BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF019D10

Length=709
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089543.1|  PREDICTED: root phototropism protein 2-like        306   5e-97   Sesamum indicum [beniseed]
ref|XP_009777101.1|  PREDICTED: root phototropism protein 2             305   2e-96   Nicotiana sylvestris
ref|XP_009611218.1|  PREDICTED: root phototropism protein 2             305   2e-96   Nicotiana tomentosiformis
gb|KJB26283.1|  hypothetical protein B456_004G235100                    300   3e-95   Gossypium raimondii
gb|KJB26282.1|  hypothetical protein B456_004G235100                    300   5e-95   Gossypium raimondii
gb|KJB26284.1|  hypothetical protein B456_004G235100                    301   6e-95   Gossypium raimondii
ref|XP_006432049.1|  hypothetical protein CICLE_v10000673mg             291   2e-93   
emb|CDP04035.1|  unnamed protein product                                297   2e-93   Coffea canephora [robusta coffee]
emb|CBI15802.3|  unnamed protein product                                281   1e-91   Vitis vinifera
ref|XP_010244564.1|  PREDICTED: root phototropism protein 2             292   2e-91   Nelumbo nucifera [Indian lotus]
ref|XP_006432045.1|  hypothetical protein CICLE_v10000673mg             291   2e-91   
gb|EYU36889.1|  hypothetical protein MIMGU_mgv1a003487mg                292   2e-91   Erythranthe guttata [common monkey flower]
ref|XP_006432046.1|  hypothetical protein CICLE_v10000673mg             291   6e-91   Citrus clementina [clementine]
ref|XP_007017103.1|  Phototropic-responsive NPH3 family protein         290   8e-91   
gb|KDO54918.1|  hypothetical protein CISIN_1g007944mg                   288   2e-90   Citrus sinensis [apfelsine]
gb|KDO54917.1|  hypothetical protein CISIN_1g007944mg                   288   8e-90   Citrus sinensis [apfelsine]
ref|XP_006353728.1|  PREDICTED: root phototropism protein 2-like        286   4e-89   Solanum tuberosum [potatoes]
ref|XP_004243653.1|  PREDICTED: root phototropism protein 2             285   1e-88   Solanum lycopersicum
gb|KDP45678.1|  hypothetical protein JCGZ_17285                         284   2e-88   Jatropha curcas
ref|XP_010650806.1|  PREDICTED: root phototropism protein 2 isofo...    282   3e-88   
ref|XP_011041764.1|  PREDICTED: root phototropism protein 2-like        283   6e-88   Populus euphratica
ref|XP_002264896.1|  PREDICTED: root phototropism protein 2 isofo...    283   7e-88   Vitis vinifera
ref|XP_002325631.1|  ROOT PHOTOTROPISM 2 family protein                 283   7e-88   Populus trichocarpa [western balsam poplar]
ref|XP_010094443.1|  Root phototropism protein 2                        282   9e-88   Morus notabilis
gb|KGN53487.1|  hypothetical protein Csa_4G056750                       280   8e-87   
ref|XP_004147730.1|  PREDICTED: root phototropism protein 2-like        280   1e-86   Cucumis sativus [cucumbers]
ref|XP_010677799.1|  PREDICTED: root phototropism protein 2             279   2e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011011776.1|  PREDICTED: root phototropism protein 2-like        279   2e-86   Populus euphratica
ref|XP_008451888.1|  PREDICTED: root phototropism protein 2 isofo...    279   3e-86   Cucumis melo [Oriental melon]
ref|XP_002533880.1|  Root phototropism protein, putative                278   3e-86   
ref|XP_002319980.1|  ROOT PHOTOTROPISM 2 family protein                 278   3e-86   
ref|XP_011015900.1|  PREDICTED: root phototropism protein 2-like        278   7e-86   Populus euphratica
ref|XP_007206420.1|  hypothetical protein PRUPE_ppa003347mg             277   9e-86   Prunus persica
ref|XP_004294714.1|  PREDICTED: root phototropism protein 2             276   2e-85   Fragaria vesca subsp. vesca
ref|XP_009374407.1|  PREDICTED: root phototropism protein 2-like        276   3e-85   Pyrus x bretschneideri [bai li]
gb|ADL36608.1|  BZIP domain class transcription factor                  275   4e-85   Malus domestica [apple tree]
ref|XP_008451887.1|  PREDICTED: root phototropism protein 2 isofo...    277   9e-85   
ref|XP_006591739.1|  PREDICTED: root phototropism protein 2-like        273   1e-84   Glycine max [soybeans]
ref|XP_008239637.1|  PREDICTED: root phototropism protein 2 isofo...    274   1e-84   Prunus mume [ume]
ref|XP_008239576.1|  PREDICTED: root phototropism protein 2 isofo...    274   1e-84   Prunus mume [ume]
ref|XP_008366216.1|  PREDICTED: root phototropism protein 2-like        272   6e-84   
ref|XP_010023564.1|  PREDICTED: root phototropism protein 2             272   8e-84   Eucalyptus grandis [rose gum]
ref|XP_003553189.1|  PREDICTED: root phototropism protein 2-like        272   1e-83   Glycine max [soybeans]
ref|NP_001280895.1|  root phototropism protein 2-like                   271   2e-83   Malus domestica [apple tree]
ref|XP_003544940.2|  PREDICTED: root phototropism protein 2-like        271   3e-83   Glycine max [soybeans]
ref|XP_010522018.1|  PREDICTED: root phototropism protein 2-like        270   5e-83   Tarenaya hassleriana [spider flower]
ref|XP_006293884.1|  hypothetical protein CARUB_v10022870mg             270   6e-83   Capsella rubella
ref|XP_009355145.1|  PREDICTED: root phototropism protein 2-like        269   9e-83   Pyrus x bretschneideri [bai li]
ref|XP_007146905.1|  hypothetical protein PHAVU_006G080400g             269   9e-83   Phaseolus vulgaris [French bean]
ref|XP_008349518.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...    269   1e-82   
ref|XP_007142019.1|  hypothetical protein PHAVU_008G245700g             268   2e-82   Phaseolus vulgaris [French bean]
gb|ACJ85866.1|  unknown                                                 262   3e-82   Medicago truncatula
ref|XP_010557176.1|  PREDICTED: root phototropism protein 2             268   3e-82   Tarenaya hassleriana [spider flower]
dbj|BAJ33924.1|  unnamed protein product                                268   5e-82   Eutrema halophilum
gb|ACJ85743.1|  unknown                                                 257   6e-82   Medicago truncatula
ref|XP_010469846.1|  PREDICTED: root phototropism protein 2 isofo...    268   6e-82   
gb|AAB63086.1|  unknown protein                                         262   8e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003519296.1|  PREDICTED: root phototropism protein 2             267   8e-82   
gb|KEH28209.1|  root phototropism-like protein                          265   1e-81   Medicago truncatula
ref|XP_010414259.1|  PREDICTED: root phototropism protein 2-like        266   2e-81   Camelina sativa [gold-of-pleasure]
ref|NP_001280845.1|  root phototropism protein 2-like                   265   3e-81   Malus domestica [apple tree]
ref|XP_003616056.1|  Root phototropism protein                          265   4e-81   Medicago truncatula
ref|XP_006842585.1|  hypothetical protein AMTR_s00077p00161250          265   4e-81   Amborella trichopoda
ref|XP_002881117.1|  hypothetical protein ARALYDRAFT_481966             265   5e-81   
ref|XP_010510344.1|  PREDICTED: root phototropism protein 2-like        265   6e-81   Camelina sativa [gold-of-pleasure]
ref|NP_001031446.1|  Root phototropism protein 2                        263   1e-80   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02185.1|  hypothetical protein                                   263   3e-80   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01791.1|  hypothetical protein                                   263   3e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850147.1|  Root phototropism protein 2                           263   3e-80   Arabidopsis thaliana [mouse-ear cress]
gb|EPS73802.1|  hypothetical protein M569_00954                         262   4e-80   Genlisea aurea
gb|AAF33112.1|AF181683_1  RPT2                                          262   7e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490729.1|  PREDICTED: root phototropism protein 2-like        261   1e-79   Cicer arietinum [garbanzo]
ref|XP_003600551.1|  Root phototropism protein                          258   3e-79   
gb|AES70802.2|  root phototropism-like protein                          258   4e-79   Medicago truncatula
gb|KFK22949.1|  root phototropism protein 2                             259   1e-78   Arabis alpina [alpine rockcress]
ref|XP_003600550.1|  Root phototropism protein                          258   1e-78   Medicago truncatula
ref|XP_004500391.1|  PREDICTED: root phototropism protein 2-like        258   2e-78   Cicer arietinum [garbanzo]
gb|KHG08105.1|  Root phototropism 2 -like protein                       251   3e-76   Gossypium arboreum [tree cotton]
ref|XP_010044625.1|  PREDICTED: root phototropism protein 2-like        252   4e-76   Eucalyptus grandis [rose gum]
emb|CDX84827.1|  BnaA03g14030D                                          251   7e-76   
emb|CDY10743.1|  BnaA05g11930D                                          251   1e-75   Brassica napus [oilseed rape]
ref|XP_009132742.1|  PREDICTED: root phototropism protein 2-like        251   1e-75   Brassica rapa
ref|XP_009144295.1|  PREDICTED: root phototropism protein 2             251   1e-75   Brassica rapa
emb|CDY23992.1|  BnaC03g16990D                                          249   5e-75   Brassica napus [oilseed rape]
ref|XP_009402206.1|  PREDICTED: root phototropism protein 2 isofo...    244   1e-73   
gb|KCW86718.1|  hypothetical protein EUGRSUZ_B03325                     244   2e-73   Eucalyptus grandis [rose gum]
ref|XP_009402205.1|  PREDICTED: root phototropism protein 2 isofo...    244   3e-73   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY02075.1|  BnaC04g14260D                                          244   6e-73   
ref|XP_009384760.1|  PREDICTED: root phototropism protein 2-like ...    242   1e-72   
ref|XP_009384759.1|  PREDICTED: root phototropism protein 2-like ...    241   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011080638.1|  PREDICTED: root phototropism protein 2             235   1e-69   Sesamum indicum [beniseed]
gb|KHN18647.1|  Root phototropism protein 2                             225   1e-68   Glycine soja [wild soybean]
ref|XP_010922790.1|  PREDICTED: root phototropism protein 2             221   2e-64   Elaeis guineensis
gb|EMS47631.1|  Root phototropism protein 2                             203   3e-59   Triticum urartu
gb|KHN24717.1|  Root phototropism protein 2                             194   2e-58   Glycine soja [wild soybean]
ref|XP_004978520.1|  PREDICTED: root phototropism protein 2-like        205   3e-58   Setaria italica
ref|XP_008803009.1|  PREDICTED: root phototropism protein 2             202   2e-57   Phoenix dactylifera
ref|XP_004977394.1|  PREDICTED: root phototropism protein 2-like        198   6e-56   Setaria italica
ref|XP_008669932.1|  PREDICTED: root phototropism protein 2-like        197   2e-55   Zea mays [maize]
dbj|BAJ91259.1|  predicted protein                                      196   4e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92463.1|  predicted protein                                      196   4e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002450159.1|  hypothetical protein SORBIDRAFT_05g001300          192   2e-53   
ref|XP_006663162.1|  PREDICTED: root phototropism protein 2-like        186   1e-51   
ref|XP_003577852.1|  PREDICTED: root phototropism protein 2             177   5e-48   Brachypodium distachyon [annual false brome]
ref|XP_002463481.1|  hypothetical protein SORBIDRAFT_01g000540          169   2e-47   
gb|EEC68739.1|  hypothetical protein OsI_37246                          173   1e-46   Oryza sativa Indica Group [Indian rice]
gb|ABG22339.1|  RPT2, putative, expressed                               172   2e-46   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95649.1|  RPT2, putative, expressed                               171   6e-46   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065596.1|  Os11g0118300                                       171   6e-46   
ref|NP_001066000.1|  Os12g0117400                                       171   7e-46   
gb|EEC67555.1|  hypothetical protein OsI_34888                          171   7e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_009374446.1|  PREDICTED: putative disease resistance prote...    174   8e-46   Pyrus x bretschneideri [bai li]
gb|AFW55920.1|  putative phototropic-responsive NPH3 family protein     166   9e-44   
ref|XP_008661889.1|  PREDICTED: LOC100281201 isoform X1                 166   9e-44   
ref|NP_001147592.1|  LOC100281201                                       164   2e-43   
ref|XP_002441790.1|  hypothetical protein SORBIDRAFT_08g002330          150   3e-38   
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...    133   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_011012052.1|  PREDICTED: BTB/POZ domain-containing protein...    131   8e-32   Populus euphratica
ref|XP_011006800.1|  PREDICTED: BTB/POZ domain-containing protein...    131   8e-32   Populus euphratica
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...    132   9e-32   Populus euphratica
ref|XP_010277091.1|  PREDICTED: BTB/POZ domain-containing protein...    132   9e-32   
ref|XP_010277089.1|  PREDICTED: BTB/POZ domain-containing protein...    132   1e-31   
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...    132   1e-31   Populus euphratica
ref|XP_008787157.1|  PREDICTED: BTB/POZ domain-containing protein...    130   3e-31   Phoenix dactylifera
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g             128   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529             128   2e-30   
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843             128   3e-30   Selaginella moellendorffii
ref|XP_006380638.1|  hypothetical protein POPTR_0007s10060g             128   3e-30   
gb|KHN36285.1|  BTB/POZ domain-containing protein                       127   6e-30   Glycine soja [wild soybean]
ref|XP_006579934.1|  PREDICTED: BTB/POZ domain-containing protein...    126   8e-30   Glycine max [soybeans]
ref|XP_002533158.1|  Root phototropism protein, putative                126   9e-30   Ricinus communis
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...    126   1e-29   Glycine max [soybeans]
ref|XP_008341358.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    125   2e-29   
ref|XP_010412681.1|  PREDICTED: putative BTB/POZ domain-containin...    120   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...    125   3e-29   
ref|XP_003538794.2|  PREDICTED: BTB/POZ domain-containing protein...    125   3e-29   Glycine max [soybeans]
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...    125   3e-29   
ref|XP_006590635.1|  PREDICTED: BTB/POZ domain-containing protein...    125   4e-29   Glycine max [soybeans]
gb|KHN12984.1|  BTB/POZ domain-containing protein                       125   4e-29   Glycine soja [wild soybean]
gb|AAN77296.1|  Hypothetical protein                                    124   5e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74727.1|  hypothetical protein OsI_10455                          124   6e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_010559030.1|  PREDICTED: BTB/POZ domain-containing protein...    124   6e-29   Tarenaya hassleriana [spider flower]
ref|XP_010559028.1|  PREDICTED: BTB/POZ domain-containing protein...    124   6e-29   Tarenaya hassleriana [spider flower]
gb|AFK45576.1|  unknown                                                 122   9e-29   Medicago truncatula
ref|XP_010905283.1|  PREDICTED: BTB/POZ domain-containing protein...    122   9e-29   Elaeis guineensis
gb|KJB48679.1|  hypothetical protein B456_008G080700                    120   2e-28   Gossypium raimondii
ref|XP_010905282.1|  PREDICTED: BTB/POZ domain-containing protein...    123   2e-28   Elaeis guineensis
ref|XP_009411062.1|  PREDICTED: BTB/POZ domain-containing protein...    122   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010028107.1|  PREDICTED: BTB/POZ domain-containing protein...    122   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010028106.1|  PREDICTED: BTB/POZ domain-containing protein...    122   2e-28   Eucalyptus grandis [rose gum]
emb|CDP02580.1|  unnamed protein product                                122   2e-28   Coffea canephora [robusta coffee]
ref|XP_010028108.1|  PREDICTED: BTB/POZ domain-containing protein...    122   4e-28   Eucalyptus grandis [rose gum]
gb|KJB48678.1|  hypothetical protein B456_008G080700                    120   4e-28   Gossypium raimondii
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...    122   4e-28   Pyrus x bretschneideri [bai li]
ref|XP_006600924.1|  PREDICTED: BTB/POZ domain-containing protein...    121   5e-28   Glycine max [soybeans]
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein         121   5e-28   
ref|XP_002465671.1|  hypothetical protein SORBIDRAFT_01g043470          120   9e-28   
gb|KJB48677.1|  hypothetical protein B456_008G080700                    120   1e-27   Gossypium raimondii
gb|AAV50010.1|  phototropic response-like protein                       113   1e-27   Malus domestica [apple tree]
ref|XP_010086959.1|  BTB/POZ domain-containing protein                  120   1e-27   
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg             120   1e-27   Prunus persica
ref|XP_010412682.1|  PREDICTED: putative BTB/POZ domain-containin...    120   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009115684.1|  PREDICTED: BTB/POZ domain-containing protein...    120   1e-27   Brassica rapa
ref|XP_009115683.1|  PREDICTED: BTB/POZ domain-containing protein...    120   2e-27   Brassica rapa
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g             120   2e-27   Phaseolus vulgaris [French bean]
ref|XP_004149698.1|  PREDICTED: BTB/POZ domain-containing protein...    120   2e-27   
ref|XP_009379312.1|  PREDICTED: BTB/POZ domain-containing protein...    118   3e-27   
gb|ACL53070.1|  unknown                                                 118   3e-27   Zea mays [maize]
ref|XP_002989054.1|  hypothetical protein SELMODRAFT_272040             119   4e-27   Selaginella moellendorffii
gb|KFK28391.1|  hypothetical protein AALP_AA8G509000                    119   4e-27   Arabis alpina [alpine rockcress]
ref|XP_002983725.1|  hypothetical protein SELMODRAFT_228979             119   5e-27   Selaginella moellendorffii
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...    118   8e-27   Nicotiana sylvestris
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...    118   8e-27   Pyrus x bretschneideri [bai li]
tpg|DAA43883.1|  TPA: putative phototropic-responsive NPH3 family...    118   9e-27   
dbj|BAK07863.1|  predicted protein                                      118   9e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006426057.1|  hypothetical protein CICLE_v10025164mg             118   9e-27   Citrus clementina [clementine]
gb|KDO78972.1|  hypothetical protein CISIN_1g006971mg                   118   9e-27   Citrus sinensis [apfelsine]
ref|XP_006466487.1|  PREDICTED: BTB/POZ domain-containing protein...    118   9e-27   Citrus sinensis [apfelsine]
dbj|BAF95168.1|  similar to ROOT PHOTOTROPISM2 protein binding          109   1e-26   Ipomoea nil [qian niu]
ref|XP_006339816.1|  PREDICTED: BTB/POZ domain-containing protein...    117   1e-26   Solanum tuberosum [potatoes]
ref|XP_004231910.1|  PREDICTED: BTB/POZ domain-containing protein...    117   1e-26   Solanum lycopersicum
emb|CDY37857.1|  BnaAnng05180D                                          117   1e-26   Brassica napus [oilseed rape]
gb|ACL52494.1|  unknown                                                 117   2e-26   Zea mays [maize]
ref|XP_008368005.1|  PREDICTED: BTB/POZ domain-containing protein...    113   2e-26   
gb|KFK34271.1|  hypothetical protein AALP_AA5G123300                    116   3e-26   Arabis alpina [alpine rockcress]
gb|EPS72379.1|  hypothetical protein M569_02379                         116   3e-26   Genlisea aurea
emb|CAN71562.1|  hypothetical protein VITISV_007563                     116   4e-26   Vitis vinifera
ref|XP_002284242.2|  PREDICTED: BTB/POZ domain-containing protein...    116   4e-26   Vitis vinifera
ref|XP_006393938.1|  hypothetical protein EUTSA_v10003858mg             116   4e-26   Eutrema salsugineum [saltwater cress]
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...    116   5e-26   Cicer arietinum [garbanzo]
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...    116   5e-26   Cicer arietinum [garbanzo]
dbj|BAJ34215.1|  unnamed protein product                                116   5e-26   Eutrema halophilum
ref|XP_004509079.1|  PREDICTED: BTB/POZ domain-containing protein...    116   5e-26   Cicer arietinum [garbanzo]
gb|KEH27511.1|  phototropic-responsive NPH3 family protein              115   6e-26   Medicago truncatula
ref|XP_008457767.1|  PREDICTED: BTB/POZ domain-containing protein...    115   6e-26   Cucumis melo [Oriental melon]
ref|XP_008457766.1|  PREDICTED: BTB/POZ domain-containing protein...    115   6e-26   
ref|XP_004511859.1|  PREDICTED: BTB/POZ domain-containing protein...    115   8e-26   
ref|XP_004511857.1|  PREDICTED: BTB/POZ domain-containing protein...    115   9e-26   
ref|NP_001152299.1|  transposon protein Mutator sub-class               115   1e-25   Zea mays [maize]
ref|NP_680473.2|  phototropic-responsive NPH3-like protein              115   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAU05485.1|  At5g67385                                               115   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597110.1|  Root phototropism protein                          115   1e-25   
ref|XP_010484509.1|  PREDICTED: BTB/POZ domain-containing protein...    114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004985270.1|  PREDICTED: BTB/POZ domain-containing protein...    114   2e-25   Setaria italica
ref|XP_010464139.1|  PREDICTED: BTB/POZ domain-containing protein...    114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010484507.1|  PREDICTED: BTB/POZ domain-containing protein...    114   2e-25   Camelina sativa [gold-of-pleasure]
gb|KDP32052.1|  hypothetical protein JCGZ_12513                         114   2e-25   Jatropha curcas
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...    114   3e-25   Nicotiana tomentosiformis
ref|XP_007155848.1|  hypothetical protein PHAVU_003G236800g             114   3e-25   Phaseolus vulgaris [French bean]
ref|XP_010426528.1|  PREDICTED: putative BTB/POZ domain-containin...    113   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010939121.1|  PREDICTED: BTB/POZ domain-containing protein...    113   4e-25   Elaeis guineensis
gb|AES90666.2|  phototropic-responsive NPH3 family protein              113   6e-25   Medicago truncatula
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...    112   8e-25   Sesamum indicum [beniseed]
ref|XP_006290338.1|  hypothetical protein CARUB_v10016995mg             111   1e-24   
ref|XP_009130549.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    112   1e-24   Brassica rapa
ref|XP_010503666.1|  PREDICTED: putative BTB/POZ domain-containin...    111   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009780159.1|  PREDICTED: BTB/POZ domain-containing protein...    112   1e-24   Nicotiana sylvestris
ref|XP_006280202.1|  hypothetical protein CARUB_v10026107mg             111   3e-24   Capsella rubella
emb|CBI33715.3|  unnamed protein product                                110   3e-24   Vitis vinifera
ref|XP_002866705.1|  signal transducer                                  110   4e-24   Arabidopsis lyrata subsp. lyrata
gb|EYU44474.1|  hypothetical protein MIMGU_mgv1a027075mg                110   4e-24   Erythranthe guttata [common monkey flower]
gb|KJB43883.1|  hypothetical protein B456_007G221600                    108   5e-24   Gossypium raimondii
ref|XP_006364419.1|  PREDICTED: BTB/POZ domain-containing protein...    110   6e-24   Solanum tuberosum [potatoes]
gb|KJB43882.1|  hypothetical protein B456_007G221600                    108   8e-24   Gossypium raimondii
ref|XP_009103425.1|  PREDICTED: BTB/POZ domain-containing protein...    109   1e-23   Brassica rapa
ref|XP_003558544.1|  PREDICTED: BTB/POZ domain-containing protein...    109   1e-23   Brachypodium distachyon [annual false brome]
gb|KJB43880.1|  hypothetical protein B456_007G221600                    109   1e-23   Gossypium raimondii
ref|XP_006841959.1|  hypothetical protein AMTR_s00144p00020600          108   2e-23   Amborella trichopoda
ref|XP_006650337.1|  PREDICTED: BTB/POZ domain-containing protein...    108   3e-23   Oryza brachyantha
