CCE82588.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
Length=187

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
            +M++AFTC VC  R++   +  AY  G+V +QC GC   H + DNL +F D K
Sbjct  67   QMMIAFTCTVCDTRSSHVFSKQAYQTGSVLIQCPGCKNRHLIADNLKIFKDNK  119



>ref|XP_004199776.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
 emb|CCE81657.1| Piso0_002320 [Millerozyma farinosa CBS 7064]
Length=187

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
            +M++AFTC VC  R++   +  AY  G+V +QC GC   H + DNL +F D K
Sbjct  67   QMMIAFTCTVCDTRSSHVFSKQAYQTGSVLIQCPGCKNRHLIADNLKIFKDNK  119



>ref|NP_001124462.1| DNL-type zinc finger protein [Rattus norvegicus]
 gb|EDL93510.1| rCG45717, isoform CRA_c [Rattus norvegicus]
Length=173

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 47/99 (47%), Gaps = 13/99 (13%)
 Frame = -1

Query  574  SAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQR  395
            +A  +RGW  G      S   GS     + +V    + L            +TCKVCG R
Sbjct  35   TAKRLRGWAWG--WRSSSSAPGSEHAAALGRVKADHYQLV-----------YTCKVCGTR  81

Query  394  TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
            +++ I+  AY  G V V C GC  +H + DNL+ F D+K
Sbjct  82   SSKHISKLAYHQGVVIVTCPGCQNHHIIADNLSWFSDLK  120



>gb|AJT23159.1| Zim17p [Saccharomyces cerevisiae YJM1383]
Length=174

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 4/84 (5%)
 Frame = -1

Query  436  RMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSF  257
            +M++AF CK C  R++  ++  AY  GTV + C  C + H + D+L +FHD    V    
Sbjct  68   KMMIAFICKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLM  127

Query  256  NPNPDNSLGFKYFDLDDDNEDDIP  185
              N +        D+ D   +DIP
Sbjct  128  KANGEQVSQ----DVGDLEFEDIP  147



>ref|XP_008482374.1| PREDICTED: DNL-type zinc finger protein-like [Diaphorina citri]
Length=198

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  442  RRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMK  278
            + ++ +A+TCKVCG R +  I+ H+Y  G V V+C GC+  H + DNL  F D+K
Sbjct  107  KHKLKLAYTCKVCGTRNSHLISKHSYEKGVVIVKCEGCSNNHLIADNLKWFTDLK  161



>gb|EEQ92563.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
ER-3]
 gb|EGE86745.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
ATCC 18188]
 gb|EQL30397.1| hypothetical protein BDFG_07086 [Blastomyces dermatitidis ATCC 
26199]
 gb|EQL30398.1| hypothetical protein, variant 1 [Blastomyces dermatitidis ATCC 
26199]
 gb|EQL30399.1| hypothetical protein, variant 2 [Blastomyces dermatitidis ATCC 
26199]
 gb|EQL30400.1| hypothetical protein, variant 3 [Blastomyces dermatitidis ATCC 
26199]
Length=228

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 43/85 (51%), Gaps = 3/85 (4%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            ++  R   + FTCK CG R++  I+ H Y  GTV + C GC   H + D+LN+F D K  
Sbjct  90   RAEERAFQITFTCKPCGHRSSHRISQHGYYKGTVLISCPGCKNRHVISDHLNIFMDKKST  149

Query  271  VNSSFNPNPDNSLGFKYFDLDDDNE  197
            +    + +    L  K   LD D E
Sbjct  150  LEDILSEHGQTLLKGK---LDGDME  171



>ref|XP_002626197.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ76986.1| DNL zinc finger domain-containing protein [Blastomyces dermatitidis 
SLH14081]
Length=228

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 43/85 (51%), Gaps = 3/85 (4%)
 Frame = -1

Query  451  KSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCY  272
            ++  R   + FTCK CG R++  I+ H Y  GTV + C GC   H + D+LN+F D K  
Sbjct  90   RAEERAFQITFTCKPCGHRSSHRISQHGYYKGTVLISCPGCKNRHVISDHLNIFMDKKST  149

Query  271  VNSSFNPNPDNSLGFKYFDLDDDNE  197
            +    + +    L  K   LD D E
Sbjct  150  LEDILSEHGQTLLKGK---LDGDME  171



>ref|XP_006863874.1| PREDICTED: DNL-type zinc finger protein [Chrysochloris asiatica]
Length=178

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 50/111 (45%), Gaps = 12/111 (11%)
 Frame = -1