ref|XP_010687037.1|  PREDICTED: BTB/POZ domain-containing protein...    107   5e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE59569.1|  hypothetical protein OsJ_11863                          106   5e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561994.1|  PREDICTED: BTB/POZ domain-containing protein...    107   7e-23   Brachypodium distachyon [annual false brome]
gb|ABR25380.1|  transposon protein                                      103   9e-23   Oryza sativa Indica Group [Indian rice]
emb|CDY57436.1|  BnaAnng14510D                                          106   1e-22   Brassica napus [oilseed rape]
ref|XP_004294000.1|  PREDICTED: BTB/POZ domain-containing protein...    107   1e-22   Fragaria vesca subsp. vesca
ref|XP_001769248.1|  predicted protein                                  106   1e-22   
gb|ABF97835.1|  transposon protein, putative, Mutator sub-class, ...    106   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003520918.1|  PREDICTED: BTB/POZ domain-containing protein...    106   1e-22   Glycine max [soybeans]
gb|ABF97836.1|  transposon protein, putative, Mutator sub-class, ...    106   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAT85278.1|  NPH3 family protein                                     106   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007201187.1|  hypothetical protein PRUPE_ppa002993mg             106   2e-22   Prunus persica
ref|XP_004166154.1|  PREDICTED: BTB/POZ domain-containing protein...    106   2e-22   
ref|XP_010679605.1|  PREDICTED: BTB/POZ domain-containing protein...    105   2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006845260.1|  hypothetical protein AMTR_s00005p00262560          105   2e-22   
ref|XP_011096666.1|  PREDICTED: BTB/POZ domain-containing protein...    105   3e-22   Sesamum indicum [beniseed]
gb|KJB26098.1|  hypothetical protein B456_004G225600                    105   3e-22   Gossypium raimondii
ref|XP_004982336.1|  PREDICTED: uncharacterized protein LOC101754459    106   3e-22   
ref|XP_007133999.1|  hypothetical protein PHAVU_010G010500g             105   3e-22   Phaseolus vulgaris [French bean]
ref|XP_002464177.1|  hypothetical protein SORBIDRAFT_01g013680          105   4e-22   Sorghum bicolor [broomcorn]
ref|XP_008235484.1|  PREDICTED: BTB/POZ domain-containing protein...    105   4e-22   Prunus mume [ume]
ref|XP_010679598.1|  PREDICTED: BTB/POZ domain-containing protein...    105   4e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008383422.1|  PREDICTED: BTB/POZ domain-containing protein...    105   4e-22   Malus domestica [apple tree]
ref|XP_010679597.1|  PREDICTED: BTB/POZ domain-containing protein...    105   4e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006404081.1|  hypothetical protein EUTSA_v10010248mg             104   4e-22   Eutrema salsugineum [saltwater cress]
ref|XP_010234279.1|  PREDICTED: BTB/POZ domain-containing protein...    104   5e-22   Brachypodium distachyon [annual false brome]
ref|XP_009344395.1|  PREDICTED: BTB/POZ domain-containing protein...    105   5e-22   Pyrus x bretschneideri [bai li]
ref|XP_001763717.1|  predicted protein                                  104   6e-22   
ref|XP_003573346.1|  PREDICTED: BTB/POZ domain-containing protein...    104   7e-22   Brachypodium distachyon [annual false brome]
ref|NP_001168297.1|  putative phototropic-resoponsive NPH3 family...    104   7e-22   Zea mays [maize]
ref|NP_001060924.1|  Os08g0130600                                       104   7e-22   
gb|EEC82855.1|  hypothetical protein OsI_27703                          104   8e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_009630229.1|  PREDICTED: BTB/POZ domain-containing protein...    103   9e-22   Nicotiana tomentosiformis
ref|XP_010317168.1|  PREDICTED: BTB/POZ domain-containing protein...    103   1e-21   
ref|XP_004233453.1|  PREDICTED: BTB/POZ domain-containing protein...    103   1e-21   
emb|CDY12841.1|  BnaC07g15920D                                          103   1e-21   Brassica napus [oilseed rape]
ref|XP_010241172.1|  PREDICTED: BTB/POZ domain-containing protein...    103   1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010685004.1|  PREDICTED: BTB/POZ domain-containing protein...    103   1e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|ADZ04641.1|  hypothetical protein                                    103   1e-21   Oryza punctata
gb|KDP34960.1|  hypothetical protein JCGZ_09248                         103   1e-21   Jatropha curcas
ref|XP_010923665.1|  PREDICTED: BTB/POZ domain-containing protein...    103   1e-21   Elaeis guineensis
ref|XP_003533834.1|  PREDICTED: BTB/POZ domain-containing protein...    103   1e-21   Glycine max [soybeans]
ref|XP_010922793.1|  PREDICTED: BTB/POZ domain-containing protein...    103   2e-21   Elaeis guineensis
ref|XP_009399039.1|  PREDICTED: BTB/POZ domain-containing protein...    103   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010241171.1|  PREDICTED: BTB/POZ domain-containing protein...    103   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_011089989.1|  PREDICTED: BTB/POZ domain-containing protein...    103   2e-21   Sesamum indicum [beniseed]
dbj|BAJ87289.1|  predicted protein                                      102   2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004247004.1|  PREDICTED: BTB/POZ domain-containing protein...    102   2e-21   Solanum lycopersicum
ref|XP_004134651.1|  PREDICTED: BTB/POZ domain-containing protein...    103   2e-21   Cucumis sativus [cucumbers]
ref|NP_001280859.1|  BTB/POZ domain-containing protein At1g30440-...    103   2e-21   Malus domestica [apple tree]
ref|XP_009410501.1|  PREDICTED: BTB/POZ domain-containing protein...    102   2e-21   
ref|XP_011089103.1|  PREDICTED: BTB/POZ domain-containing protein...    102   2e-21   
ref|XP_011015340.1|  PREDICTED: BTB/POZ domain-containing protein...    102   2e-21   
ref|XP_006659093.1|  PREDICTED: BTB/POZ domain-containing protein...    102   2e-21   
ref|XP_006836308.1|  hypothetical protein AMTR_s00092p00041800          102   2e-21   
ref|XP_003546563.1|  PREDICTED: BTB/POZ domain-containing protein...    102   3e-21   
ref|XP_008439559.1|  PREDICTED: BTB/POZ domain-containing protein...    102   3e-21   
ref|XP_007015158.1|  BZIP domain class transcription factor             102   3e-21   
ref|XP_010486408.1|  PREDICTED: putative BTB/POZ domain-containin...    102   3e-21   
gb|KJB35735.1|  hypothetical protein B456_006G125900                    102   3e-21   
ref|XP_007138529.1|  hypothetical protein PHAVU_009G216900g             102   3e-21   
ref|XP_009410500.1|  PREDICTED: BTB/POZ domain-containing protein...    102   3e-21   
ref|XP_002521098.1|  protein binding protein, putative                  102   4e-21   
ref|XP_002963864.1|  hypothetical protein SELMODRAFT_141980             102   4e-21   
ref|XP_001770455.1|  predicted protein                                  102   4e-21   
gb|KHG15697.1|  hypothetical protein F383_22812                         102   4e-21   
ref|XP_008784787.1|  PREDICTED: BTB/POZ domain-containing protein...    102   4e-21   
ref|XP_004488271.1|  PREDICTED: BTB/POZ domain-containing protein...    102   4e-21   
gb|KHN41442.1|  BTB/POZ domain-containing protein                       102   4e-21   
ref|XP_003595495.1|  BTB/POZ domain-containing protein                  102   5e-21   
ref|XP_011468062.1|  PREDICTED: BTB/POZ domain-containing protein...    101   6e-21   
ref|XP_004288469.1|  PREDICTED: BTB/POZ domain-containing protein...    101   6e-21   
ref|XP_006386870.1|  hypothetical protein POPTR_0002s24380g             100   6e-21   
ref|XP_006349069.1|  PREDICTED: BTB/POZ domain-containing protein...    100   6e-21   
ref|XP_008803011.1|  PREDICTED: BTB/POZ domain-containing protein...    101   6e-21   
gb|KHG21232.1|  hypothetical protein F383_08117                         101   6e-21   
ref|XP_010051973.1|  PREDICTED: BTB/POZ domain-containing protein...    101   7e-21   
ref|XP_010275929.1|  PREDICTED: BTB/POZ domain-containing protein...    101   7e-21   
ref|XP_011468065.1|  PREDICTED: BTB/POZ domain-containing protein...    101   7e-21   
ref|XP_010100164.1|  BTB/POZ domain-containing protein                  101   7e-21   
gb|AAO16690.1|  hypothetical protein-like protein                       101   7e-21   
ref|XP_010275928.1|  PREDICTED: BTB/POZ domain-containing protein...    101   8e-21   
ref|XP_010275927.1|  PREDICTED: BTB/POZ domain-containing protein...    101   8e-21   
gb|EMT33147.1|  BTB/POZ domain-containing protein                       101   9e-21   
ref|XP_002526612.1|  Root phototropism protein, putative                101   9e-21   
ref|XP_002988267.1|  hypothetical protein SELMODRAFT_447227             101   9e-21   
ref|XP_002301784.2|  hypothetical protein POPTR_0002s24380g             100   1e-20   
ref|XP_006349068.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   
ref|XP_009406358.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   
ref|XP_002281182.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   
ref|XP_004251006.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   
ref|XP_011024680.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   
ref|XP_010941534.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   
ref|XP_002317350.2|  hypothetical protein POPTR_0011s09340g             100   1e-20   
ref|XP_010941535.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   
ref|XP_010036820.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   
ref|XP_009757420.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   
ref|XP_009362255.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   
emb|CDP05630.1|  unnamed protein product                                100   2e-20   
ref|XP_010027852.1|  PREDICTED: putative BTB/POZ domain-containin...    100   2e-20   
gb|KFK38267.1|  hypothetical protein AALP_AA3G091600                    100   2e-20   
ref|XP_010543146.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   
dbj|BAK04900.1|  predicted protein                                      100   2e-20   
ref|XP_009593550.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   
gb|EPS73600.1|  hypothetical protein M569_01153                         100   2e-20   
ref|XP_010905600.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   
ref|XP_009763589.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   
ref|XP_011459733.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   
gb|EMT33625.1|  BTB/POZ domain-containing protein                       100   2e-20   
ref|XP_006653803.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   
ref|XP_007049780.1|  Phototropic-responsive NPH3 family protein         100   2e-20   
ref|XP_010683440.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   
ref|XP_007214533.1|  hypothetical protein PRUPE_ppa002754mg             100   2e-20   
ref|XP_002445002.1|  hypothetical protein SORBIDRAFT_07g002590          100   2e-20   
ref|XP_008225559.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   
ref|XP_009397397.1|  PREDICTED: BTB/POZ domain-containing protein...    100   2e-20   
gb|AFO63285.1|  bZIP6                                                 99.8    3e-20   
ref|XP_010244571.1|  PREDICTED: BTB/POZ domain-containing protein...  99.8    3e-20   
gb|ADV56692.1|  NPH3 family protein                                     100   3e-20   
ref|XP_010244572.1|  PREDICTED: BTB/POZ domain-containing protein...  99.8    3e-20   
ref|XP_010110255.1|  BTB/POZ domain-containing protein                99.8    3e-20   
gb|KDO64171.1|  hypothetical protein CISIN_1g035818mg                 99.8    3e-20   
ref|XP_002961348.1|  hypothetical protein SELMODRAFT_74933            99.8    3e-20   
ref|XP_009397396.1|  PREDICTED: BTB/POZ domain-containing protein...  99.8    3e-20   
ref|XP_007163074.1|  hypothetical protein PHAVU_001G203800g           99.8    3e-20   
ref|XP_009419001.1|  PREDICTED: BTB/POZ domain-containing protein...  99.8    3e-20   
emb|CDX90249.1|  BnaA08g17350D                                        99.8    3e-20   
ref|XP_006481239.1|  PREDICTED: BTB/POZ domain-containing protein...  99.4    3e-20   
ref|XP_010109730.1|  BTB/POZ domain-containing protein                99.4    4e-20   
ref|XP_003579359.1|  PREDICTED: BTB/POZ domain-containing protein...  99.8    4e-20   
ref|NP_187478.1|  phototropic-responsive NPH3 family protein          99.4    4e-20   
gb|EMT10715.1|  BTB/POZ domain-containing protein                       100   4e-20   
ref|XP_011469652.1|  PREDICTED: BTB/POZ domain-containing protein...  99.4    4e-20   
ref|XP_006429637.1|  hypothetical protein CICLE_v10011315mg           99.4    4e-20   
ref|XP_007204975.1|  hypothetical protein PRUPE_ppa002796mg           99.4    4e-20   
ref|XP_008228112.1|  PREDICTED: BTB/POZ domain-containing protein...  99.4    4e-20   
ref|XP_008382632.1|  PREDICTED: BTB/POZ domain-containing protein...  99.4    4e-20   
gb|KEH43247.1|  phototropic-responsive NPH3 family protein            99.0    5e-20   
gb|KJB27631.1|  hypothetical protein B456_005G002800                  99.0    5e-20   
gb|KHG06087.1|  hypothetical protein F383_05585                       99.0    5e-20   
emb|CDY09586.1|  BnaC05g23330D                                        99.0    5e-20   
ref|XP_006577128.1|  PREDICTED: BTB/POZ domain-containing protein...  98.2    5e-20   
gb|EMT21744.1|  BTB/POZ domain-containing protein                     98.6    6e-20   
ref|NP_001130370.1|  putative phototropic-resoponsive NPH3 family...  98.6    6e-20   
ref|XP_004978267.1|  PREDICTED: BTB/POZ domain-containing protein...  99.0    6e-20   
ref|XP_010056964.1|  PREDICTED: BTB/POZ domain-containing protein...  99.0    6e-20   
emb|CAN72130.1|  hypothetical protein VITISV_002335                   99.0    6e-20   
ref|XP_002447182.1|  hypothetical protein SORBIDRAFT_06g030040        99.0    6e-20   
gb|KDO75322.1|  hypothetical protein CISIN_1g006764mg                 98.6    7e-20   
ref|XP_011089687.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    7e-20   
ref|XP_006468280.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    7e-20   
ref|XP_010098595.1|  BTB/POZ domain-containing protein                98.6    7e-20   
emb|CBI17097.3|  unnamed protein product                              98.6    7e-20   
ref|XP_006448940.1|  hypothetical protein CICLE_v10014591mg           98.6    7e-20   
ref|XP_003632267.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    7e-20   
ref|XP_006602728.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    7e-20   
ref|XP_003577427.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    7e-20   
ref|XP_011089686.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    8e-20   
ref|XP_009783326.1|  PREDICTED: BTB/POZ domain-containing protein...  98.2    8e-20   
ref|XP_011089689.1|  PREDICTED: BTB/POZ domain-containing protein...  98.2    8e-20   
ref|XP_009622877.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    8e-20   
gb|KJB42465.1|  hypothetical protein B456_007G154300                  98.2    8e-20   
gb|KHG00255.1|  hypothetical protein F383_19997                       98.2    8e-20   
ref|XP_008235006.1|  PREDICTED: BTB/POZ domain-containing protein...  98.2    9e-20   
ref|XP_007199752.1|  hypothetical protein PRUPE_ppa002803mg           98.2    9e-20   
ref|XP_011095171.1|  PREDICTED: BTB/POZ domain-containing protein...  98.2    9e-20   
ref|XP_009792130.1|  PREDICTED: BTB/POZ domain-containing protein...  98.2    1e-19   
ref|XP_003551322.2|  PREDICTED: BTB/POZ domain-containing protein...  98.2    1e-19   
ref|XP_003521542.1|  PREDICTED: BTB/POZ domain-containing protein...  98.2    1e-19   
ref|XP_008385468.1|  PREDICTED: BTB/POZ domain-containing protein...  98.2    1e-19   
gb|EYU42051.1|  hypothetical protein MIMGU_mgv1a003173mg              98.2    1e-19   
ref|XP_002527435.1|  protein binding protein, putative                97.8    1e-19   
ref|XP_006389692.1|  hypothetical protein POPTR_0020s00510g           98.2    1e-19   
gb|ABR17518.1|  unknown                                               98.2    1e-19   
gb|KHN13450.1|  BTB/POZ domain-containing protein                     97.8    1e-19   
ref|XP_006856184.1|  hypothetical protein AMTR_s00059p00182270        98.2    1e-19   
ref|XP_009371616.1|  PREDICTED: BTB/POZ domain-containing protein...  97.8    1e-19   
ref|XP_010278266.1|  PREDICTED: BTB/POZ domain-containing protein...  97.8    1e-19   
ref|XP_011090549.1|  PREDICTED: BTB/POZ domain-containing protein...  97.8    1e-19   
ref|XP_007144554.1|  hypothetical protein PHAVU_007G165600g           97.8    1e-19   
ref|XP_006443605.1|  hypothetical protein CICLE_v10019330mg           97.8    1e-19   
ref|XP_007144555.1|  hypothetical protein PHAVU_007G165600g           97.8    1e-19   
gb|KHN28223.1|  BTB/POZ domain-containing protein                     97.8    1e-19   
ref|NP_001131511.1|  uncharacterized protein LOC100192849             96.3    1e-19   
ref|XP_009334929.1|  PREDICTED: BTB/POZ domain-containing protein...  97.8    1e-19   
ref|XP_008389180.1|  PREDICTED: BTB/POZ domain-containing protein...  97.8    1e-19   
ref|XP_006359095.1|  PREDICTED: BTB/POZ domain-containing protein...  97.8    1e-19   
ref|XP_009378916.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    2e-19   
emb|CDX84515.1|  BnaC03g49850D                                        97.8    2e-19   
ref|XP_008813120.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    2e-19   
ref|NP_001266239.1|  Hop-interacting protein THI063                   97.4    2e-19   
emb|CDP03873.1|  unnamed protein product                              97.4    2e-19   
emb|CDY27653.1|  BnaUnng00030D                                        97.4    2e-19   
ref|XP_009337389.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    2e-19   
ref|XP_004246916.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    2e-19   
ref|XP_009109587.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    2e-19   
ref|XP_008813119.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    2e-19   
ref|XP_009337391.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    2e-19   
ref|XP_010905431.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    2e-19   
gb|KHN43539.1|  BTB/POZ domain-containing protein                     97.4    2e-19   
ref|XP_006604703.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    2e-19   
gb|ACA64834.1|  SKIP interacting protein 17                           97.4    2e-19   
ref|XP_011001651.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    2e-19   
ref|XP_007033473.1|  Phototropic-responsive NPH3 family protein i...  97.4    2e-19   
ref|XP_007033472.1|  Phototropic-responsive NPH3 family protein i...  97.1    2e-19   
ref|XP_009406573.1|  PREDICTED: BTB/POZ domain-containing protein...  97.4    2e-19   
gb|ABA99392.2|  transposon protein, putative, Mutator sub-class, ...  97.4    2e-19   
dbj|BAB10932.1|  photoreceptor-interacting protein-like               97.1    2e-19   
ref|XP_010931398.1|  PREDICTED: BTB/POZ domain-containing protein...  96.7    2e-19   
ref|XP_002312886.2|  hypothetical protein POPTR_0009s15270g           97.1    2e-19   
ref|XP_006374056.1|  phototropic-responsive family protein            96.7    2e-19   
ref|XP_009364840.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    2e-19   
ref|XP_009757792.1|  PREDICTED: BTB/POZ domain-containing protein...  96.7    2e-19   
ref|XP_009605138.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    2e-19   
ref|XP_003604967.1|  BTB/POZ domain-containing protein                97.1    2e-19   
ref|XP_009605134.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    2e-19   
ref|XP_002882618.1|  predicted protein                                93.6    3e-19   
ref|XP_009757790.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    3e-19   
ref|XP_002323684.2|  hypothetical protein POPTR_0016s14670g           96.7    3e-19   
ref|XP_009140160.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    3e-19   
ref|XP_009140161.1|  PREDICTED: BTB/POZ domain-containing protein...  97.1    3e-19   
ref|XP_010931396.1|  PREDICTED: BTB/POZ domain-containing protein...  96.7    3e-19   
ref|XP_002877714.1|  predicted protein                                96.3    3e-19   
ref|XP_008794467.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    3e-19   
emb|CDX73781.1|  BnaC08g22220D                                        96.3    3e-19   
ref|XP_009611132.1|  PREDICTED: BTB/POZ domain-containing protein...  96.7    3e-19   
gb|AHH91633.1|  SOD2 protein                                          95.1    3e-19   
ref|XP_011046734.1|  PREDICTED: BTB/POZ domain-containing protein...  96.7    3e-19   
ref|XP_002298828.2|  phototropic-responsive NPH3 family protein       96.7    3e-19   
gb|KFK44855.1|  hypothetical protein AALP_AA1G311200                  96.7    3e-19   
ref|XP_004144382.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    3e-19   
gb|KGN58361.1|  hypothetical protein Csa_3G627720                     96.7    3e-19   
ref|XP_010520662.1|  PREDICTED: putative BTB/POZ domain-containin...  94.0    3e-19   
gb|EEC69668.1|  hypothetical protein OsI_39098                        97.4    3e-19   
gb|KDP21845.1|  hypothetical protein JCGZ_00632                       96.3    4e-19   
gb|AAS79592.1|  putative non-phototropic hypocotyl 3-like protein     96.7    4e-19   
ref|XP_006354400.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    4e-19   
ref|XP_004972932.1|  PREDICTED: BTB/POZ domain-containing protein...  96.7    4e-19   
ref|XP_008794466.1|  PREDICTED: BTB/POZ domain-containing protein...  96.7    4e-19   
emb|CDP02432.1|  unnamed protein product                              96.7    4e-19   
ref|XP_004506596.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    4e-19   
dbj|BAK03444.1|  predicted protein                                    94.7    4e-19   
ref|XP_011033589.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    4e-19   
gb|ACN35855.1|  unknown                                               96.7    4e-19   
gb|KHN29482.1|  BTB/POZ domain-containing protein                     96.3    4e-19   
gb|EYU40606.1|  hypothetical protein MIMGU_mgv1a003057mg              96.3    4e-19   
ref|XP_008647352.1|  PREDICTED: uncharacterized protein LOC100192...  96.3    4e-19   
gb|AFW74482.1|  putative phototropic-responsive NPH3 family protein   96.7    4e-19   
ref|XP_004970185.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    4e-19   
ref|XP_008647351.1|  PREDICTED: uncharacterized protein LOC100192...  96.3    4e-19   
ref|XP_006855474.1|  hypothetical protein AMTR_s00057p00189750        96.3    4e-19   
gb|KEH38919.1|  phototropic-responsive NPH3 family protein            96.3    5e-19   
ref|XP_006356774.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    5e-19   
ref|XP_009150508.1|  PREDICTED: root phototropism protein 3 isofo...  96.7    5e-19   
gb|KDP34354.1|  hypothetical protein JCGZ_11237                       96.3    5e-19   
ref|XP_008788108.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  95.9    5e-19   
ref|XP_010653126.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    5e-19   
ref|XP_009115761.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    5e-19   
ref|XP_011025673.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    5e-19   
ref|XP_010499573.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    5e-19   
ref|XP_010032181.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    6e-19   
gb|KJB09015.1|  hypothetical protein B456_001G119000                  95.9    6e-19   
ref|XP_011016336.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    6e-19   
ref|XP_004156559.1|  PREDICTED: putative BTB/POZ domain-containin...  95.9    6e-19   
ref|XP_010465263.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    6e-19   
ref|XP_004137290.1|  PREDICTED: putative BTB/POZ domain-containin...  95.9    6e-19   
gb|KDP31835.1|  hypothetical protein JCGZ_12296                       95.9    6e-19   
gb|KJB09013.1|  hypothetical protein B456_001G119000                  95.9    6e-19   
ref|XP_011033592.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    6e-19   
gb|KDO46252.1|  hypothetical protein CISIN_1g0470461mg                95.1    6e-19   
ref|XP_002890870.1|  phototropic-responsive NPH3 family protein       95.9    6e-19   



>ref|XP_011089543.1| PREDICTED: root phototropism protein 2-like [Sesamum indicum]
Length=563

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 168/192 (88%), Gaps = 8/192 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  380  NGIANLVPKTARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  439

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSGA+D K TP+A+ TRNQLQAD +LVKENEALRTELL+MK
Sbjct  440  KRLPVQIVLHALYYDQLKLRSGADDHK-TPDALTTRNQLQADTSLVKENEALRTELLKMK  498

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I D+Q        S   +S  + +KPTFFSS+SK LGKLNPFKHGSKDTSN+DDG VD
Sbjct  499  MYIQDIQK-------SQGTTSKGSAKKPTFFSSVSKTLGKLNPFKHGSKDTSNIDDGMVD  551

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  552  LTKPRRRRFSIS  563



>ref|XP_009777101.1| PREDICTED: root phototropism protein 2 [Nicotiana sylvestris]
Length=574

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 165/192 (86%), Gaps = 4/192 (2%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD LKLSYEARVHASQN
Sbjct  387  NGIAILVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDTLKLSYEARVHASQN  446

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALY+DQLKIRSG +D  + P+A+ATRNQLQADV+LVKENEALRTELL+MK
Sbjct  447  KRLPVQIVLHALYFDQLKIRSGGDDTSNLPDAMATRNQLQADVSLVKENEALRTELLKMK  506

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I+D+Q            +  S  RKPTFFSS+SKKLGKLNPFKHGSKDTS +DD  VD
Sbjct  507  MYISDIQK----TSQGTTSAKPSLSRKPTFFSSVSKKLGKLNPFKHGSKDTSMIDDATVD  562

Query  168  ITKPRRRRFSIS  133
            ITKPRRRRFSIS
Sbjct  563  ITKPRRRRFSIS  574



>ref|XP_009611218.1| PREDICTED: root phototropism protein 2 [Nicotiana tomentosiformis]
Length=575

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 164/192 (85%), Gaps = 4/192 (2%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD LKLSYEARVHASQN
Sbjct  388  NGIAILVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDTLKLSYEARVHASQN  447

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALY+DQLKIRSG +D  + P A+ATRNQLQADV+LVKENEALRTELL+MK
Sbjct  448  KRLPVQIVLHALYFDQLKIRSGGDDTSNLPEAMATRNQLQADVSLVKENEALRTELLKMK  507

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I+D+Q            +  S  RKPTFFSS+SKKLGKLNPFKHGSKDTS +DD  VD
Sbjct  508  MYISDIQK----TSQGTTSAKPSLSRKPTFFSSVSKKLGKLNPFKHGSKDTSMIDDATVD  563

Query  168  ITKPRRRRFSIS  133
            ITKPRRRRFSIS
Sbjct  564  ITKPRRRRFSIS  575



>gb|KJB26283.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=532

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 166/193 (86%), Gaps = 5/193 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KGARKV+DDLYRAIDIYLK+HP LDEIEREKVCS MDPLKLSYEARVHASQN
Sbjct  344  NGIANLVPKGARKVEDDLYRAIDIYLKSHPNLDEIEREKVCSSMDPLKLSYEARVHASQN  403

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQADV+LVKENEALRTELL+MK
Sbjct  404  KRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQADVSLVKENEALRTELLKMK  463

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-EV  172
            M+I+DMQ        +   S +   RKPTFFSSMSK LGKLNPF+HGSKDTS++DD   V
Sbjct  464  MYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKLNPFRHGSKDTSHIDDNLGV  519

Query  171  DITKPRRRRFSIS  133
            D+TKPRRRRFSIS
Sbjct  520  DVTKPRRRRFSIS  532



>gb|KJB26282.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=558

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 166/193 (86%), Gaps = 5/193 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KGARKV+DDLYRAIDIYLK+HP LDEIEREKVCS MDPLKLSYEARVHASQN
Sbjct  370  NGIANLVPKGARKVEDDLYRAIDIYLKSHPNLDEIEREKVCSSMDPLKLSYEARVHASQN  429

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQADV+LVKENEALRTELL+MK
Sbjct  430  KRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQADVSLVKENEALRTELLKMK  489

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-EV  172
            M+I+DMQ        +   S +   RKPTFFSSMSK LGKLNPF+HGSKDTS++DD   V
Sbjct  490  MYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKLNPFRHGSKDTSHIDDNLGV  545

Query  171  DITKPRRRRFSIS  133
            D+TKPRRRRFSIS
Sbjct  546  DVTKPRRRRFSIS  558



>gb|KJB26284.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=574

 Score =   301 bits (770),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 166/193 (86%), Gaps = 5/193 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KGARKV+DDLYRAIDIYLK+HP LDEIEREKVCS MDPLKLSYEARVHASQN
Sbjct  386  NGIANLVPKGARKVEDDLYRAIDIYLKSHPNLDEIEREKVCSSMDPLKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D ++ P+A+ TRNQLQADV+LVKENEALRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGGADDRNQPDAVTTRNQLQADVSLVKENEALRTELLKMK  505

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-EV  172
            M+I+DMQ        +   S +   RKPTFFSSMSK LGKLNPF+HGSKDTS++DD   V
Sbjct  506  MYISDMQK----NNQTGTSSKSVGTRKPTFFSSMSKTLGKLNPFRHGSKDTSHIDDNLGV  561

Query  171  DITKPRRRRFSIS  133
            D+TKPRRRRFSIS
Sbjct  562  DVTKPRRRRFSIS  574



>ref|XP_006432049.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45289.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=382

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 165/195 (85%), Gaps = 3/195 (2%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+CS MDPLKLSYEARVHASQN
Sbjct  188  NGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDPLKLSYEARVHASQN  247

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV+L+KENEALR+EL +MK
Sbjct  248  KRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVSLIKENEALRSELTRMK  307

Query  348  MFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--G  178
            ++I+DMQ     +   S   S  S  +K TFFSSMSK  GKLNPFKHGSKDTSN+DD   
Sbjct  308  LYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDTSNIDDDVA  367

Query  177  EVDITKPRRRRFSIS  133
             +D TKPRRRRFSIS
Sbjct  368  AMDGTKPRRRRFSIS  382



>emb|CDP04035.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 163/192 (85%), Gaps = 5/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV K ARKVDDD+YRA+DIYLKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  387  NGIAILVPKAARKVDDDVYRAVDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  446

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG ED K  PNAI TR QLQAD +L +ENE LRTELL+MK
Sbjct  447  KRLPVQIVLHALYYDQLKLRSGTEDQK-MPNAITTRRQLQADTSLARENEELRTELLKMK  505

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+IAD+Q            ++A++ ++PTFFSSMSK LGKLNPFKHGSKDTSNLDD  VD
Sbjct  506  MYIADLQK----TQGPSTKATAASSKRPTFFSSMSKTLGKLNPFKHGSKDTSNLDDALVD  561

Query  168  ITKPRRRRFSIS  133
            I+KPRRRRFSIS
Sbjct  562  ISKPRRRRFSIS  573



>emb|CBI15802.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 166/193 (86%), Gaps = 7/193 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV K ARKVDDDLYRAIDI+LKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  27   NGIANLVPKDARKVDDDLYRAIDIFLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  86

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQADV+LV+ENEALR+EL++MK
Sbjct  87   KRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQADVSLVRENEALRSELMKMK  143

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD-GEV  172
            M+I+D+Q   S+ G    G  +    KPTFFSSMSK LGKLNPF+HGSKDTSN+DD   V
Sbjct  144  MYISDIQKNSSAGGGKGLGGGSK---KPTFFSSMSKTLGKLNPFRHGSKDTSNIDDETAV  200

Query  171  DITKPRRRRFSIS  133
            D+TKPRRRRFSIS
Sbjct  201  DVTKPRRRRFSIS  213



>ref|XP_010244564.1| PREDICTED: root phototropism protein 2 [Nelumbo nucifera]
Length=571

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 162/192 (84%), Gaps = 6/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV K ARKVDDDLYRAIDIYLKAH  LDEIEREKVCSVMDP KLSYEARVHASQN
Sbjct  386  NGIATLVPKTARKVDDDLYRAIDIYLKAHQNLDEIEREKVCSVMDPHKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D + T +A+ TRNQ+QADV+L+KENEALRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGVIDDRKTQDALMTRNQIQADVSLIKENEALRTELLKMK  505

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I+D+Q       +    S +   RKPTFFSS+SK LGKLNPF+HGSKDTSN+DD  +D
Sbjct  506  MYISDLQK------NQGTSSKSGGSRKPTFFSSVSKTLGKLNPFRHGSKDTSNIDDSAID  559

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFS+S
Sbjct  560  LTKPRRRRFSVS  571



>ref|XP_006432045.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432047.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45285.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45287.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=541

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 165/195 (85%), Gaps = 3/195 (2%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+CS MDPLKLSYEARVHASQN
Sbjct  347  NGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDPLKLSYEARVHASQN  406

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV+L+KENEALR+EL +MK
Sbjct  407  KRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVSLIKENEALRSELTRMK  466

Query  348  MFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--G  178
            ++I+DMQ     +   S   S  S  +K TFFSSMSK  GKLNPFKHGSKDTSN+DD   
Sbjct  467  LYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDTSNIDDDVA  526

Query  177  EVDITKPRRRRFSIS  133
             +D TKPRRRRFSIS
Sbjct  527  AMDGTKPRRRRFSIS  541



>gb|EYU36889.1| hypothetical protein MIMGU_mgv1a003487mg [Erythranthe guttata]
Length=582

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 167/200 (84%), Gaps = 8/200 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  383  NGIANLVPKAARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  442

Query  528  KRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVTLVKENEALRTELLQM  352
            KRLPVQIVLHALYYDQL +RSGA ED   TP+A +TRNQLQADV+L KENEALRTELL+M
Sbjct  443  KRLPVQIVLHALYYDQLMLRSGADEDDHKTPDAGSTRNQLQADVSLAKENEALRTELLKM  502

Query  351  KMFIADMQ-------NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  193
            KM+I D+Q          S+  S+   +SAS  RKP FFSSMSK LGKLNPFKHGSKDT 
Sbjct  503  KMYIQDIQRPQGTTSKAVSTSTSTSASASASTSRKPKFFSSMSKTLGKLNPFKHGSKDTL  562

Query  192  NLDDGEVDITKPRRRRFSIS  133
            NLD+G  D+TKPRRRRFSIS
Sbjct  563  NLDEGMPDLTKPRRRRFSIS  582



>ref|XP_006432046.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432048.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006464960.1| PREDICTED: root phototropism protein 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45286.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45288.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=584

 Score =   291 bits (744),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 165/195 (85%), Gaps = 3/195 (2%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+CS MDPLKLSYEARVHASQN
Sbjct  390  NGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDPLKLSYEARVHASQN  449

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV+L+KENEALR+EL +MK
Sbjct  450  KRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVSLIKENEALRSELTRMK  509

Query  348  MFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--G  178
            ++I+DMQ     +   S   S  S  +K TFFSSMSK  GKLNPFKHGSKDTSN+DD   
Sbjct  510  LYISDMQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDTSNIDDDVA  569

Query  177  EVDITKPRRRRFSIS  133
             +D TKPRRRRFSIS
Sbjct  570  AMDGTKPRRRRFSIS  584



>ref|XP_007017103.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY34722.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=576

 Score =   290 bits (743),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 165/195 (85%), Gaps = 7/195 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARKV+DDLYRAIDIYLKAHP LDEIEREKVCS MDPLKLSYEARVHASQN
Sbjct  386  NGIAILVPKGARKVEDDLYRAIDIYLKAHPNLDEIEREKVCSSMDPLKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAED--PKSTPNAIATRNQLQADVTLVKENEALRTELLQ  355
            KRLPVQIVLHALYYDQLK+RSGA D   ++  +A+ATRNQLQADV+LVKENEALR+EL +
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGAVDDRERNAADAVATRNQLQADVSLVKENEALRSELKK  505

Query  354  MKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-  178
            MKM+I+D+Q             SA+  RKPTFFSSMSK LGKLNPF+HGSKDTSN+DD  
Sbjct  506  MKMYISDLQK----NNQGTCSKSAAGNRKPTFFSSMSKTLGKLNPFRHGSKDTSNIDDSL  561

Query  177  EVDITKPRRRRFSIS  133
             VD+TKPRRRRFSIS
Sbjct  562  GVDVTKPRRRRFSIS  576



>gb|KDO54918.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=541

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 164/195 (84%), Gaps = 3/195 (2%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+CS MDPLKLSYEARVHASQN
Sbjct  347  NGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDPLKLSYEARVHASQN  406

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV L+KENEALR+EL +MK
Sbjct  407  KRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVLLIKENEALRSELTRMK  466

Query  348  MFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--G  178
            ++I+D+Q     +   S   S  S  +K TFFSSMSK  GKLNPFKHGSKDTSN+DD   
Sbjct  467  LYISDVQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDTSNIDDDVA  526

Query  177  EVDITKPRRRRFSIS  133
             +D TKPRRRRFSIS
Sbjct  527  AMDGTKPRRRRFSIS  541



>gb|KDO54917.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=584

 Score =   288 bits (736),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 164/195 (84%), Gaps = 3/195 (2%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KG+RKVDDDLYRAIDIYLKAHP LDEIEREK+CS MDPLKLSYEARVHASQN
Sbjct  390  NGIANLVPKGSRKVDDDLYRAIDIYLKAHPNLDEIEREKICSSMDPLKLSYEARVHASQN  449

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG ++ +STP+A ATRNQLQADV L+KENEALR+EL +MK
Sbjct  450  KRLPVQIVLHALYYDQLKLRSGLDNDRSTPDAAATRNQLQADVLLIKENEALRSELTRMK  509

Query  348  MFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--G  178
            ++I+D+Q     +   S   S  S  +K TFFSSMSK  GKLNPFKHGSKDTSN+DD   
Sbjct  510  LYISDVQKGNNQAGTGSSSKSGTSGHKKHTFFSSMSKTFGKLNPFKHGSKDTSNIDDDVA  569

Query  177  EVDITKPRRRRFSIS  133
             +D TKPRRRRFSIS
Sbjct  570  AMDGTKPRRRRFSIS  584



>ref|XP_006353728.1| PREDICTED: root phototropism protein 2-like [Solanum tuberosum]
Length=576

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 166/195 (85%), Gaps = 7/195 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARK DDDLYRA+DIYLKAHP LDEIEREKVCSVMDPLKLS+EARVHASQN
Sbjct  386  NGIAILVPKGARKADDDLYRAVDIYLKAHPHLDEIEREKVCSVMDPLKLSHEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKST--PNAIATRNQLQADVTLVKENEALRTELLQ  355
            KRLPVQIVLHALY+DQLK+RSGA D  +   P A+ATRNQLQADV+LVKENE LRTELL+
Sbjct  446  KRLPVQIVLHALYFDQLKLRSGAADDTNNNMPEAMATRNQLQADVSLVKENEVLRTELLK  505

Query  354  MKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNL-DDG  178
            MKM+IAD+Q       +S +G+S   ++K TFFSS+SK LGK NPFKHGSKDTSN+ DD 
Sbjct  506  MKMYIADIQK----TTTSTQGTSKGGLKKTTFFSSVSKTLGKFNPFKHGSKDTSNIVDDA  561

Query  177  EVDITKPRRRRFSIS  133
             +D+TKPRRRRFSIS
Sbjct  562  ALDLTKPRRRRFSIS  576



>ref|XP_004243653.1| PREDICTED: root phototropism protein 2 [Solanum lycopersicum]
Length=576

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 167/195 (86%), Gaps = 7/195 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARK DDDLYRA+DIYLKAHP LDEIEREKVCSVMDPLKLS+EARVHASQN
Sbjct  386  NGIAILVPKGARKADDDLYRAVDIYLKAHPHLDEIEREKVCSVMDPLKLSHEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKST--PNAIATRNQLQADVTLVKENEALRTELLQ  355
            KRLPVQIVLHALY+DQLKIRSGA D  +   P A+ATRNQLQADV+LVKENE LRTELL+
Sbjct  446  KRLPVQIVLHALYFDQLKIRSGAADDSNNNMPEAMATRNQLQADVSLVKENEVLRTELLK  505

Query  354  MKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNL-DDG  178
            MKM+IAD+Q       +S +G+S  +++K TFFSS+SK LGK NPFKHGSKDTS++ DD 
Sbjct  506  MKMYIADIQK----TTNSSQGTSKGSLKKTTFFSSVSKTLGKFNPFKHGSKDTSSIVDDA  561

Query  177  EVDITKPRRRRFSIS  133
             +D+TKPRRRRFSIS
Sbjct  562  ALDLTKPRRRRFSIS  576



>gb|KDP45678.1| hypothetical protein JCGZ_17285 [Jatropha curcas]
Length=575

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 164/194 (85%), Gaps = 7/194 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDPLKLSYEAR+HASQN
Sbjct  387  NGIAILVPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARLHASQN  446

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA-TRNQLQADVTLVKENEALRTELLQM  352
            KRLPVQIVLHALYYDQLK+RSG  +  +    ++ T+NQLQ DV+L++ENEALR+EL +M
Sbjct  447  KRLPVQIVLHALYYDQLKLRSGVVESSTPETPVSNTKNQLQTDVSLIRENEALRSELTKM  506

Query  351  KMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGE-  175
            K++I+DMQ       S+   S+ S  RKPTFFSSMSK LGKLNPFKHGSKDTS+LDDG  
Sbjct  507  KLYISDMQK-----NSNQGSSTKSGSRKPTFFSSMSKTLGKLNPFKHGSKDTSHLDDGAG  561

Query  174  VDITKPRRRRFSIS  133
            +DITKPRRRRFSIS
Sbjct  562  IDITKPRRRRFSIS  575



>ref|XP_010650806.1| PREDICTED: root phototropism protein 2 isoform X2 [Vitis vinifera]
Length=527

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 7/193 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV K ARKVDDDLYRAIDI+LKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  341  NGIANLVPKDARKVDDDLYRAIDIFLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  400

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQADV+LV+ENEALR+EL++MK
Sbjct  401  KRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQADVSLVRENEALRSELMKMK  457

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD-GEV  172
            M+I+D+Q    +  +          +KPTFFSSMSK LGKLNPF+HGSKDTSN+DD   V
Sbjct  458  MYISDIQK---NSSAGGGKGLGGGSKKPTFFSSMSKTLGKLNPFRHGSKDTSNIDDETAV  514