Query  613  PILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRR  434
            P L Q  A G +  AA  R W         S   G  P T + +V +  + L        
Sbjct  21   PGLRQLWARGALPEAAGKR-WAWDWNWRRLSSEPGQGPGTALGRVESKHYQLV-------  72

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM  281
                +TCKVCG R+++ I+  AY  G V V C GC  +H + DNL  F D+
Sbjct  73   ----YTCKVCGTRSSKRISKLAYHQGVVIVTCQGCRNHHIIADNLGWFSDL  119



>emb|CCC46977.1| conserved hypothetical protein [Trypanosoma vivax Y486]
Length=184

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -1

Query  433  MLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHD  284
            M+ AFTC  C  RT +  + HAYT G V VQC  C + H L DNL  F D
Sbjct  105  MVAAFTCGRCDHRTVKKFSKHAYTKGIVIVQCPSCEVRHLLADNLGWFTD  154



>ref|XP_009862369.1| PREDICTED: DNL-type zinc finger protein-like [Ciona intestinalis]
Length=182

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 57/123 (46%), Gaps = 10/123 (8%)
 Frame = -1

Query  649  DLRSNSNDSSLVPILSQDAAMGLVLSAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTF  470
             +RSN N SS   + S  +    +    ++R ++T      P V   ++ E   E     
Sbjct  35   QVRSNVNRSSHFQLFSSSSKFNYIEHKKSLRSFSTSIP---PPVNQWNDSEPSNENT---  88

Query  469  PWSLFTKSPRRRMLVAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLF  290
                  K   +R  +AFTC VC  RT + I+  AY  G V V+C GC+  H + DNLN F
Sbjct  89   ----IGKINSKRYNLAFTCTVCQTRTGKQISKRAYHHGVVIVRCPGCSNNHIIADNLNWF  144

Query  289  HDM  281
             D+
Sbjct  145  SDL  147



>ref|XP_011109584.1| hypothetical protein H072_3614 [Dactylellina haptotyla CBS 200.50]
 gb|EPS42422.1| hypothetical protein H072_3614 [Dactylellina haptotyla CBS 200.50]
Length=341

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 4/86 (5%)
 Frame = -1

Query  427  VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPN  248
            + FTCK C  R+T  ++  AY  GTV +QC GC + H + D+L +F D    +       
Sbjct  250  LTFTCKKCTHRSTHKVSKQAYHKGTVLIQCPGCQVRHLIADHLKIFRDTSTTIEDILREK  309

Query  247  PDN-SLGFKYFDLDDD---NEDDIPQ  182
             +  + G KY + D +   +E+ +P+
Sbjct  310  GEKITKGVKYGNGDVEFLPDEEAVPE  335



>ref|XP_010607176.1| PREDICTED: DNL-type zinc finger protein [Fukomys damarensis]
 gb|KFO21489.1| DNL-type zinc finger protein [Fukomys damarensis]
Length=178

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 46/98 (47%), Gaps = 13/98 (13%)
 Frame = -1

Query  574  SAANVRGWTTGSGMEGPSVPAGSNPETGMEQVSTFPWSLFTKSPRRRMLVAFTCKVCGQR  395
            +A   R W  G G     + +G  P  G+ ++    + L            +TCKVCG R
Sbjct  35   AAGRPRAWAWGHGWR--PLSSGPEPAAGLGRLEAAHYQLV-----------YTCKVCGTR  81

Query  394  TTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDM  281
            +++ I+  AY  G V V C GC  +H + DNL  F D+
Sbjct  82   SSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDL  119



>ref|XP_001394190.1| DNL zinc finger domain protein [Aspergillus niger CBS 513.88]
 emb|CAK45920.1| unnamed protein product [Aspergillus niger]
 gb|EHA19406.1| hypothetical protein ASPNIDRAFT_179365 [Aspergillus niger ATCC 
1015]
Length=191

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = -1

Query  427  VAFTCKVCGQRTTRAINPHAYTDGTVFVQCCGCNIYHKLVDNLNLFHDMKCYVNSSFNPN  248
            + FTCK CG+R++  ++ H Y  GTV ++C  C+  H + D+LN+F D K  +       
Sbjct  96   ITFTCKPCGERSSHRMSKHGYHRGTVLIKCPSCDARHVIADHLNIFFDKKSTLEDILARQ  155

Query  247  PDNSLGFKYFDLDDDNEDD  191
             D  L   Y D D +  DD
Sbjct  156  GDK-LTRGYVDGDMEFWDD  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420