Query  171  DITKPRRRRFSIS  133
            D+TKPRRRRFSIS
Sbjct  515  DVTKPRRRRFSIS  527



>ref|XP_011041764.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=574

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 168/194 (87%), Gaps = 5/194 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDPLKLSYEAR+HASQN
Sbjct  384  NGIATLVRKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARIHASQN  443

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLP+QIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+DV+LV ENEALR+EL +MK
Sbjct  444  KRLPLQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQSDVSLVSENEALRSELKKMK  500

Query  348  MFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-E  175
            ++I++MQ NKGSS  S    ++ S  RK TFFSSMSK LGKLNPFKHGSKDTS++DD   
Sbjct  501  LYISEMQKNKGSSAKSISAAAATSGPRKHTFFSSMSKTLGKLNPFKHGSKDTSHIDDNLA  560

Query  174  VDITKPRRRRFSIS  133
            VDITKPRRRRFS+S
Sbjct  561  VDITKPRRRRFSVS  574



>ref|XP_002264896.1| PREDICTED: root phototropism protein 2 isoform X1 [Vitis vinifera]
Length=572

 Score =   283 bits (723),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 7/193 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV K ARKVDDDLYRAIDI+LKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  386  NGIANLVPKDARKVDDDLYRAIDIFLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSGA+D     +A++TR+ LQADV+LV+ENEALR+EL++MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGADDAH---DAMSTRSHLQADVSLVRENEALRSELMKMK  502

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD-GEV  172
            M+I+D+Q    +  +          +KPTFFSSMSK LGKLNPF+HGSKDTSN+DD   V
Sbjct  503  MYISDIQK---NSSAGGGKGLGGGSKKPTFFSSMSKTLGKLNPFRHGSKDTSNIDDETAV  559

Query  171  DITKPRRRRFSIS  133
            D+TKPRRRRFSIS
Sbjct  560  DVTKPRRRRFSIS  572



>ref|XP_002325631.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEF00013.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=575

 Score =   283 bits (723),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 166/195 (85%), Gaps = 6/195 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARKVDDDLYRAIDIYLKAHP LDE+EREKVCSVMDPLKLSYEAR+HASQN
Sbjct  384  NGIATLVRKGARKVDDDLYRAIDIYLKAHPNLDEMEREKVCSVMDPLKLSYEARLHASQN  443

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+DV+LV ENEALR+EL +MK
Sbjct  444  KRLPVQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQSDVSLVSENEALRSELTKMK  500

Query  348  MFIADMQNkgssqgssvkgssasaV--RKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-  178
            ++I+DMQ    S   S+  ++A+    RK TFFSSMSK LGKLNPFKHGSKDTS++DD  
Sbjct  501  LYISDMQKDKGSSAKSISAAAATTSGPRKHTFFSSMSKTLGKLNPFKHGSKDTSHIDDNI  560

Query  177  EVDITKPRRRRFSIS  133
             VDITKPRRRRFS+S
Sbjct  561  AVDITKPRRRRFSVS  575



>ref|XP_010094443.1| Root phototropism protein 2 [Morus notabilis]
 gb|EXB56024.1| Root phototropism protein 2 [Morus notabilis]
Length=574

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 161/192 (84%), Gaps = 3/192 (2%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  386  NGIANLVPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D      A   R+QLQADV+LV+ENEALR EL +MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGVADDHDAKEAATARSQLQADVSLVRENEALRAELTKMK  505

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            ++I D+Q   + Q ++    +  + ++PTFFSS+SK LGKLNPFKHGSKDTS+++D  VD
Sbjct  506  LYITDIQK--NGQTTATSSRAVGSTKRPTFFSSVSKTLGKLNPFKHGSKDTSHIED-VVD  562

Query  168  ITKPRRRRFSIS  133
            I+KPRRRRFSIS
Sbjct  563  ISKPRRRRFSIS  574



>gb|KGN53487.1| hypothetical protein Csa_4G056750 [Cucumis sativus]
Length=572

 Score =   280 bits (715),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 163/195 (84%), Gaps = 7/195 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  382  NGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  441

Query  528  KRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADVTLVKENEALRTELL  358
            KRLPVQIVLHALYYDQLK+RSG  +D KST    AT  R Q QADV+LVKENEALR+EL+
Sbjct  442  KRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAATMARTQAQADVSLVKENEALRSELM  501

Query  357  QMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            +MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNPF+HGSKDTSN+DDG
Sbjct  502  KMKLYISDMQKSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNPFRHGSKDTSNIDDG  558

Query  177  EVDITKPRRRRFSIS  133
             +DITKPRRRRFSIS
Sbjct  559  -IDITKPRRRRFSIS  572



>ref|XP_004147730.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
 ref|XP_004164428.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
Length=582

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 163/195 (84%), Gaps = 7/195 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  392  NGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADVTLVKENEALRTELL  358
            KRLPVQIVLHALYYDQLK+RSG  +D KST    AT  R Q QADV+LVKENEALR+EL+
Sbjct  452  KRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAATMARTQAQADVSLVKENEALRSELM  511

Query  357  QMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            +MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNPF+HGSKDTSN+DDG
Sbjct  512  KMKLYISDMQKSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNPFRHGSKDTSNIDDG  568

Query  177  EVDITKPRRRRFSIS  133
             +DITKPRRRRFSIS
Sbjct  569  -IDITKPRRRRFSIS  582



>ref|XP_010677799.1| PREDICTED: root phototropism protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 161/192 (84%), Gaps = 5/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV K AR+ DDDLYRAIDIYLKAHP LDEIEREKVCS MDPLKLSYEARVHASQN
Sbjct  395  NGIANLVPKDARRTDDDLYRAIDIYLKAHPNLDEIEREKVCSSMDPLKLSYEARVHASQN  454

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQ+VLHALYYDQLK+RSGA D    P+AIATR Q++AD +L KENEAL++EL++MK
Sbjct  455  KRLPVQMVLHALYYDQLKLRSGAND-GPLPDAIATRGQVKADASLAKENEALKSELMKMK  513

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I+DMQ   ++   +   +      K TFFSSMSK LGKLNPFKHGSKDTS+LDD EVD
Sbjct  514  MYISDMQKNKATTSRTSTATGMP---KRTFFSSMSKTLGKLNPFKHGSKDTSHLDD-EVD  569

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  570  LTKPRRRRFSIS  581



>ref|XP_011011776.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=595

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 166/196 (85%), Gaps = 7/196 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARKVDDDLYRAIDI+LKAHP LDEIEREKVCSVMDPLKLSYEAR+HASQN
Sbjct  403  NGIAILVPKGARKVDDDLYRAIDIFLKAHPNLDEIEREKVCSVMDPLKLSYEARLHASQN  462

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG +D    P+A+ATR+QLQ+DV+LV+ENEALR+EL++MK
Sbjct  463  KRLPVQIVLHALYYDQLKLRSGVDD---QPDAVATRSQLQSDVSLVRENEALRSELMKMK  519

Query  348  MFIADM---QNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            ++I+DM   Q   +   ++    + +  RK +FFSSMSK LGKLNPFKHGSKDT +++D 
Sbjct  520  LYISDMQKNQGSSTKGIAAAAAPTTTGSRKHSFFSSMSKTLGKLNPFKHGSKDTLHINDN  579

Query  177  -EVDITKPRRRRFSIS  133
              VDITKPRRRRFSIS
Sbjct  580  IGVDITKPRRRRFSIS  595



>ref|XP_008451888.1| PREDICTED: root phototropism protein 2 isoform X2 [Cucumis melo]
Length=582

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 163/195 (84%), Gaps = 7/195 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  392  NGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADVTLVKENEALRTELL  358
            KRLPVQIVLHALYYDQLK+RSG  +D KST    A+  R Q QADV+LVKENEALR+EL+
Sbjct  452  KRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAASMARTQAQADVSLVKENEALRSELM  511

Query  357  QMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            +MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNPF+HGSKDTSN+DDG
Sbjct  512  KMKLYISDMQRSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNPFRHGSKDTSNIDDG  568

Query  177  EVDITKPRRRRFSIS  133
             +DITKPRRRRFSIS
Sbjct  569  -IDITKPRRRRFSIS  582



>ref|XP_002533880.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF28503.1| Root phototropism protein, putative [Ricinus communis]
Length=549

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 162/195 (83%), Gaps = 9/195 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KG+R VDDDLYRAIDIYLK+HP LDEIEREKVCSVMDPLKLSYEAR+HASQN
Sbjct  361  NGIAMLVPKGSRGVDDDLYRAIDIYLKSHPHLDEIEREKVCSVMDPLKLSYEARLHASQN  420

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA--TRNQLQADVTLVKENEALRTELLQ  355
            KRLPVQIVLH LY+DQLK+RSG  D +STP A+A  T++QLQ DV+L++ENEALR+EL++
Sbjct  421  KRLPVQIVLHCLYFDQLKLRSGVAD-RSTPEAMAPNTKSQLQTDVSLIRENEALRSELMK  479

Query  354  MKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGE  175
            MK++I DMQ       S    S+    RK TFFSSMSK LGKLNPFKHGSKDTS++DD  
Sbjct  480  MKLYITDMQK-----SSQGTTSARGGPRKTTFFSSMSKTLGKLNPFKHGSKDTSHIDDSA  534

Query  174  -VDITKPRRRRFSIS  133
             VDITKPRRRRFSIS
Sbjct  535  GVDITKPRRRRFSIS  549



>ref|XP_002319980.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEE95903.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=578

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 165/196 (84%), Gaps = 7/196 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARKVDDDLYRAIDI+LKAHP LDEIEREKVCSVMDPLKLSYEAR+HASQN
Sbjct  386  NGIAILVPKGARKVDDDLYRAIDIFLKAHPNLDEIEREKVCSVMDPLKLSYEARLHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D    P+A+ATR+QLQ+DV+LV+ENEALR+EL++MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGVND---QPDAVATRSQLQSDVSLVRENEALRSELMKMK  502

Query  348  MFIADM---QNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            ++I+DM   Q   +   ++    + +  RK +FFSSMSK LGKLNPFKHGSKDT +++D 
Sbjct  503  LYISDMQKNQGSSTKGIAATAAPTTTGSRKHSFFSSMSKTLGKLNPFKHGSKDTFHINDN  562

Query  177  -EVDITKPRRRRFSIS  133
              VDITKPRRRRFSIS
Sbjct  563  IGVDITKPRRRRFSIS  578



>ref|XP_011015900.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=579

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 167/199 (84%), Gaps = 10/199 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGI+ LV KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDPLKLSYEAR+HASQN
Sbjct  384  NGISTLVRKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARIHASQN  443

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLP+QIVLH LYYDQLK+RSGA+D    P+A ATR+QLQ+DV+LV ENEALR+EL +MK
Sbjct  444  KRLPLQIVLHTLYYDQLKLRSGADD---QPDAAATRSQLQSDVSLVSENEALRSELKKMK  500

Query  348  MFIADMQNkgssqgssvkgssasaV------RKPTFFSSMSKKLGKLNPFKHGSKDTSNL  187
            ++I++MQ    S   S+  ++A+A       RK TFFSSMSK LGKLNPFKHGSKDTS++
Sbjct  501  LYISEMQKNKGSSAKSISAAAAAAAAATSGPRKHTFFSSMSKTLGKLNPFKHGSKDTSHI  560

Query  186  DDG-EVDITKPRRRRFSIS  133
            DD   VDITKPRRRRFS+S
Sbjct  561  DDNLAVDITKPRRRRFSVS  579



>ref|XP_007206420.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
 gb|EMJ07619.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
Length=583

 Score =   277 bits (709),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 159/198 (80%), Gaps = 6/198 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD LKLSYEARVHASQN
Sbjct  386  NGIANLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDALKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG ++     +A+ TR+Q+Q DV+L +ENE+LRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGVDENDMMQDAVTTRSQVQQDVSLARENESLRTELLRMK  505

Query  348  MFIADMQNk------gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNL  187
            M+I D+Q             ++  G      RK TFFSS+SKKLGKLNPFK GSKDTSN+
Sbjct  506  MYITDLQKSGPAAKGSLGSATTSSGKGGGGPRKGTFFSSVSKKLGKLNPFKQGSKDTSNI  565

Query  186  DDGEVDITKPRRRRFSIS  133
             D  VDITKPRRRRFSIS
Sbjct  566  MDEGVDITKPRRRRFSIS  583



>ref|XP_004294714.1| PREDICTED: root phototropism protein 2 [Fragaria vesca subsp. 
vesca]
Length=581

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 167/196 (85%), Gaps = 5/196 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD LKLSYEAR+HASQN
Sbjct  387  NGIAVLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDALKLSYEARLHASQN  446

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG E+ ++  +A +TRNQ+QADV+L KENE LRTELL+MK
Sbjct  447  KRLPVQIVLHALYYDQLKLRSGEEENETQIDAASTRNQVQADVSLAKENEVLRTELLKMK  506

Query  348  MFIADMQN----kgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD  181
            M+I+D++      G+S  ++  G      RKPTFFSS+SKKLGKLNPFK+GSKDTSN+DD
Sbjct  507  MYISDIKKSGGGAGASAATTSSGKGGGGPRKPTFFSSVSKKLGKLNPFKNGSKDTSNIDD  566

Query  180  GEVDITKPRRRRFSIS  133
              VD+TKPRRRRFSIS
Sbjct  567  C-VDVTKPRRRRFSIS  581



>ref|XP_009374407.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 158/193 (82%), Gaps = 2/193 (1%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMD LKLSYEARVHASQN
Sbjct  386  NGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDALKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D     +A+ TR+Q+Q DV+L +ENE LRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGV-DENDVQDAVTTRSQVQHDVSLARENEELRTELLKMK  504

Query  348  MFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  172
            M+I D+Q    +   ++  G      +K TFFSS+SKKLGKLNPFK GSKDTSN+ D  V
Sbjct  505  MYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFKQGSKDTSNIMDEGV  564

Query  171  DITKPRRRRFSIS  133
            DITKPRRRRFSIS
Sbjct  565  DITKPRRRRFSIS  577



>gb|ADL36608.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 158/193 (82%), Gaps = 2/193 (1%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMD LKLSYEARVHASQN
Sbjct  386  NGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDALKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D     +AI TR+++Q DV+L +ENE LRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSRVQHDVSLARENEELRTELLKMK  504

Query  348  MFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  172
            M+I DMQ    +   ++  G      +K TFFSS+SKKLGKLNPFK GSKDTSN+ D  V
Sbjct  505  MYITDMQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFKQGSKDTSNIIDDGV  564

Query  171  DITKPRRRRFSIS  133
            DI+KPRRRRFSIS
Sbjct  565  DISKPRRRRFSIS  577



>ref|XP_008451887.1| PREDICTED: root phototropism protein 2 isoform X1 [Cucumis melo]
Length=666

 Score =   277 bits (708),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 163/195 (84%), Gaps = 7/195 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIAN++ K ARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  476  NGIANIIPKFARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQN  535

Query  528  KRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIAT--RNQLQADVTLVKENEALRTELL  358
            KRLPVQIVLHALYYDQLK+RSG  +D KST    A+  R Q QADV+LVKENEALR+EL+
Sbjct  536  KRLPVQIVLHALYYDQLKLRSGTPDDRKSTQEDAASMARTQAQADVSLVKENEALRSELM  595

Query  357  QMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            +MK++I+DMQ       S    +S S   K TFFSS+SK LGKLNPF+HGSKDTSN+DDG
Sbjct  596  KMKLYISDMQRSSQGTSSIKVPTSRS---KGTFFSSVSKTLGKLNPFRHGSKDTSNIDDG  652

Query  177  EVDITKPRRRRFSIS  133
             +DITKPRRRRFSIS
Sbjct  653  -IDITKPRRRRFSIS  666



>ref|XP_006591739.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=516

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 165/200 (83%), Gaps = 13/200 (7%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ K ARK+DDDLYRA+DIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  322  NGIATLIPKSARKIDDDLYRAVDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  381

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTLVKENEALRTELLQM  352
            KRLPVQIVLHALYYDQL++RSGAE+ +     +AT +NQLQ DVTLV+ENE LRTEL++M
Sbjct  382  KRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNQLQMDVTLVRENEELRTELMKM  436

Query  351  KMFIADMQNkgssqg-------ssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  193
            KM+I+D+Q   ++          +   ++    +K TFFSS+SK LGKLNPF++GSKDT+
Sbjct  437  KMYISDLQQNKNTNNGANPQGHGTTSSAANPNPKKATFFSSVSKTLGKLNPFRNGSKDTT  496

Query  192  NLDDGEVDITKPRRRRFSIS  133
            +L+DG VD+TKPRRRRFS+S
Sbjct  497  HLEDGNVDLTKPRRRRFSVS  516



>ref|XP_008239637.1| PREDICTED: root phototropism protein 2 isoform X2 [Prunus mume]
Length=584

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 161/199 (81%), Gaps = 7/199 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD LKLSYEARVHASQN
Sbjct  386  NGIANLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDALKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG ++ +   +A+ TR+Q+Q DV+L +ENE+LRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGVDENEMMQDAVTTRSQVQQDVSLARENESLRTELLRMK  505

Query  348  MFIADMQNk------gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK-DTSN  190
            M+I+D+Q             ++  G      RK TFFSS+SKKLGKLNPFK GSK DTSN
Sbjct  506  MYISDLQKSGPAAKGSLGAATTSSGKGGGGPRKGTFFSSVSKKLGKLNPFKQGSKDDTSN  565

Query  189  LDDGEVDITKPRRRRFSIS  133
            + D  VDITKPRRRRFSIS
Sbjct  566  IMDEGVDITKPRRRRFSIS  584



>ref|XP_008239576.1| PREDICTED: root phototropism protein 2 isoform X1 [Prunus mume]
Length=584

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 161/199 (81%), Gaps = 7/199 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV KGARKVDDDLYRA+DIYLKAHP LDEIEREKVCSVMD LKLSYEARVHASQN
Sbjct  386  NGIANLVPKGARKVDDDLYRAVDIYLKAHPNLDEIEREKVCSVMDALKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG ++ +   +A+ TR+Q+Q DV+L +ENE+LRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGVDENEMMQDAVTTRSQVQQDVSLARENESLRTELLRMK  505

Query  348  MFIADMQNk------gssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK-DTSN  190
            M+I+D+Q             ++  G      RK TFFSS+SKKLGKLNPFK GSK DTSN
Sbjct  506  MYISDLQKSGPAAKGSLGAATTSSGKGGGGPRKGTFFSSVSKKLGKLNPFKQGSKDDTSN  565

Query  189  LDDGEVDITKPRRRRFSIS  133
            + D  VDITKPRRRRFSIS
Sbjct  566  IMDEGVDITKPRRRRFSIS  584



>ref|XP_008366216.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=577

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 157/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMD LKLSYEARVHASQN
Sbjct  386  NGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDALKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q DV+L +ENE LRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGX-DENDVQDAITTRSQVQHDVSLARENEELRTELLKMK  504

Query  348  MFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  172
             +I D+Q    +   ++  G      +K TFFSS+SKKLGKLNPFK GSKDTSN+ D  V
Sbjct  505  XYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFKXGSKDTSNIIDDGV  564

Query  171  DITKPRRRRFSIS  133
            DI+KPRRRRFSIS
Sbjct  565  DISKPRRRRFSIS  577



>ref|XP_010023564.1| PREDICTED: root phototropism protein 2 [Eucalyptus grandis]
 gb|KCW59867.1| hypothetical protein EUGRSUZ_H02604 [Eucalyptus grandis]
Length=570

 Score =   272 bits (695),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 160/192 (83%), Gaps = 7/192 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA +V KGARKVDDDLYRAIDIYLK+HP LDEIEREK CS +DPLKLS EAR+HASQN
Sbjct  386  NGIATIVPKGARKVDDDLYRAIDIYLKSHPNLDEIEREKACSALDPLKLSPEARLHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG ED K  P+A+ TR+QLQAD +L+KENE LR+EL++MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGTEDHKG-PDAVTTRHQLQADSSLIKENEDLRSELMKMK  504

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I+D+Q       +    S+    ++ TFFSSMSK LGKLNPF+HGSKDTSN++D  VD
Sbjct  505  MYISDLQK-----TNHGTTSAKGGPKRHTFFSSMSKTLGKLNPFRHGSKDTSNIEDA-VD  558

Query  168  ITKPRRRRFSIS  133
            ITKPR+RRFSIS
Sbjct  559  ITKPRKRRFSIS  570



>ref|XP_003553189.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=573

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 164/195 (84%), Gaps = 7/195 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV K ARKVDDDLYRA+DIYLKAHP+LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  383  NGIAILVPKNARKVDDDLYRAVDIYLKAHPKLDEIEREKVCSVMDPLKLSYEARVHASQN  442

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQL++RSGAE+    P     +NQLQ DV+LV+ENE LRTEL++MK
Sbjct  443  KRLPVQIVLHALYYDQLRLRSGAEERDVEPE----KNQLQMDVSLVRENEELRTELMKMK  498

Query  348  MFIADMQNkgs---sqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            M+I+D+QNK +   +       +S++  +K TFFSS+SK LGKLNPF++GSKDT++L+D 
Sbjct  499  MYISDLQNKNTNNDANPQVHGTTSSATPKKATFFSSVSKTLGKLNPFRNGSKDTTHLEDA  558

Query  177  EVDITKPRRRRFSIS  133
             VD+TKPRRRRFS+S
Sbjct  559  SVDLTKPRRRRFSMS  573



>ref|NP_001280895.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36607.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 158/193 (82%), Gaps = 2/193 (1%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA+L+ KGARKVDDDLYRAIDIYLKAHP LDEIE+EKVCSVMD LKLSYEARVHASQN
Sbjct  386  NGIASLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEKEKVCSVMDALKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q DV+L +ENE LRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSQVQHDVSLARENEELRTELLKMK  504

Query  348  MFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  172
            M+I D+   G ++  ++         +K  FFSSMSKKLG+LNPFK GSKDTSN+ D +V
Sbjct  505  MYITDLHKTGPAAVATTSSCKGGGGPKKAKFFSSMSKKLGRLNPFKQGSKDTSNIMDEDV  564

Query  171  DITKPRRRRFSIS  133
            DITKPRRRRFSIS
Sbjct  565  DITKPRRRRFSIS  577



>ref|XP_003544940.2| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=579

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 158/192 (82%), Gaps = 2/192 (1%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ KG+RK DDDLYRA+DIYLK HP LDEIE+EKVCSV+DPLKLSYEARVHAS+N
Sbjct  390  NGIAILIPKGSRKSDDDLYRAVDIYLKVHPNLDEIEKEKVCSVLDPLKLSYEARVHASKN  449

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLP+QIVLHALYYDQL IRSG  + K    A+A + QLQADV+LV+ENE LR+EL++MK
Sbjct  450  KRLPLQIVLHALYYDQLHIRSGTAEEK-VALAVAEKKQLQADVSLVRENEELRSELMKMK  508

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            MFI+DMQ       SS    +    +KPTFFSSMSKKL KLNPFK+GSKDTS++DD  VD
Sbjct  509  MFISDMQK-HGHGTSSSGRENIGLAKKPTFFSSMSKKLSKLNPFKNGSKDTSHIDDAPVD  567

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  568  LTKPRRRRFSIS  579



>ref|XP_010522018.1| PREDICTED: root phototropism protein 2-like [Tarenaya hassleriana]
Length=572

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 156/193 (81%), Gaps = 6/193 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NG ANLV K ARKVDDDLYRA+DIYLKAHP LDEIEREK CS MDPLKLSYEAR+HASQN
Sbjct  385  NGFANLVPKAARKVDDDLYRAVDIYLKAHPNLDEIEREKACSSMDPLKLSYEARLHASQN  444

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPV IVLHALYYD LK+RSG ED +  P A+  R QLQ DV+L KENEALRTEL++MK
Sbjct  445  KRLPVNIVLHALYYDNLKLRSGKED-RDVPEAMEIRGQLQKDVSLEKENEALRTELMKMK  503

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNL-DDGEV  172
            M+++DMQ    S G+S     +    K TFFSS+SK LGKLNPF+HG+KDTSN+ DD  V
Sbjct  504  MYVSDMQKNQGSVGASSLSKKS----KYTFFSSVSKTLGKLNPFRHGAKDTSNIDDDSGV  559

Query  171  DITKPRRRRFSIS  133
            DITKPRRRRFSIS
Sbjct  560  DITKPRRRRFSIS  572



>ref|XP_006293884.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
 gb|EOA26782.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
Length=593

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 162/202 (80%), Gaps = 10/202 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTE  364
            KRLPV IVLHALYYDQLK+RSG ED +       P A+ TR+QLQAD TL KENEALR+E
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVEDQEERAVVVLPEALKTRSQLQADTTLAKENEALRSE  511

Query  363  LLQMKMFIADMQNkgssqgssvkgssasaVRKP---TFFSSMSKKLGKLNPFKHGSKDTS  193
            L++MKM+++DMQ   +  G+S   SS+    K    TFFSS+SKKLGKLNPFKHGSKDTS
Sbjct  512  LMKMKMYVSDMQKNKNGAGASSSNSSSLVSNKKSKNTFFSSVSKKLGKLNPFKHGSKDTS  571

Query  192  NLDD--GEVDITKPRRRRFSIS  133
            N+D+    VDITKPRRRRFSIS
Sbjct  572  NIDEDLAGVDITKPRRRRFSIS  593



>ref|XP_009355145.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 157/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA+L+ KGARKVDDDLYRAIDIYLKAHP LDEIE+EKVCSVMD LKLSYEARVHASQN
Sbjct  386  NGIASLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEKEKVCSVMDALKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG E+     +A  TR Q+Q DV+L +ENE LRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGVEE-NDVQDATMTRRQVQHDVSLARENEELRTELLKMK  504

Query  348  MFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  172
            M+I D+Q  G +   ++         +K TFFSS+SKKLG+LNPFK GSKDT N+ D +V
Sbjct  505  MYITDLQKTGPAGVATTSSCKGGGGPKKATFFSSVSKKLGRLNPFKQGSKDTMNIVDEDV  564

Query  171  DITKPRRRRFSIS  133
            D+TKPRRRRFSIS
Sbjct  565  DLTKPRRRRFSIS  577



>ref|XP_007146905.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
 gb|ESW18899.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
Length=573

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 167/196 (85%), Gaps = 9/196 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA LV K ARKVDDD+YRA+DIYLKAHP+LDEIEREKVCSVMDPLKLSYEAR+HASQN
Sbjct  383  NGIAILVPKSARKVDDDIYRAVDIYLKAHPKLDEIEREKVCSVMDPLKLSYEARLHASQN  442

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTLVKENEALRTELLQM  352
            KRLPVQIVLHALYYDQL++RSGAE+ +     +AT +N+L  DV+LV+ENE LRTELL+M
Sbjct  443  KRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNELHMDVSLVRENEELRTELLKM  497

Query  351  KMFIADMQNkgssqgssv---kgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD  181
            KM+I+DMQNK  +   S      +S+ + +K TFFSS+SK LG+LNPF++GSKDT++L+D
Sbjct  498  KMYISDMQNKNVNNAESTHGNGTTSSGSTKKATFFSSVSKTLGRLNPFRNGSKDTTHLED  557

Query  180  GEVDITKPRRRRFSIS  133
            G VD++KPRRRRFS+S
Sbjct  558  GNVDLSKPRRRRFSMS  573



>ref|XP_008349518.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 2-like 
[Malus domestica]
Length=577

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 156/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANL+ KGARKVDDDLYRAIDIYLKAHP LDEIEREKVCSVMD LKLSYEARVHASQN
Sbjct  386  NGIANLIPKGARKVDDDLYRAIDIYLKAHPNLDEIEREKVCSVMDALKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            K  PVQIVLHALYYDQLK+RSG  +     +AI TR+Q+Q DV+L +ENE LRTELL+MK
Sbjct  446  KTTPVQIVLHALYYDQLKLRSGXXE-NDVQDAITTRSQVQHDVSLARENEELRTELLKMK  504

Query  348  MFIADMQ-NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  172
            M+I D+Q    +   ++  G      +K TFFSS+SKKLGKLNPFK GSKDTSN+ D  V
Sbjct  505  MYITDLQKTGSAGIATTSSGKGGGGPKKATFFSSVSKKLGKLNPFKXGSKDTSNIIDDGV  564

Query  171  DITKPRRRRFSIS  133
            DI+KPRRRRFSIS
Sbjct  565  DISKPRRRRFSIS  577



>ref|XP_007142019.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
 gb|ESW14013.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
Length=580

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 160/192 (83%), Gaps = 1/192 (1%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGI+ L+  GARK DDDLYRA+DIYLKAHP LDEIE+EKVCSVMDPLKLSYEARVHAS+N
Sbjct  390  NGISILIPGGARKSDDDLYRAVDIYLKAHPNLDEIEKEKVCSVMDPLKLSYEARVHASKN  449

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLP+QIVLHALYYDQL +RSGA + K    A   + QLQADV+LV+ENE LR+EL++MK
Sbjct  450  KRLPLQIVLHALYYDQLHLRSGAAEDKEAGAAAVEKKQLQADVSLVRENEELRSELMKMK  509

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I DMQ  G+   SS K +SA A R PTF SSMSKKL KLNPFK+GSKDTS++DD  VD
Sbjct  510  MYITDMQKNGNGTSSSGKETSAPAKR-PTFLSSMSKKLSKLNPFKNGSKDTSHIDDAPVD  568

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  569  LTKPRRRRFSIS  580



>gb|ACJ85866.1| unknown [Medicago truncatula]
Length=376

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 156/192 (81%), Gaps = 5/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ KGARK+DDDLYRA+DIYLK H  LDE+E+EKVCSVMD LKLSYEARVHASQN
Sbjct  190  NGIAILIPKGARKLDDDLYRAVDIYLKVHTNLDELEKEKVCSVMDALKLSYEARVHASQN  249

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ DVTLV+ENE LRTEL++MK
Sbjct  250  KRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQTDVTLVRENEELRTELIRMK  305

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+++D+Q      G++        V+  TFFSS+SKKLGKLNPFK+GSKDTS+++D  VD
Sbjct  306  MYVSDLQK-NGHGGTTSSSEVGKEVKNSTFFSSVSKKLGKLNPFKNGSKDTSHIEDVGVD  364

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  365  LTKPRRRRFSIS  376



>ref|XP_010557176.1| PREDICTED: root phototropism protein 2 [Tarenaya hassleriana]
Length=575

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 154/193 (80%), Gaps = 5/193 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIANLV K ARKVDDDLYRA+DI+LK+HP LDEIEREKVCS +DPLKLSYEAR+HASQN
Sbjct  387  NGIANLVPKSARKVDDDLYRAVDIFLKSHPNLDEIEREKVCSSIDPLKLSYEARLHASQN  446

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPV IVLHALYYDQLK+RSG E+ +  P  +A R QLQ DV+L KENEALRTEL +MK
Sbjct  447  KRLPVNIVLHALYYDQLKLRSGVEE-RDAPEGLAIRGQLQTDVSLAKENEALRTELTKMK  505

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD-GEV  172
            M+I+DMQ        +   S  S     TFFSS+SK LGKLNPF+ GSKDT NLDD G V
Sbjct  506  MYISDMQKNQGGGVGASSSSKKSKH---TFFSSVSKTLGKLNPFRQGSKDTLNLDDAGGV  562

Query  171  DITKPRRRRFSIS  133
            DITKPRRRRFSIS
Sbjct  563  DITKPRRRRFSIS  575



>dbj|BAJ33924.1| unnamed protein product [Thellungiella halophila]
Length=597

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 160/206 (78%), Gaps = 14/206 (7%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS----TPNAIATRNQLQADVTLVKENEALRTEL  361
            KRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD +L KENEALR+EL
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVEDKEGAVVMVPEALATRGQVKADTSLAKENEALRSEL  511

Query  360  LQMKMFIADMQNkgssqgssvkg--------ssasaVRKPTFFSSMSKKLGKLNPFKHGS  205
            ++MKM+++D+Q    S G              ++    KPTFFSS+SKKLGKLNPF+HGS
Sbjct  512  MKMKMYVSDLQKNKQSGGGGAGASSSNSSSLVNSKKSNKPTFFSSVSKKLGKLNPFRHGS  571

Query  204  KDTSNLDD--GEVDITKPRRRRFSIS  133
            KDTSN+D+    VDITKPRRRRFSIS
Sbjct  572  KDTSNIDEDLAGVDITKPRRRRFSIS  597



>gb|ACJ85743.1| unknown [Medicago truncatula]
Length=257

 Score =   257 bits (657),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 158/192 (82%), Gaps = 6/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  72   NGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVCSVMDPLKLSYEARVHASQN  131

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV ENE LR+EL +MK
Sbjct  132  KRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLVGENEELRSELTKMK  190

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+G+KDT++L+DG VD
Sbjct  191  MYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKNGAKDTAHLEDGPVD  245

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  246  LTKPRRRRFSIS  257



>ref|XP_010469846.1| PREDICTED: root phototropism protein 2 isoform X1 [Camelina sativa]
 ref|XP_010469847.1| PREDICTED: root phototropism protein 2 isoform X2 [Camelina sativa]
Length=595

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 163/204 (80%), Gaps = 12/204 (6%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIATRNQLQADVTLVKENEALRT  367
            KRLPV IVLHALYYDQLK+RSG E+ +      + P A+ TR+QLQAD TL KENEALR+
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVEEHEERAVVVNLPEALKTRSQLQADTTLAKENEALRS  511

Query  366  ELLQMKMFIADMQ----NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  199
            EL++MKM+++DMQ      G+S  +S    S +   K TFFSS+SKKLGKLNPF+HGSKD
Sbjct  512  ELMKMKMYVSDMQKNKNGAGASSSNSTSLVSNNKKSKHTFFSSVSKKLGKLNPFRHGSKD  571

Query  198  TSNLDD--GEVDITKPRRRRFSIS  133
            TSNLD+    VDITKPRRRRFSIS
Sbjct  572  TSNLDEDLAGVDITKPRRRRFSIS  595



>gb|AAB63086.1| unknown protein [Arabidopsis thaliana]
Length=415

 Score =   262 bits (670),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 161/202 (80%), Gaps = 10/202 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  214  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  273

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTE  364
            KRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL KENEALR+E
Sbjct  274  KRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSE  333

Query  363  LLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  193
            L++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPFK+GSKDTS
Sbjct  334  LMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPFKNGSKDTS  393

Query  192  NLDD--GEVDITKPRRRRFSIS  133
            ++D+  G VDITKPRRRRFSIS
Sbjct  394  HIDEDLGGVDITKPRRRRFSIS  415



>ref|XP_003519296.1| PREDICTED: root phototropism protein 2 [Glycine max]
Length=580

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 156/192 (81%), Gaps = 1/192 (1%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ KGARK DDDLYRA+DIYLK HP LDEIE+EKVCSV+D LKLSYEARVHAS+N
Sbjct  390  NGIAILIPKGARKSDDDLYRAVDIYLKVHPNLDEIEKEKVCSVLDTLKLSYEARVHASKN  449

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLP+QIVLHALYYDQL+IRSG    K    A A + QLQADV+LV+ENE LR+EL++MK
Sbjct  450  KRLPLQIVLHALYYDQLQIRSGTAADKQAVVAAAEKKQLQADVSLVRENEELRSELMKMK  509

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            MFI+D+Q       SS    +    +KPTFFSSMSKKL KLNPFK+GSKDTS++DD  VD
Sbjct  510  MFISDLQK-NVHGTSSSGRENIGPTKKPTFFSSMSKKLSKLNPFKNGSKDTSHIDDAPVD  568

Query  168  ITKPRRRRFSIS  133
            +TKPR+RRFSIS
Sbjct  569  LTKPRKRRFSIS  580



>gb|KEH28209.1| root phototropism-like protein [Medicago truncatula]
Length=536

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 157/192 (82%), Gaps = 5/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ KGARK+DDDLYRA+DIYLK H  LDE+E+EKVCSVMD LKLSYEARVHASQN
Sbjct  350  NGIAILIPKGARKLDDDLYRAVDIYLKVHTNLDELEKEKVCSVMDALKLSYEARVHASQN  409

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ DVTLV+ENE LRTEL++MK
Sbjct  410  KRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQTDVTLVRENEELRTELIRMK  465

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+++D+Q      G++        V+K TFFSS+SKKLGKLNPFK+GSKDTS+++D  VD
Sbjct  466  MYVSDLQK-NGHGGTTSSSEVGKEVKKSTFFSSVSKKLGKLNPFKNGSKDTSHIEDVGVD  524

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  525  LTKPRRRRFSIS  536



>ref|XP_010414259.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=595

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 163/204 (80%), Gaps = 12/204 (6%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIATRNQLQADVTLVKENEALRT  367
            KRLPV IVLHALYYDQLK+RSG E+ +      + P A+ TR+QLQAD TL KENEALR+
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVNLPEALKTRSQLQADTTLAKENEALRS  511

Query  366  ELLQMKMFIADMQ----NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  199
            EL++MK++++DMQ      G+S  +S    S +   K TFFSS+SKKLGKLNPF+HGSKD
Sbjct  512  ELMKMKLYVSDMQKNKNGAGTSSSNSTSLVSNNKKSKHTFFSSVSKKLGKLNPFRHGSKD  571

Query  198  TSNLDD--GEVDITKPRRRRFSIS  133
            TSNLD+    VDITKPRRRRFSIS
Sbjct  572  TSNLDEDLAGVDITKPRRRRFSIS  595



>ref|NP_001280845.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36603.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 157/193 (81%), Gaps = 2/193 (1%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA+L+ KGARKVDDDLYRAIDIYLK+HP LDEIE+EKVCSVMD LKLSYEARVHASQN
Sbjct  386  NGIASLIPKGARKVDDDLYRAIDIYLKSHPNLDEIEKEKVCSVMDALKLSYEARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG  D     +AI TR+Q+Q DV+L +ENE LRTELL+MK
Sbjct  446  KRLPVQIVLHALYYDQLKLRSGV-DENDVQDAITTRSQVQHDVSLARENEELRTELLKMK  504

Query  348  MFIADMQNkg-ssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  172
            M+I D+   G ++  ++         +K  FFS +SKKLG+LNPFK GSKDTSN+ D +V
Sbjct  505  MYITDLHKTGPAAVATTSSCKGGGGPKKAKFFSYVSKKLGRLNPFKQGSKDTSNIVDEDV  564

Query  171  DITKPRRRRFSIS  133
            DITKPRRRRFSIS
Sbjct  565  DITKPRRRRFSIS  577



>ref|XP_003616056.1| Root phototropism protein [Medicago truncatula]
 gb|AES99014.1| root phototropism-like protein [Medicago truncatula]
Length=579

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 157/192 (82%), Gaps = 5/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ KGARK+DDDLYRA+DIYLK H  LDE+E+EKVCSVMD LKLSYEARVHASQN
Sbjct  393  NGIAILIPKGARKLDDDLYRAVDIYLKVHTNLDELEKEKVCSVMDALKLSYEARVHASQN  452

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLKIRSGA   +   +    RNQLQ DVTLV+ENE LRTEL++MK
Sbjct  453  KRLPVQIVLHALYYDQLKIRSGATAERDAED----RNQLQTDVTLVRENEELRTELIRMK  508

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+++D+Q      G++        V+K TFFSS+SKKLGKLNPFK+GSKDTS+++D  VD
Sbjct  509  MYVSDLQK-NGHGGTTSSSEVGKEVKKSTFFSSVSKKLGKLNPFKNGSKDTSHIEDVGVD  567

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  568  LTKPRRRRFSIS  579



>ref|XP_006842585.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
 gb|ERN04260.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
Length=564

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 155/191 (81%), Gaps = 11/191 (6%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            IANL+ K A+K DDDLYR++DIYLKAHP LDEIEREKVCSVMDPLKLSYEARVHASQNKR
Sbjct  384  IANLIPKAAKKFDDDLYRSVDIYLKAHPNLDEIEREKVCSVMDPLKLSYEARVHASQNKR  443

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMF  343
            LPVQIVLHALYYDQLKIRSG ED K+  +A  TRNQ+QAD++L+KENE+L++EL +MK +
Sbjct  444  LPVQIVLHALYYDQLKIRSGKEDAKNF-DASFTRNQVQADISLIKENESLKSELAKMKSY  502

Query  342  IADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGE-VDI  166
            +  +Q        S          K TFFSSMSKKLG+LNPF+HGSKDT N++DG  VDI
Sbjct  503  VDGLQKGKGIATKSS---------KKTFFSSMSKKLGRLNPFRHGSKDTLNVEDGNAVDI  553

Query  165  TKPRRRRFSIS  133
            TKPR+RRFSIS
Sbjct  554  TKPRKRRFSIS  564



>ref|XP_002881117.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57376.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
Length=593

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 161/202 (80%), Gaps = 10/202 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTE  364
            KRLPV IVLHALYYDQLK+RSG E+ +       P A+ TR+QLQAD TL KENEALR+E
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSE  511

Query  363  LLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  193
            L++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPFK+GSKDTS
Sbjct  512  LMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKNKHTFFSSVSKKLGKLNPFKNGSKDTS  571

Query  192  NLDD--GEVDITKPRRRRFSIS  133
            N+D+    VDITKPRRRRFSIS
Sbjct  572  NIDEDLAGVDITKPRRRRFSIS  593



>ref|XP_010510344.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=596

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 162/205 (79%), Gaps = 13/205 (6%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPK------STPNAIATRNQLQADVTLVKENEALRT  367
            KRLPV IVLHALYYDQLK+RSG E+ +      + P A+ TR+QLQAD TL KENEALR+
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVEEQEERAVVVNLPEALKTRSQLQADTTLAKENEALRS  511

Query  366  ELLQMKMFIADMQ---NkgssqgssvkgssasaVRKP--TFFSSMSKKLGKLNPFKHGSK  202
            EL++MKM+++DMQ   N   +  S+     ++  +K    FFSS+SKKLGKLNPF+HGSK
Sbjct  512  ELMKMKMYVSDMQKNKNGAGASSSNSTSLVSNNNKKSKHNFFSSVSKKLGKLNPFRHGSK  571

Query  201  DTSNLDD--GEVDITKPRRRRFSIS  133
            DTSNLD+    VDITKPRRRRFSIS
Sbjct  572  DTSNLDEDLAGVDITKPRRRRFSIS  596



>ref|NP_001031446.1| Root phototropism protein 2 [Arabidopsis thaliana]
 ref|NP_001077982.1| Root phototropism protein 2 [Arabidopsis thaliana]
 dbj|BAD43060.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08402.1| Root phototropism protein 2 [Arabidopsis thaliana]
 gb|AEC08403.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=545

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 161/202 (80%), Gaps = 10/202 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  344  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  403

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTE  364
            KRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL KENEALR+E
Sbjct  404  KRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSE  463

Query  363  LLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  193
            L++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPFK+GSKDTS
Sbjct  464  LMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPFKNGSKDTS  523

Query  192  NLDD--GEVDITKPRRRRFSIS  133
            ++D+  G VDITKPRRRRFSIS
Sbjct  524  HIDEDLGGVDITKPRRRRFSIS  545



>dbj|BAF02185.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 161/202 (80%), Gaps = 10/202 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTE  364
            KRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL KENEALR+E
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSE  511

Query  363  LLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  193
            L++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPFK+GSKDTS
Sbjct  512  LMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPFKNGSKDTS  571

Query  192  NLDD--GEVDITKPRRRRFSIS  133
            ++D+  G VDITKPRRRRFSIS
Sbjct  572  HIDEDLGGVDITKPRRRRFSIS  593



>dbj|BAF01791.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01873.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01940.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 161/202 (80%), Gaps = 10/202 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTE  364
            KRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL KENEALR+E
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSE  511

Query  363  LLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  193
            L++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPFK+GSKDTS
Sbjct  512  LMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPFKNGSKDTS  571

Query  192  NLDD--GEVDITKPRRRRFSIS  133
            ++D+  G VDITKPRRRRFSIS
Sbjct  572  HIDEDLGGVDITKPRRRRFSIS  593



>ref|NP_850147.1| Root phototropism protein 2 [Arabidopsis thaliana]
 sp|Q682S0.2|RPT2_ARATH RecName: Full=Root phototropism protein 2; AltName: Full=BTB/POZ 
domain-containing protein RPT2 [Arabidopsis thaliana]
 gb|AAK59568.1| unknown protein [Arabidopsis thaliana]
 gb|AAL07245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31821.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94074.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94572.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD95385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01595.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01673.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02233.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08401.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=593

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 161/202 (80%), Gaps = 10/202 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTE  364
            KRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL KENEALR+E
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSE  511

Query  363  LLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  193
            L++MKM+++DMQ   N   +  S+     +S   K TFFSS+SKKLGKLNPFK+GSKDTS
Sbjct  512  LMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPFKNGSKDTS  571

Query  192  NLDD--GEVDITKPRRRRFSIS  133
            ++D+  G VDITKPRRRRFSIS
Sbjct  572  HIDEDLGGVDITKPRRRRFSIS  593



>gb|EPS73802.1| hypothetical protein M569_00954 [Genlisea aurea]
Length=566

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 150/190 (79%), Gaps = 5/190 (3%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A LV + ARKVDDDLYRAIDIYLKAHP LDEIEREKVC+ MDPLKLSYEARVHASQNKR
Sbjct  382  LAKLVPETARKVDDDLYRAIDIYLKAHPDLDEIEREKVCAAMDPLKLSYEARVHASQNKR  441

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMF  343
            LPVQIVLHALYYDQL++RSG       PNA +TR Q QAD  LVKENE LRTELL+MKM+
Sbjct  442  LPVQIVLHALYYDQLQLRSGGGGDYEKPNAASTRFQAQADTDLVKENEKLRTELLKMKMY  501

Query  342  IADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  163
            + ++Q        +   +S+ A +KPTFFSSMSK LGKLNPF+ GSKDT  +DD   D+ 
Sbjct  502  VQEIQE-----SKNQGTTSSKAAKKPTFFSSMSKTLGKLNPFRIGSKDTLQIDDAASDVR  556

Query  162  KPRRRRFSIS  133
            KPRRRRFSIS
Sbjct  557  KPRRRRFSIS  566



>gb|AAF33112.1|AF181683_1 RPT2 [Arabidopsis thaliana]
Length=593

 Score =   262 bits (670),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 161/202 (80%), Gaps = 10/202 (5%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTE  364
            KRLPV IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL KENEALR+E
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSE  511

Query  363  LLQMKMFIADMQ---NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTS  193
            L++MKM+++DMQ   N   +  S+     +S   K TFFSS+S+KLGKLNPFK+GSKDTS
Sbjct  512  LMKMKMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSRKLGKLNPFKNGSKDTS  571

Query  192  NLDD--GEVDITKPRRRRFSIS  133
            ++D+  G VDITKPRRRRFSIS
Sbjct  572  HIDEDLGGVDITKPRRRRFSIS  593



>ref|XP_004490729.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=573

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 156/192 (81%), Gaps = 8/192 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ KGARK+DDDLYRAIDIYLK H  LDE+E+EKVCSVMD LKLSYEARVHASQN
Sbjct  390  NGIAILIPKGARKLDDDLYRAIDIYLKVHTNLDELEKEKVCSVMDALKLSYEARVHASQN  449

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALY+DQLK+RSGA   +   +  A RNQLQ DVTLV+ENE LR+EL++MK
Sbjct  450  KRLPVQIVLHALYFDQLKLRSGAVVER---DVTAERNQLQTDVTLVRENEELRSELMRMK  506

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M++ D++            SS+  V+K TFFSS+SKKLGKLNPFK+G+KDTS ++DG VD
Sbjct  507  MYVTDLKK-----NVDGTTSSSREVKKSTFFSSVSKKLGKLNPFKNGAKDTSTIEDGPVD  561

Query  168  ITKPRRRRFSIS  133
            + KPRRRRFSIS
Sbjct  562  LIKPRRRRFSIS  573



>ref|XP_003600551.1| Root phototropism protein [Medicago truncatula]
Length=513

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 159/192 (83%), Gaps = 6/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  328  NGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVCSVMDPLKLSYEARVHASQN  387

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV+ENE LR+EL +MK
Sbjct  388  KRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLVRENEELRSELTKMK  446

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+G+KDT++L+DG VD
Sbjct  447  MYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKNGAKDTAHLEDGPVD  501

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  502  LTKPRRRRFSIS  513



>gb|AES70802.2| root phototropism-like protein [Medicago truncatula]
Length=526

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 159/192 (83%), Gaps = 6/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  341  NGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVCSVMDPLKLSYEARVHASQN  400

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV+ENE LR+EL +MK
Sbjct  401  KRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLVRENEELRSELTKMK  459

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+G+KDT++L+DG VD
Sbjct  460  MYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKNGAKDTAHLEDGPVD  514

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  515  LTKPRRRRFSIS  526



>gb|KFK22949.1| root phototropism protein 2 [Arabis alpina]
Length=596

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 162/205 (79%), Gaps = 13/205 (6%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQADVTLVKENEALRTEL  361
            KRLPV IVLHALYYDQLK+RSG E+ + T    P A+ATR Q++AD +L KENEALR+EL
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVEEKQGTVVIVPEALATRGQVKADTSLAKENEALRSEL  511

Query  360  LQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFFSSMSKKLGKLNPFKHGSK  202
            ++MKM+++D+Q    S G +   +S++ V        K  FFSS+SKKLGK NPF+HGSK
Sbjct  512  MKMKMYVSDLQKNKQSGGGASSSNSSALVSSSNKKNIKQNFFSSVSKKLGKFNPFRHGSK  571

Query  201  DTSNLDD--GEVDITKPRRRRFSIS  133
            DTS++D+    VDITKPRRRRFSIS
Sbjct  572  DTSHIDEDLAGVDITKPRRRRFSIS  596



>ref|XP_003600550.1| Root phototropism protein [Medicago truncatula]
 gb|AES70801.1| root phototropism-like protein [Medicago truncatula]
Length=568

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 159/192 (83%), Gaps = 6/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  383  NGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVCSVMDPLKLSYEARVHASQN  442

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQLK+RSG++D +    A   RN+L  DV+LV+ENE LR+EL +MK
Sbjct  443  KRLPVQIVLHALYYDQLKLRSGSDDGE-CDGAATERNRLATDVSLVRENEELRSELTKMK  501

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+I DMQ     +  +   +S S+ +K TFFSS+SKKLGKL  FK+G+KDT++L+DG VD
Sbjct  502  MYITDMQQ---QKNVTPGTTSLSSSKKTTFFSSVSKKLGKL--FKNGAKDTAHLEDGPVD  556

Query  168  ITKPRRRRFSIS  133
            +TKPRRRRFSIS
Sbjct  557  LTKPRRRRFSIS  568



>ref|XP_004500391.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=569

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 156/192 (81%), Gaps = 5/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ K ARKVDDDLYRA+DIYLKAHP+LDEIEREKVCSVMD LKLSYEARVHASQ 
Sbjct  383  NGIAILIPKHARKVDDDLYRAVDIYLKAHPKLDEIEREKVCSVMDTLKLSYEARVHASQK  442

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPVQIVLHALYYDQL++RSG++D  +   A   +N+L  DV+LV+ENE LR+EL +MK
Sbjct  443  KRLPVQIVLHALYYDQLRLRSGSDDGDT---AATKKNRLNTDVSLVRENEELRSELAKMK  499

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M+++DMQ    +       +S+ + +K  FFSS+SK LGKLNPFKH +KDT++LDDG VD
Sbjct  500  MYVSDMQQ--KNVSQVHGTTSSHSTKKTKFFSSVSKTLGKLNPFKHEAKDTTHLDDGPVD  557

Query  168  ITKPRRRRFSIS  133
            + KPRRRRFSIS
Sbjct  558  LIKPRRRRFSIS  569



>gb|KHG08105.1| Root phototropism 2 -like protein [Gossypium arboreum]
Length=507

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 5/168 (3%)
 Frame = -2

Query  633  LKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAED  454
            + +HP LDEIEREKVCS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D
Sbjct  344  MASHPNLDEIEREKVCSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGAD  403

Query  453  PKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaV  274
             ++ P+A+ TRNQLQADV+LVKENEALRTELL+MKM+I+DMQ        +   S +   
Sbjct  404  DRNQPDAVTTRNQLQADVSLVKENEALRTELLKMKMYISDMQK----NNQTGTSSKSIGT  459

Query  273  RKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  133
            RKPTFFSSMSK LGKLNPF+HGSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  460  RKPTFFSSMSKTLGKLNPFRHGSKDTSHIDDNLGVDVTKPRRRRFSIS  507



>ref|XP_010044625.1| PREDICTED: root phototropism protein 2-like [Eucalyptus grandis]
 gb|KCW86717.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=570

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 151/192 (79%), Gaps = 6/192 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IA L+ K ARKVDDDLYRAIDIYLKAHP LDE+EREK CSVMDPLKLS+EAR+HASQN
Sbjct  385  NAIATLMPKAARKVDDDLYRAIDIYLKAHPNLDEVEREKACSVMDPLKLSHEARIHASQN  444

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KR P QIVLHALY DQLK+RSG  D +   + +ATR+Q+ ADV+L++ENE LR+EL+ MK
Sbjct  445  KRFPAQIVLHALYNDQLKLRSGM-DNRDVCDPMATRSQVLADVSLIRENETLRSELMMMK  503

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
              I+DMQN      S    SS    +K TFFSSM+K LGKLNPF+ GSKD SN+DD  VD
Sbjct  504  KNISDMQN----PKSQGTTSSKGGAKKTTFFSSMTKTLGKLNPFRQGSKDASNIDD-LVD  558

Query  168  ITKPRRRRFSIS  133
            ITKPRRRRFSIS
Sbjct  559  ITKPRRRRFSIS  570



>emb|CDX84827.1| BnaA03g14030D [Brassica napus]
Length=565

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 152/195 (78%), Gaps = 5/195 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK +DDLYRA+DI+LKAHP L EIEREKVCS+MDPLKLSY+AR+HASQN
Sbjct  373  NAIANLVPKSARKSEDDLYRAVDIFLKAHPSLGEIEREKVCSLMDPLKLSYDARLHASQN  432

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPV IVLH LYYDQLK+RS  ED + TP  I        D +L KENE LR+EL++MK
Sbjct  433  KRLPVNIVLHTLYYDQLKLRSEVEDKEGTP-VIVPEGLGTRDSSLAKENEDLRSELMKMK  491

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLD---DG  178
            M+++D+QN  ++  SS    S     K TFFSS+SKKLGKLNPF+HGSKDTSN+D   DG
Sbjct  492  MYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKLNPFRHGSKDTSNIDEDLDG  551

Query  177  EVDITKPRRRRFSIS  133
             VDITKPRRRRFSIS
Sbjct  552  -VDITKPRRRRFSIS  565



>emb|CDY10743.1| BnaA05g11930D [Brassica napus]
Length=581

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 162/200 (81%), Gaps = 8/200 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSYEAR+HASQN
Sbjct  382  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYEARLHASQN  441

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQADVTLVKENEALRTEL  361
            KRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD +L KENEALR+EL
Sbjct  442  KRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVLPEAVATRGQVKADASLAKENEALRSEL  501

Query  360  LQMKMFIADMQNkgssqgssvkgs--sasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNL  187
            ++MKM+++D+Q  G + G+S   +  S     K TFFSS+SKKLGKLNPF+HGSKDTSN+
Sbjct  502  MKMKMYVSDLQKSGGAAGASSSNAPPSNKKSSKSTFFSSVSKKLGKLNPFRHGSKDTSNI  561

Query  186  DD--GEVDITKPRRRRFSIS  133
            D+    VDITKPRRRRFSIS
Sbjct  562  DEDLAGVDITKPRRRRFSIS  581



>ref|XP_009132742.1| PREDICTED: root phototropism protein 2-like [Brassica rapa]
Length=575

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 152/195 (78%), Gaps = 5/195 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK +DDLYRA+DI+LKAHP L EIEREKVCS+MDPLKLSY+AR+HASQN
Sbjct  383  NAIANLVPKSARKSEDDLYRAVDIFLKAHPSLGEIEREKVCSLMDPLKLSYDARLHASQN  442

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
            KRLPV IVLH LYYDQLK+RS  ED + TP  I        D +L KENE LR+EL++MK
Sbjct  443  KRLPVNIVLHTLYYDQLKLRSEVEDKEGTP-VIVPEGLGTRDSSLAKENEDLRSELMKMK  501

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLD---DG  178
            M+++D+QN  ++  SS    S     K TFFSS+SKKLGKLNPF+HGSKDTSN+D   DG
Sbjct  502  MYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKLNPFRHGSKDTSNIDEDLDG  561

Query  177  EVDITKPRRRRFSIS  133
             VDITKPRRRRFSIS
Sbjct  562  -VDITKPRRRRFSIS  575



>ref|XP_009144295.1| PREDICTED: root phototropism protein 2 [Brassica rapa]
Length=591

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 162/200 (81%), Gaps = 8/200 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSYEAR+HASQN
Sbjct  392  NAIANLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYEARLHASQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQADVTLVKENEALRTEL  361
            KRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD +L KENEALR+EL
Sbjct  452  KRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVLPEAVATRGQVKADASLAKENEALRSEL  511

Query  360  LQMKMFIADMQNkgssqgssvkgs--sasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNL  187
            ++MKM+++D+Q  G + G+S   +  S     K TFFSS+SKKLGKLNPF+HGSKDTSN+
Sbjct  512  MKMKMYVSDLQKSGGAAGASSSNAPPSNKKSSKSTFFSSVSKKLGKLNPFRHGSKDTSNI  571

Query  186  DD--GEVDITKPRRRRFSIS  133
            D+    VDITKPRRRRFSIS
Sbjct  572  DEDLAGVDITKPRRRRFSIS  591



>emb|CDY23992.1| BnaC03g16990D [Brassica napus]
Length=565

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 154/199 (77%), Gaps = 13/199 (7%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK +DDLYRA+DI+LKAHP L EIEREKVCS+MDPLKLS + R+HASQN
Sbjct  373  NAIANLVPKSARKSEDDLYRAVDIFLKAHPSLGEIEREKVCSLMDPLKLSCDPRLHASQN  432

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKST----PNAIATRNQLQADVTLVKENEALRTEL  361
            KRLPV IVLHALYYDQLK+RS  ED + T    P A+ TR     D +L KENE LR+EL
Sbjct  433  KRLPVNIVLHALYYDQLKLRSEVEDKEGTPVIVPEALGTR-----DSSLAKENEDLRSEL  487

Query  360  LQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLD-  184
            ++MKM+++D+QN  ++  SS    S     K TFFSS+SKKLGKLNPF+HGSKDTSN+D 
Sbjct  488  MKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSSVSKKLGKLNPFRHGSKDTSNIDE  547

Query  183  --DGEVDITKPRRRRFSIS  133
              DG VDITKPRRRRFSIS
Sbjct  548  DLDG-VDITKPRRRRFSIS  565



>ref|XP_009402206.1| PREDICTED: root phototropism protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=540

 Score =   244 bits (624),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 151/196 (77%), Gaps = 7/196 (4%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA  + K AR+ DDDLYRA+DIYLKAHP L EIEREKVCSVMDPLKLSYEAR+HASQNK
Sbjct  347  GIAGALPKSARRFDDDLYRAVDIYLKAHPGLAEIEREKVCSVMDPLKLSYEARLHASQNK  406

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR----NQLQADVTLVKENEALRTELL  358
            RLP+QIVLHALYYDQLK+RSG  D ++   A+         L+ADV+L++ENE LR+EL 
Sbjct  407  RLPLQIVLHALYYDQLKLRSGI-DGEAAAGALGVTLGRDEGLKADVSLIRENETLRSELA  465

Query  357  QMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            +MKM+++++Q  G   G           +K +FFSS+S+ LGKLNPFK GSKDTSN+DDG
Sbjct  466  KMKMYVSELQR-GGGGGGGEGSGVKIGSKKTSFFSSVSRTLGKLNPFKQGSKDTSNIDDG  524

Query  177  -EVDITKPRRRRFSIS  133
              VD+TKPRRRRFSIS
Sbjct  525  VGVDVTKPRRRRFSIS  540



>gb|KCW86718.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=577

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 151/199 (76%), Gaps = 13/199 (7%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLK-------AHPQLDEIEREKVCSVMDPLKLSYEA  550
            N IA L+ K ARKVDDDLYRAIDIYLK       AHP LDE+EREK CSVMDPLKLS+EA
Sbjct  385  NAIATLMPKAARKVDDDLYRAIDIYLKWAEPNLQAHPNLDEVEREKACSVMDPLKLSHEA  444

Query  549  RVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALR  370
            R+HASQNKR P QIVLHALY DQLK+RSG  D +   + +ATR+Q+ ADV+L++ENE LR
Sbjct  445  RIHASQNKRFPAQIVLHALYNDQLKLRSGM-DNRDVCDPMATRSQVLADVSLIRENETLR  503

Query  369  TELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSN  190
            +EL+ MK  I+DMQN      S    SS    +K TFFSSM+K LGKLNPF+ GSKD SN
Sbjct  504  SELMMMKKNISDMQN----PKSQGTTSSKGGAKKTTFFSSMTKTLGKLNPFRQGSKDASN  559

Query  189  LDDGEVDITKPRRRRFSIS  133
            +DD  VDITKPRRRRFSIS
Sbjct  560  IDD-LVDITKPRRRRFSIS  577



>ref|XP_009402205.1| PREDICTED: root phototropism protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 151/196 (77%), Gaps = 7/196 (4%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA  + K AR+ DDDLYRA+DIYLKAHP L EIEREKVCSVMDPLKLSYEAR+HASQNK
Sbjct  388  GIAGALPKSARRFDDDLYRAVDIYLKAHPGLAEIEREKVCSVMDPLKLSYEARLHASQNK  447

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR----NQLQADVTLVKENEALRTELL  358
            RLP+QIVLHALYYDQLK+RSG  D ++   A+         L+ADV+L++ENE LR+EL 
Sbjct  448  RLPLQIVLHALYYDQLKLRSGI-DGEAAAGALGVTLGRDEGLKADVSLIRENETLRSELA  506

Query  357  QMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            +MKM+++++Q  G   G           +K +FFSS+S+ LGKLNPFK GSKDTSN+DDG
Sbjct  507  KMKMYVSELQR-GGGGGGGEGSGVKIGSKKTSFFSSVSRTLGKLNPFKQGSKDTSNIDDG  565

Query  177  -EVDITKPRRRRFSIS  133
              VD+TKPRRRRFSIS
Sbjct  566  VGVDVTKPRRRRFSIS  581



>emb|CDY02075.1| BnaC04g14260D [Brassica napus]
Length=580

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 161/199 (81%), Gaps = 7/199 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            N IANLV K ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSYEAR+HASQN
Sbjct  382  NAIANLVQKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYEARLHASQN  441

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS----TPNAIATRNQLQADVTLVKENEALRTEL  361
            KRLPV IVLHALYYDQLK+RSG ED +      P A+ATR Q++AD +L KENEALR+EL
Sbjct  442  KRLPVNIVLHALYYDQLKLRSGVEDKEGAVVVVPEAVATRGQVKADASLAKENEALRSEL  501

Query  360  LQMKMFIADMQNkgssqgssvkg-ssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLD  184
            ++MKM+++D+Q  G++  SS     S     K TFFSS+SKKLGKLNPF+HGSKDTSN+D
Sbjct  502  MKMKMYVSDLQKSGAAGASSSNAPPSNKKSSKSTFFSSVSKKLGKLNPFRHGSKDTSNID  561

Query  183  D--GEVDITKPRRRRFSIS  133
            +    VDITKPRRRRFSIS
Sbjct  562  EDLAGVDITKPRRRRFSIS  580



>ref|XP_009384760.1| PREDICTED: root phototropism protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
             GIA  + K AR+ DDDLYRA+DIYLKAHP LDEIEREK  SV+DPLKLSYEAR+HASQN
Sbjct  345  TGIAGALPKSARRFDDDLYRAVDIYLKAHPGLDEIEREKASSVIDPLKLSYEARLHASQN  404

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS--TPNA-IATRNQLQADVTLVKENEALRTELL  358
            KRLP+QIVLHALYYDQLK RSG ED  +   P A +   + L ADV+L++ENEALR+EL 
Sbjct  405  KRLPLQIVLHALYYDQLKQRSGMEDEAAAGAPGATLGPDHGLNADVSLIRENEALRSELA  464

Query  357  QMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            +MKM++++M       G        +  +K  FFSS+S+ LGKLNPFK GSKDTSN+DDG
Sbjct  465  RMKMYVSEMHR--GGGGGGQGSGVKARSKKAMFFSSVSRTLGKLNPFKQGSKDTSNMDDG  522

Query  177  -EVDITKPRRRRFSIS  133
              VD+TKPRRRRFSIS
Sbjct  523  VVVDVTKPRRRRFSIS  538



>ref|XP_009384759.1| PREDICTED: root phototropism protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=582

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
             GIA  + K AR+ DDDLYRA+DIYLKAHP LDEIEREK  SV+DPLKLSYEAR+HASQN
Sbjct  389  TGIAGALPKSARRFDDDLYRAVDIYLKAHPGLDEIEREKASSVIDPLKLSYEARLHASQN  448

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKS--TPNA-IATRNQLQADVTLVKENEALRTELL  358
            KRLP+QIVLHALYYDQLK RSG ED  +   P A +   + L ADV+L++ENEALR+EL 
Sbjct  449  KRLPLQIVLHALYYDQLKQRSGMEDEAAAGAPGATLGPDHGLNADVSLIRENEALRSELA  508

Query  357  QMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG  178
            +MKM++++M       G        +  +K  FFSS+S+ LGKLNPFK GSKDTSN+DDG
Sbjct  509  RMKMYVSEMHR--GGGGGGQGSGVKARSKKAMFFSSVSRTLGKLNPFKQGSKDTSNMDDG  566

Query  177  -EVDITKPRRRRFSIS  133
              VD+TKPRRRRFSIS
Sbjct  567  VVVDVTKPRRRRFSIS  582



>ref|XP_011080638.1| PREDICTED: root phototropism protein 2 [Sesamum indicum]
Length=570

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 142/192 (74%), Gaps = 7/192 (4%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIAN V K ARK+DD LYRA+DIYLKAHP LDEI+R KVCSVMDPL+LS++ARVHASQN
Sbjct  386  NGIANSVPKAARKLDDHLYRAVDIYLKAHPYLDEIKRLKVCSVMDPLRLSHQARVHASQN  445

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK  349
             RLPVQIVLHAL+YDQLK+  G  D     +A   RN LQ DV+LVKENEALRTELL+M+
Sbjct  446  NRLPVQIVLHALHYDQLKLTRGIYDDHLLLDAPRARNYLQIDVSLVKENEALRTELLRMR  505

Query  348  MFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVD  169
            M + DMQ               S V+K TFFSS+SK LG LNPFKH  KDTSN+DD  VD
Sbjct  506  MCMRDMQR-------IQGTPYRSRVKKHTFFSSLSKTLGILNPFKHARKDTSNVDDEMVD  558

Query  168  ITKPRRRRFSIS  133
             T  RR RFSIS
Sbjct  559  STTLRRGRFSIS  570



>gb|KHN18647.1| Root phototropism protein 2 [Glycine soja]
Length=312

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 144/193 (75%), Gaps = 29/193 (15%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            IA L+ K ARK+DDDLYRA+DIYLKAHP+LDEIEREKVCSVMDPLKLSYEARVHASQNKR
Sbjct  146  IATLIPKSARKIDDDLYRAVDIYLKAHPKLDEIEREKVCSVMDPLKLSYEARVHASQNKR  205

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQADVTLVK--ENEALRTELLQM  352
            LPVQIVLHALYYDQL++RSGAE+ +     +AT +NQLQ DVTL K   N+A        
Sbjct  206  LPVQIVLHALYYDQLRLRSGAEERE-----VATEKNQLQMDVTLNKNTNNDA--------  252

Query  351  KMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  172
                                +S++  +K TFFSS+SK LGKLNPF++GSKDT++L+D  V
Sbjct  253  -------------NPQGHGTTSSATPKKATFFSSVSKTLGKLNPFRNGSKDTTHLEDASV  299

Query  171  DITKPRRRRFSIS  133
            D+TKPRRRRFS+S
Sbjct  300  DLTKPRRRRFSMS  312



>ref|XP_010922790.1| PREDICTED: root phototropism protein 2 [Elaeis guineensis]
Length=577

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 148/194 (76%), Gaps = 10/194 (5%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            IA  + K AR+ DDDLYRA+DIYLKAHP L EIEREK+CSVMDPLKL+Y+AR+HASQN R
Sbjct  390  IAGALPKSARRFDDDLYRAVDIYLKAHPGLHEIEREKLCSVMDPLKLTYDARLHASQNNR  449

Query  522  LPVQIVLHALYYDQLKIRSGA--EDPKSTPNA-IATRNQLQADVTLVKENEALRTELLQM  352
            LP+QIVL ALYYDQLK+RSGA  E+  + PN+  A R    AD +L++ENEALR+EL +M
Sbjct  450  LPLQIVLQALYYDQLKLRSGAEPENAVTPPNSAAAARAGAMADASLMRENEALRSELTRM  509

Query  351  KMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-E  175
            K+ ++++Q       S       +  ++PTFFSS SK L KLNPF+HGSKDT+++DDG  
Sbjct  510  KLCLSELQR------SQGTSGLKAGPKRPTFFSSFSKTLEKLNPFRHGSKDTASIDDGVG  563

Query  174  VDITKPRRRRFSIS  133
            VD+TKPRRRRFSI 
Sbjct  564  VDLTKPRRRRFSIG  577



>gb|EMS47631.1| Root phototropism protein 2 [Triticum urartu]
Length=386

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 137/202 (68%), Gaps = 11/202 (5%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLKAHP+LDEIEREKVCSVMD LKLSY AR+HASQNK
Sbjct  185  GVAGAVPKDARATHDCLYRAVDIYLKAHPELDEIEREKVCSVMDTLKLSYTARIHASQNK  244

Query  525  RLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATRNQLQADVTLVKENEALRTEL  361
            RLP+Q VL ALYYDQLK+RS       ED  +   A + R Q +AD  L +ENEALR+EL
Sbjct  245  RLPLQAVLSALYYDQLKLRSAGVGHDDEDSDARSEAGSARMQAKADAALARENEALRSEL  304

Query  360  LQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG---SKDTSN  190
             +M+  ++    +    GS    ++    +K +FF SMS+ L +LNPF+ G   SKDTS+
Sbjct  305  ARMRAHLSSGVQQSKGSGSRTAATATVPGKKASFFGSMSRTLSRLNPFRAGGGWSKDTSS  364

Query  189  LDD---GEVDITKPRRRRFSIS  133
            + D   G +++ KP+RRR SIS
Sbjct  365  IRDSRGGAMNVVKPKRRRSSIS  386



>gb|KHN24717.1| Root phototropism protein 2 [Glycine soja]
Length=152

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 125/157 (80%), Gaps = 13/157 (8%)
 Frame = -2

Query  579  MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQAD  403
            MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+ +     +AT +NQLQ D
Sbjct  1    MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNQLQMD  55

Query  402  VTLVKENEALRTELLQMKMFIADMQNkgssqg-------ssvkgssasaVRKPTFFSSMS  244
            VTLV+ENE LRTEL++MKM+I+D+Q   ++          +   ++    +K TFFSS+S
Sbjct  56   VTLVRENEELRTELMKMKMYISDLQQNKNTNNGANPQGHGTTSSAANPNPKKATFFSSVS  115

Query  243  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            K LGKLNPF++GSKDT++L+DG VD+TKPRRRRFS+S
Sbjct  116  KTLGKLNPFRNGSKDTTHLEDGNVDLTKPRRRRFSVS  152



>ref|XP_004978520.1| PREDICTED: root phototropism protein 2-like [Setaria italica]
Length=604

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 140/199 (70%), Gaps = 13/199 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLK HP+LDEIEREKVCSVMDPLKLSY+AR+HASQNK
Sbjct  411  GVAGAVPKEARASHDCLYRAVDIYLKTHPELDEIEREKVCSVMDPLKLSYQARLHASQNK  470

Query  525  RLPVQIVLHALYYDQLKIRS--GAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQM  352
            RLP+Q VL ALYYDQLK+RS  GA D  +   A   R Q +AD +L +ENEALR+EL +M
Sbjct  471  RLPLQAVLSALYYDQLKLRSAAGAGDDDTQSAAGKARAQARADASLARENEALRSELARM  530

Query  351  KMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG-SKDTSNLDDG-  178
            + +++ MQ            S + A +K +F  S+S+ L +LNPFK G +KDT+++ DG 
Sbjct  531  RAYLSGMQP-----SRGSGSSPSPAAKKTSFLGSVSRTLSRLNPFKGGWAKDTASVADGR  585

Query  177  ----EVDITKPRRRRFSIS  133
                E+ + +P+RRRFSIS
Sbjct  586  DGRKEMHVVRPKRRRFSIS  604



>ref|XP_008803009.1| PREDICTED: root phototropism protein 2 [Phoenix dactylifera]
Length=583

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 142/201 (71%), Gaps = 19/201 (9%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA ++ K AR+ DDDLYRA+DIYLKAH  L EIE+EK CSVMDPLKLS+EAR+HA++N 
Sbjct  392  GIAGVLPKSARRFDDDLYRAVDIYLKAHTGLHEIEKEKACSVMDPLKLSHEARLHAARNN  451

Query  525  RLPVQIVLHALYYDQLKIRSGA---EDPKSTPNAIATRNQLQADVTLVKENEALRTELLQ  355
            RLP+QI+LHALY+DQLK+RSGA   +    + +A A R    AD +L++ENEALR+EL +
Sbjct  452  RLPLQIILHALYFDQLKLRSGAAAKDAVAPSNSAAAARAGAMADASLMRENEALRSELTR  511

Query  354  MKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGE  175
            M++ ++++Q                  ++PTF SS SK LGKLNPF+HGS D S++D+G 
Sbjct  512  MQLCLSELQG---------GSGLKGRPKRPTFLSSFSKTLGKLNPFRHGSMDASSIDNGG  562

Query  174  VDIT-------KPRRRRFSIS  133
            V +        KPRRRRFSIS
Sbjct  563  VGVLGEALTKPKPRRRRFSIS  583



>ref|XP_004977394.1| PREDICTED: root phototropism protein 2-like [Setaria italica]
Length=560

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 139/199 (70%), Gaps = 13/199 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLK HP+LDEIEREKVCSVMDPLKLSY+AR+HASQNK
Sbjct  367  GVAGAVPKEARASHDCLYRAVDIYLKTHPELDEIEREKVCSVMDPLKLSYQARLHASQNK  426

Query  525  RLPVQIVLHALYYDQLKIRS--GAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQM  352
            RLP+Q VL ALYYDQLK+RS  GA D  +   A   R Q +AD +L +ENEALR+EL +M
Sbjct  427  RLPLQAVLSALYYDQLKLRSAAGAGDDDTQSAAGKARAQARADASLARENEALRSELARM  486

Query  351  KMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG-SKDTSNLDDG-  178
            + +++ +Q            S + A +K +F  S+S+ L +LNPFK G +KDT+++ DG 
Sbjct  487  RAYLSGVQP-----SKGSGSSPSPAAKKTSFLGSVSRTLSRLNPFKGGWAKDTASVADGR  541

Query  177  ----EVDITKPRRRRFSIS  133
                ++ + +P+RRR SIS
Sbjct  542  DGRKDMHVVRPKRRRSSIS  560



>ref|XP_008669932.1| PREDICTED: root phototropism protein 2-like [Zea mays]
 tpg|DAA39312.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=577

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 139/208 (67%), Gaps = 17/208 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V + AR   D LYRA+DIYLK HP LDEIEREKVCSVMDPL+LSY+AR+HASQNK
Sbjct  370  GVAGAVPRDARPSHDCLYRAVDIYLKTHPGLDEIEREKVCSVMDPLRLSYQARMHASQNK  429

Query  525  RLPVQIVLHALYYDQLKIRS-----GAEDPKSTPNAIA-TRNQLQADVTLVKENEALRTE  364
            RLP+Q VL  LYYDQLKIRS     G E+   T +A    R Q +ADV+L +ENEALR E
Sbjct  430  RLPLQAVLSVLYYDQLKIRSADGSGGTEEGWETQSAAGKARAQARADVSLARENEALRLE  489

Query  363  LLQMKMFIADMQNkgssqgssvkgs------sasaVRKPTFFSSMSKKLGKLNPFKHG-S  205
            L +M+ +++ MQ      GS    S      + +  +K +F  S+S+ L +LNPFK G +
Sbjct  490  LARMRAYVSGMQQSSKGSGSRPSSSSLVPGPATATGKKASFLGSVSRTLSRLNPFKGGWA  549

Query  204  KDTSNLDDG----EVDITKPRRRRFSIS  133
            KDT+++ DG     + + KP+RRRFSI 
Sbjct  550  KDTTSIADGRDRTSMHVVKPKRRRFSIG  577



>dbj|BAJ91259.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 138/202 (68%), Gaps = 15/202 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLKAHP+LDEIEREKVCSVMD LKLSY AR+HASQNK
Sbjct  371  GVAGAVPKDARDTHDCLYRAVDIYLKAHPELDEIEREKVCSVMDTLKLSYTARLHASQNK  430

Query  525  RLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATRNQLQADVTLVKENEALRTEL  361
            RLP+Q VL ALYYDQLK+RS A     ED  +   A + R Q +AD  L +EN+ALR+EL
Sbjct  431  RLPLQAVLSALYYDQLKLRSAAVSHDDEDNDARSEAGSARMQAKADAALARENQALRSEL  490

Query  360  LQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG---SKDTSN  190
             +M+  +    + G  Q       +A+  +K +FF SMS+ L +LNPF+ G   SKDTS+
Sbjct  491  ARMRAHM----SSGVQQSKGSGSRTAATGKKASFFGSMSRTLSRLNPFRAGGGWSKDTSS  546

Query  189  LDD---GEVDITKPRRRRFSIS  133
            + D   G +++ KP+RRR SIS
Sbjct  547  IRDSRGGAMNVVKPKRRRSSIS  568



>dbj|BAJ92463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 138/202 (68%), Gaps = 15/202 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLKAHP+LDEIEREKVCSVMD LKLSY AR+HASQNK
Sbjct  371  GVAGAVPKDARDTHDCLYRAVDIYLKAHPELDEIEREKVCSVMDTLKLSYTARLHASQNK  430

Query  525  RLPVQIVLHALYYDQLKIRSGA-----EDPKSTPNAIATRNQLQADVTLVKENEALRTEL  361
            RLP+Q VL ALYYDQLK+RS A     ED  +   A + R Q +AD  L +EN+ALR+EL
Sbjct  431  RLPLQAVLSALYYDQLKLRSAAVSHDDEDNDARSEAGSARMQAKADAALARENQALRSEL  490

Query  360  LQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG---SKDTSN  190
             +M+  +    + G  Q       +A+  +K +FF SMS+ L +LNPF+ G   S+DTS+
Sbjct  491  ARMRAHM----SSGVQQSKGSGSRTAATGKKASFFGSMSRTLSRLNPFRAGGGWSRDTSS  546

Query  189  LDD---GEVDITKPRRRRFSIS  133
            + D   G +++ KP+RRR SIS
Sbjct  547  IGDSRGGAMNVVKPKRRRSSIS  568



>ref|XP_002450159.1| hypothetical protein SORBIDRAFT_05g001300 [Sorghum bicolor]
 gb|EES09147.1| hypothetical protein SORBIDRAFT_05g001300 [Sorghum bicolor]
Length=587

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 141/212 (67%), Gaps = 23/212 (11%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+D+YLK HP LDEIEREKVCSVMDPL+LSY+AR+HASQNK
Sbjct  378  GVAGAVPKDARASHDCLYRAVDMYLKTHPGLDEIEREKVCSVMDPLRLSYQARLHASQNK  437

Query  525  RLPVQIVLHALYYDQLKIRSGAE------------DPKSTPNAIATRNQLQADVTLVKEN  382
            RLP+Q VL ALYYDQLK+RS               +P+S   A   R Q +AD +L +EN
Sbjct  438  RLPLQAVLSALYYDQLKLRSADGGGGDGAEGGAGWEPQSA--AGKARAQARADASLAREN  495

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgs----sasaVRKPTFFSSMSKKLGKLNPFK  214
            EALR+EL +M+ +++ MQ      GS    +    +++A +K +F  S+S+ L +LNPFK
Sbjct  496  EALRSELARMRAYVSGMQQHSKGSGSRSSSASLVPASAAGKKASFLGSVSRTLSRLNPFK  555

Query  213  HG-SKDTSNLDDGE----VDITKPRRRRFSIS  133
             G +KDT+++ DG     + + KP+RRRFSI 
Sbjct  556  GGWAKDTASIADGRDRSAMHVVKPKRRRFSIG  587



>ref|XP_006663162.1| PREDICTED: root phototropism protein 2-like [Oryza brachyantha]
Length=506

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 138/207 (67%), Gaps = 16/207 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLKAHP LDEIEREKVCSVMDPLKLSY+ R+HASQNK
Sbjct  300  GLAGAVPKEARATHDCLYRAVDIYLKAHPALDEIEREKVCSVMDPLKLSYQGRLHASQNK  359

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI----------ATRNQLQADVTLVKENEA  376
            RLP+Q VL ALYYDQLK+RSG         +           + R Q +A+ +L +ENE 
Sbjct  360  RLPLQAVLSALYYDQLKLRSGNGGGVGGDESGGWDAYGGMMRSARMQAKAEASLARENEE  419

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT----FFSSMSKKLGKLNPFKHG  208
            LR+EL +M+ +++ M  + S  G S   ++AS+ +K T       S+S+ L +LNPFK G
Sbjct  420  LRSELARMRAYMSGMGVQQSKGGGSSSRTTASSGKKGTTSLWLLGSVSRTLSRLNPFKGG  479

Query  207  --SKDTSNLDDGEVDITKPRRRRFSIS  133
              +KDTS++ D ++   KP+RRRFS+S
Sbjct  480  IWAKDTSSIGDKKIHSVKPKRRRFSVS  506



>ref|XP_003577852.1| PREDICTED: root phototropism protein 2 [Brachypodium distachyon]
Length=606

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 125/190 (66%), Gaps = 17/190 (9%)
 Frame = -2

Query  663  DDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYD  484
            D +YRA+D+YLKAHP LDEIEREKVCSVMDPLKLS  AR+HASQNKRLP+Q VL ALYYD
Sbjct  421  DCVYRAVDVYLKAHPGLDEIEREKVCSVMDPLKLSPAARLHASQNKRLPLQAVLSALYYD  480

Query  483  QLKIRSGA----EDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgs  316
            QLK+RSG     ED +S   A + R Q +AD  L +ENEALR+EL +M+  ++   +   
Sbjct  481  QLKLRSGQLTGDEDDRS--EAGSARMQAKADAALARENEALRSELGRMRAHMSSSSSGSG  538

Query  315  s-----qgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG----SKDTSNLDDGEVDIT  163
                     S   ++     K  FF SMS+ L +LNPF+ G    SKDTSN+ D    I 
Sbjct  539  RGQRSKGSGSRTPAAMKGKMKVGFFGSMSRTLSRLNPFRAGGGRWSKDTSNIADAA--IV  596

Query  162  KPRRRRFSIS  133
            KP+RRRFSI 
Sbjct  597  KPKRRRFSIG  606



>ref|XP_002463481.1| hypothetical protein SORBIDRAFT_01g000540 [Sorghum bicolor]
 gb|EER90479.1| hypothetical protein SORBIDRAFT_01g000540 [Sorghum bicolor]
Length=264

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 127/189 (67%), Gaps = 18/189 (10%)
 Frame = -2

Query  648  AIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR  469
            A+DIYLK HP LDEIEREKVCSVMDPL+LSY+AR+HA QNKRLP+Q +L ALYYDQLK+R
Sbjct  75   AVDIYLKTHPGLDEIEREKVCSVMDPLRLSYQARLHAPQNKRLPLQALLDALYYDQLKLR  134

Query  468  SGAEDP-------KSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkgssq  310
            S            +S   A   R Q +AD +L +ENEALR+EL +M+ +++ MQ   +  
Sbjct  135  SADGGDGAEGGGWESQSAAGKARAQARADASLARENEALRSELARMRAYVSGMQQHSNGS  194

Query  309  gssvkgs------sasaVRKPTFFSSMSKKLGKLNPFKHG-SKDTSNLDDGE----VDIT  163
            GS    +      +++A +K +F  S+S+ L +LNPFK G +KD +++ DG     + + 
Sbjct  195  GSRSSLASASLVPASAAGKKASFLGSVSQTLSQLNPFKGGWAKDMASIADGRDRSAMHVV  254

Query  162  KPRRRRFSI  136
            KP+RRRFSI
Sbjct  255  KPKRRRFSI  263



>gb|EEC68739.1| hypothetical protein OsI_37246 [Oryza sativa Indica Group]
Length=570

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 127/206 (62%), Gaps = 26/206 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPLKLSY+ R+HASQN 
Sbjct  376  GLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPLKLSYQGRLHASQNN  435

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQADVTLVKENEA  376
            RLP+Q VL ALYYDQLK+RSG E              +  A + R Q + + +L +ENEA
Sbjct  436  RLPLQAVLSALYYDQLKLRSGDEGGGGWDAYGNGVMRSSAAGSARKQAKEEASLARENEA  495

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG--SK  202
            LR+EL +M+ +++ MQ +     SS                S  + L +LNPFK G   K
Sbjct  496  LRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRTLSRLNPFKAGIWGK  544

Query  201  DTSNLDDGEVDI---TKPRRRRFSIS  133
            DTS + DG+ D     K +RRRFSIS
Sbjct  545  DTSGIVDGKTDAMNSVKSKRRRFSIS  570



>gb|ABG22339.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
Length=539

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 127/206 (62%), Gaps = 26/206 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPLKLSY+ R+HASQN 
Sbjct  345  GLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPLKLSYQGRLHASQNN  404

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQADVTLVKENEA  376
            RLP+Q VL ALYYD+LK+RSG E              +  A + R Q + + +L +ENEA
Sbjct  405  RLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARKQAKEEASLARENEA  464

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG--SK  202
            LR+EL +M+ +++ MQ +     SS                S  + L +LNPFK G   K
Sbjct  465  LRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRTLSRLNPFKAGIWGK  513

Query  201  DTSNLDDGEVDI---TKPRRRRFSIS  133
            DTS + DG+ D     K +RRRFSIS
Sbjct  514  DTSGIVDGKTDAMNSVKSKRRRFSIS  539



>gb|ABA95649.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
 gb|EEE52651.1| hypothetical protein OsJ_35014 [Oryza sativa Japonica Group]
Length=570

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 127/206 (62%), Gaps = 26/206 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPLKLSY+ R+HASQN 
Sbjct  376  GLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPLKLSYQGRLHASQNN  435

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQADVTLVKENEA  376
            RLP+Q VL ALYYD+LK+RSG E              +  A + R Q + + +L +ENEA
Sbjct  436  RLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARKQAKEEASLARENEA  495

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG--SK  202
            LR+EL +M+ +++ MQ +     SS                S  + L +LNPFK G   K
Sbjct  496  LRSELARMRAYVSGMQQQSKGSSSSRGKK-----------GSWLRTLSRLNPFKAGIWGK  544

Query  201  DTSNLDDGEVDI---TKPRRRRFSIS  133
            DTS + DG+ D     K +RRRFSIS
Sbjct  545  DTSGIVDGKTDAMNSVKSKRRRFSIS  570



>ref|NP_001065596.1| Os11g0118300 [Oryza sativa Japonica Group]
 gb|ABA91174.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27441.1| Os11g0118300 [Oryza sativa Japonica Group]
 dbj|BAG89308.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51536.1| hypothetical protein OsJ_32738 [Oryza sativa Japonica Group]
Length=571

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 127/206 (62%), Gaps = 26/206 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPLKLSY+ R+HASQN 
Sbjct  377  GLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPLKLSYQGRLHASQNN  436

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQADVTLVKENEA  376
            RLP+Q VL ALYYD+LK+RSG E              +  A + R Q + + +L +ENEA
Sbjct  437  RLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARKQAKEEASLARENEA  496

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG--SK  202
            LR+EL +M+ +++ MQ +     SS                S  + L +LNPFK G   K
Sbjct  497  LRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRTLSRLNPFKAGIWGK  545

Query  201  DTSNLDDGEVDI---TKPRRRRFSIS  133
            DTS + DG+ D     K +RRRFSIS
Sbjct  546  DTSGIVDGKTDAMNSVKSKRRRFSIS  571



>ref|NP_001066000.1| Os12g0117400 [Oryza sativa Japonica Group]
 dbj|BAF29019.1| Os12g0117400, partial [Oryza sativa Japonica Group]
Length=591

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 127/206 (62%), Gaps = 26/206 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPLKLSY+ R+HASQN 
Sbjct  397  GLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPLKLSYQGRLHASQNN  456

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQADVTLVKENEA  376
            RLP+Q VL ALYYD+LK+RSG E              +  A + R Q + + +L +ENEA
Sbjct  457  RLPLQAVLSALYYDRLKLRSGDEGGGGWDAYGNGVMRSSAAGSARKQAKEEASLARENEA  516

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG--SK  202
            LR+EL +M+ +++ MQ +     SS                S  + L +LNPFK G   K
Sbjct  517  LRSELARMRAYVSGMQQQSKGSSSSR-----------GKKGSWLRTLSRLNPFKAGIWGK  565

Query  201  DTSNLDDGEVDI---TKPRRRRFSIS  133
            DTS + DG+ D     K +RRRFSIS
Sbjct  566  DTSGIVDGKTDAMNSVKSKRRRFSIS  591



>gb|EEC67555.1| hypothetical protein OsI_34888 [Oryza sativa Indica Group]
Length=571

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 126/206 (61%), Gaps = 26/206 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLKAHP L+E+EREKVCSVMDPLKLSY+ R+HASQN 
Sbjct  377  GLAGAVPKEARATHDCLYRAVDIYLKAHPALEEMEREKVCSVMDPLKLSYQGRLHASQNN  436

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKS----------TPNAIATRNQLQADVTLVKENEA  376
            RLP+Q VL ALYYDQLK+RSG E              +  A +   Q + + +L +ENEA
Sbjct  437  RLPLQAVLSALYYDQLKLRSGDEGGSGWDAYGNGVMRSSAAGSAWKQAKEEASLARENEA  496

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHG--SK  202
            LR+EL +M+ +++ MQ +     SS                S  + L +LNPFK G   K
Sbjct  497  LRSELARMRAYVSGMQQQSKGSSSSRGKK-----------GSWLRTLSRLNPFKAGIWGK  545

Query  201  DTSNLDDGEVDI---TKPRRRRFSIS  133
            DTS + DG+ D     K +RRRFSIS
Sbjct  546  DTSGIVDGKTDAMNSVKAKRRRFSIS  571



>ref|XP_009374446.1| PREDICTED: putative disease resistance protein RGA3 [Pyrus x 
bretschneideri]
Length=1090

 Score =   174 bits (442),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = -2

Query  627   AHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK  448
             AHP LDEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQ K+RSG  D  
Sbjct  945   AHPNLDEIEREKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQPKLRSGV-DEN  1003

Query  447   STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNk-gssqgssvkgssasaVR  271
                +A+ TR+Q+Q DV+L +ENE LR ELL+MKM+I D+Q    +   ++  G      +
Sbjct  1004  DVQDAVTTRSQVQHDVSLARENEELRMELLKMKMYITDLQKTGSAGIATTSSGKGGGGPK  1063

Query  270   KPTFFSSMSKKLGKLNPFKHG  208
             K TFFSS+SKKLGKLNPFK G
Sbjct  1064  KATFFSSVSKKLGKLNPFKQG  1084



>gb|AFW55920.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=621

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 127/207 (61%), Gaps = 17/207 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLK HP+LDEI+REKVCSVMDPLKLSY+AR HASQNK
Sbjct  416  GVAGAVPKDARPSHDCLYRAVDIYLKTHPELDEIQREKVCSVMDPLKLSYQARTHASQNK  475

Query  525  RLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATRNQLQADVTLVKENEALRTEL  361
            RLP+Q  L ALYYD+LK+RS A      D +S+    A      AD  L +ENEALR+EL
Sbjct  476  RLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACAQARAADAALARENEALRSEL  535

Query  360  LQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK----DTS  193
             +M+ +++ M+       S+   S +   +K +F  S+S+ + +LNPF+ G       TS
Sbjct  536  ARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSRTMSRLNPFRSGGWMAKVTTS  594

Query  192  NLDDGEVD-------ITKPRRRRFSIS  133
            N   G          +  P+RRR SIS
Sbjct  595  NAAGGGRQSKTMMQHVVTPKRRRASIS  621



>ref|XP_008661889.1| PREDICTED: LOC100281201 isoform X1 [Zea mays]
Length=636

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 127/207 (61%), Gaps = 17/207 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLK HP+LDEI+REKVCSVMDPLKLSY+AR HASQNK
Sbjct  431  GVAGAVPKDARPSHDCLYRAVDIYLKTHPELDEIQREKVCSVMDPLKLSYQARTHASQNK  490

Query  525  RLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATRNQLQADVTLVKENEALRTEL  361
            RLP+Q  L ALYYD+LK+RS A      D +S+    A      AD  L +ENEALR+EL
Sbjct  491  RLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACAQARAADAALARENEALRSEL  550

Query  360  LQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK----DTS  193
             +M+ +++ M+       S+   S +   +K +F  S+S+ + +LNPF+ G       TS
Sbjct  551  ARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSRTMSRLNPFRSGGWMAKVTTS  609

Query  192  NLDDGEVD-------ITKPRRRRFSIS  133
            N   G          +  P+RRR SIS
Sbjct  610  NAAGGGRQSKTMMQHVVTPKRRRASIS  636



>ref|NP_001147592.1| LOC100281201 [Zea mays]
 gb|ACG28024.1| RPT2-like protein [Zea mays]
Length=613

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 127/207 (61%), Gaps = 17/207 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLK HP+LDEI+REKVCSVMDPLKLSY+AR HASQNK
Sbjct  408  GVAGAVPKDARPSHDYLYRAVDIYLKTHPELDEIQREKVCSVMDPLKLSYQARTHASQNK  467

Query  525  RLPVQIVLHALYYDQLKIRSGAE-----DPKSTPNAIATRNQLQADVTLVKENEALRTEL  361
            RLP+Q  L ALYYD+LK+RS A      D +S+    A      AD  L +ENEALR+EL
Sbjct  468  RLPLQAALSALYYDELKLRSAATADVVLDTQSSAAGRACAQARAADAALARENEALRSEL  527

Query  360  LQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSK----DTS  193
             +M+ +++ M+       S+   S +   +K +F  S+S+ + +LNPF+ G       TS
Sbjct  528  ARMRAYLSGMER-SKGGRSTPPSSPSRRAKKASFLGSVSRTMSRLNPFRSGGWMAKVTTS  586

Query  192  NLDDGEVD-------ITKPRRRRFSIS  133
            N   G          +  P+RRR SIS
Sbjct  587  NAAGGGRQSKTMMQHVVTPKRRRASIS  613



>ref|XP_002441790.1| hypothetical protein SORBIDRAFT_08g002330 [Sorghum bicolor]
 gb|AAO16688.1| RPT2-like protein [Sorghum bicolor]
 gb|EES15628.1| hypothetical protein SORBIDRAFT_08g002330 [Sorghum bicolor]
Length=665

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 100/252 (40%), Positives = 129/252 (51%), Gaps = 61/252 (24%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  V K AR   D LYRA+DIYLK HP LDEI+REKVCSVMDPLKLSY+AR+HASQNK
Sbjct  414  GVAGAVPKDARPSHDCLYRAVDIYLKTHPALDEIQREKVCSVMDPLKLSYQARLHASQNK  473

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA-TRNQLQADV-----------TLVKEN  382
            RLP+Q VL ALYYDQLK+RS A+   S  + +A T+ Q  +              L +EN
Sbjct  474  RLPLQAVLSALYYDQLKLRSAADAATSMGDVVADTQTQSSSAAGRARAQAMADAALAREN  533

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTF-------------------  259
            EALR EL +M+ +++     G  + SS   S +   +K TF                   
Sbjct  534  EALRVELARMRAYMSGTMQHGKGRESSTPASPSRTAKKATFLGTELARMRAYMSGMHHSK  593

Query  258  ----------------------FSSMSKKLGKLNPFKHG--SKDTSNLDDGEV------D  169
                                    S+S+ L +LNPFK G  +  T ++  G         
Sbjct  594  GSGATPPASPSRTAAAKTKASLLGSVSRSLSRLNPFKGGWTTNHTGSIAAGGRPCKTMHH  653

Query  168  ITKPRRRRFSIS  133
            +  P+RRR SI 
Sbjct  654  VVTPKRRRSSIG  665



>ref|XP_010272171.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nelumbo 
nucifera]
Length=620

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 119/211 (56%), Gaps = 26/211 (12%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A L+ + AR  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  416  ALAELIPEQARVTEDGMYRAIDIYLKAHPALTDMERKKVCSLMDCQKLSREACAHAAQND  475

Query  525  RLPVQIVLHALYYDQLKIRS--------GAEDPKSTPNAIATRNQLQAD--------VTL  394
            RLPVQIV+  LYY+Q ++R         G E P S P  +   N   AD        V+L
Sbjct  476  RLPVQIVVQVLYYEQQRLRDVMGGGNLMGGESP-SLPQKL---NLYSADYHSAPDEVVSL  531

Query  393  VKENEALRTELLQMKMFIADMQNkgssqgssvkgssa----saVRKPTFFSSMSKKLGKL  226
             +ENE L+ EL++M+M +  ++       S     SA        KP+F +S+SKKLG+L
Sbjct  532  RRENEDLKIELVKMRMRLKQLEKSAEIIPSGSTPPSADKPPLPRSKPSFINSVSKKLGRL  591

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
             PF     D     DG+  I   R RR SIS
Sbjct  592  YPFVRA--DGVKPSDGKGRIKPSRNRRHSIS  620



>ref|XP_011012052.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Populus euphratica]
Length=546

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 121/203 (60%), Gaps = 16/203 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  348  GLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDCQKLSREACAHAAQND  407

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD--VTLVKENE  379
            RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D   +L +ENE
Sbjct  408  RLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDIRPVSDELSSLRRENE  467

Query  378  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  199
             L+ EL++MKM I +++       +S   +    + + +F +S+SKKLG++NPF      
Sbjct  468  DLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRINPFVRADGP  527

Query  198  TSNLDDGEVDITKPRR-RRFSIS  133
             SN        T+P + RR SIS
Sbjct  528  LSNTKAR----TRPSKDRRHSIS  546



>ref|XP_011006800.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Populus euphratica]
Length=546

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 121/203 (60%), Gaps = 16/203 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  348  GLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDCQKLSREACAHAAQND  407

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD--VTLVKENE  379
            RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D   +L +ENE
Sbjct  408  RLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDIRPVSDELSSLRRENE  467

Query  378  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  199
             L+ EL++MKM I +++       +S   +    + + +F +S+SKKLG++NPF      
Sbjct  468  DLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRINPFVRADGP  527

Query  198  TSNLDDGEVDITKPRR-RRFSIS  133
             SN        T+P + RR SIS
Sbjct  528  LSNTKAR----TRPSKDRRHSIS  546



>ref|XP_011006799.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Populus euphratica]
Length=599

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 121/203 (60%), Gaps = 16/203 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  401  GLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDCQKLSREACAHAAQND  460

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD--VTLVKENE  379
            RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D   +L +ENE
Sbjct  461  RLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDIRPVSDELSSLRRENE  520

Query  378  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  199
             L+ EL++MKM I +++       +S   +    + + +F +S+SKKLG++NPF      
Sbjct  521  DLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRINPFVRADGP  580

Query  198  TSNLDDGEVDITKPRR-RRFSIS  133
             SN        T+P + RR SIS
Sbjct  581  LSNTKAR----TRPSKDRRHSIS  599



>ref|XP_010277091.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nelumbo nucifera]
Length=594

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 120/207 (58%), Gaps = 20/207 (10%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ +  R ++D +YRAIDIYLKAHP L ++ER+KVC +MD  KLS EA  HA+QN R
Sbjct  391  LAELIPEQTRVIEDGMYRAIDIYLKAHPALTDMERKKVCRLMDCQKLSREACAHAAQNDR  450

Query  522  LPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD---VTLVKENEAL  373
            LPVQIV+  LYY+Q ++R        GAE P      + +++   A    ++L +ENE L
Sbjct  451  LPVQIVVQVLYYEQRRLRDAMSDNLMGAESPALQKMNLHSKDYHSAPDELLSLRRENEDL  510

Query  372  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKP------TFFSSMSKKLGKLNPFKH  211
            + EL++M+M + +++  G            S  + P      +F SSMSKKLG+L PF  
Sbjct  511  KMELVKMRMRLKELEKSGEINPPESTPPIPSVDKPPLALPRKSFISSMSKKLGRLYPFMR  570

Query  210  GSKDTSNLDDGEVDITKP-RRRRFSIS  133
            G    S+   G    TKP R RR S+S
Sbjct  571  GEGVKSSDGKGR---TKPSRNRRHSVS  594



>ref|XP_010277089.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010277090.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
Length=605

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 120/207 (58%), Gaps = 20/207 (10%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ +  R ++D +YRAIDIYLKAHP L ++ER+KVC +MD  KLS EA  HA+QN R
Sbjct  402  LAELIPEQTRVIEDGMYRAIDIYLKAHPALTDMERKKVCRLMDCQKLSREACAHAAQNDR  461

Query  522  LPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD---VTLVKENEAL  373
            LPVQIV+  LYY+Q ++R        GAE P      + +++   A    ++L +ENE L
Sbjct  462  LPVQIVVQVLYYEQRRLRDAMSDNLMGAESPALQKMNLHSKDYHSAPDELLSLRRENEDL  521

Query  372  RTELLQMKMFIADMQNkgssqgssvkgssasaVRKP------TFFSSMSKKLGKLNPFKH  211
            + EL++M+M + +++  G            S  + P      +F SSMSKKLG+L PF  
Sbjct  522  KMELVKMRMRLKELEKSGEINPPESTPPIPSVDKPPLALPRKSFISSMSKKLGRLYPFMR  581

Query  210  GSKDTSNLDDGEVDITKP-RRRRFSIS  133
            G    S+   G    TKP R RR S+S
Sbjct  582  GEGVKSSDGKGR---TKPSRNRRHSVS  605



>ref|XP_011012051.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Populus euphratica]
Length=599

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 121/203 (60%), Gaps = 16/203 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  401  GLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDCQKLSREACAHAAQND  460

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD--VTLVKENE  379
            RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D   +L +ENE
Sbjct  461  RLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPALPPKVNIFSTDIRPVSDELSSLRRENE  520

Query  378  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  199
             L+ EL++MKM I +++       +S   +    + + +F +S+SKKLG++NPF      
Sbjct  521  DLKIELVKMKMKIKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRINPFVRADGP  580

Query  198  TSNLDDGEVDITKPRR-RRFSIS  133
             SN        T+P + RR SIS
Sbjct  581  LSNTKAR----TRPSKDRRHSIS  599



>ref|XP_008787157.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Phoenix 
dactylifera]
Length=610

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 115/202 (57%), Gaps = 18/202 (9%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + AR ++D +YRAIDIYLKAHP L  +ER+KVCS+MD  +LS EA  HA+QN R
Sbjct  415  LAELIPEQARVIEDGMYRAIDIYLKAHPSLSVVERKKVCSLMDCQRLSREACAHAAQNDR  474

Query  522  LPVQIVLHALYYDQLKIR--------SGAEDP----KSTPNAIATRNQLQADVTLVKENE  379
            LPVQ+V+  LYY+Q + R        SG E P    K+TP  I   N       L +EN 
Sbjct  475  LPVQLVVQVLYYEQQRHRDVMSTGNLSGGESPALSQKATPYGIGYHNAPDELSRLRRENA  534

Query  378  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  199
             L+ EL +M+M + +++    +  S+ K        K +F +S+SKKLG+L PF     D
Sbjct  535  DLKLELFRMRMQLQEIEKSSGNTTSAGKPPLP----KKSFINSVSKKLGRLYPFMR--SD  588

Query  198  TSNLDDGEVDITKPRRRRFSIS  133
                  G+     P+ RR SIS
Sbjct  589  NEKTLSGKTRKKPPKDRRHSIS  610



>ref|XP_006380639.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58436.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=601

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 120/202 (59%), Gaps = 13/202 (6%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  402  GLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDCQKLSREACAHAAQND  461

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD--VTLVKENE  379
            RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D   +L +ENE
Sbjct  462  RLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPDLPPKVNIFSTDIRPVSDELSSLRRENE  521

Query  378  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  199
             L+ EL++MKM + +++       +S   +    + + +F +S+SKKLG++NPF     D
Sbjct  522  DLKIELVKMKMKMKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRINPFVRA--D  579

Query  198  TSNLDDGEVDITKPRRRRFSIS  133
               L + +      + RR SIS
Sbjct  580  GFPLSNTKARTRPSKDRRHSIS  601



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 122/208 (59%), Gaps = 27/208 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A L    AR VDD LYRA+DIYLKAHP L ++ER+K+C ++D  KLS EA  HA+QN+
Sbjct  406  ALAELFPDHARLVDDSLYRAVDIYLKAHPALSDLERKKLCKLLDVQKLSQEACQHAAQNE  465

Query  525  RLPVQIVLHALYYDQLKIRSG-----------------AEDPKSTPNAIATRNQLQADVT  397
            RLPVQ+V+  LYY+Q+++R+                  A  P     AI+ R+      +
Sbjct  466  RLPVQMVVQVLYYEQMRLRTAMTTSFVDGEQVGPYSQKAAGPGGLSAAISPRDHYS---S  522

Query  396  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  217
            + +EN  L+ E+ +M+M + D++    +    ++ + +S+     F SS++K L KLNPF
Sbjct  523  IRRENRELKLEVARMRMRLTDLEKDHVNMKEGIQKTGSSSK----FLSSVTKTLSKLNPF  578

Query  216  KHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +   KD+SN+ + +  +   RRRR SIS
Sbjct  579  RF--KDSSNVPNAKSGMNS-RRRRHSIS  603



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 122/208 (59%), Gaps = 27/208 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A L    AR VDD LYRA+DIYLKAHP L ++ER+K+C ++D  KLS EA  HA+QN+
Sbjct  418  ALAELFPDHARLVDDSLYRAVDIYLKAHPALSDLERKKLCKLLDVQKLSQEACQHAAQNE  477

Query  525  RLPVQIVLHALYYDQLKIRSG-----------------AEDPKSTPNAIATRNQLQADVT  397
            RLPVQ+V+  LYY+Q+++R+                  A  P     AI+ R+      +
Sbjct  478  RLPVQMVVQVLYYEQMRLRTAMTTSFVDGEQVGPYSQKAAGPGGLSAAISPRDHYS---S  534

Query  396  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  217
            + +EN  L+ E+ +M+M + D++    +    ++ + +S+     F SS++K L KLNPF
Sbjct  535  IRRENRELKLEVARMRMRLTDLEKDHVNMKEGIQKTGSSSK----FLSSVTKTLSKLNPF  590

Query  216  KHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +   KD+SN+ + +  +   RRRR SIS
Sbjct  591  RF--KDSSNVPNAKSGMNN-RRRRHSIS  615



>ref|XP_006380638.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58435.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=643

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 120/202 (59%), Gaps = 13/202 (6%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A ++ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  444  GLAEIIPEQSRVTEDGMYRAIDIYLKAHPALSDMERKKVCSLMDCQKLSREACAHAAQND  503

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDPKSTP--NAIATRNQLQAD--VTLVKENE  379
            RLPVQ V+  LYY+Q ++R        G + P   P  N  +T  +  +D   +L +ENE
Sbjct  504  RLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSPDLPPKVNIFSTDIRPVSDELSSLRRENE  563

Query  378  ALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKD  199
             L+ EL++MKM + +++       +S   +    + + +F +S+SKKLG++NPF     D
Sbjct  564  DLKIELVKMKMKMKEIERATVVSTTSSPSADKPPLPRKSFINSVSKKLGRINPFVRA--D  621

Query  198  TSNLDDGEVDITKPRRRRFSIS  133
               L + +      + RR SIS
Sbjct  622  GFPLSNTKARTRPSKDRRHSIS  643



>gb|KHN36285.1| BTB/POZ domain-containing protein [Glycine soja]
Length=618

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 125/208 (60%), Gaps = 20/208 (10%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
              +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCSVMD  KLS EA  HA+QN
Sbjct  415  TSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVCSVMDCQKLSREACAHAAQN  474

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------TLVKENEA  376
             RLPVQ V+  LYY+Q ++R+     +S  +++ ++ N    D+        TL +ENE 
Sbjct  475  DRLPVQTVVQVLYYEQQRLRNAMNGSRSGESSVDSKLNVYSTDLHPVSNELSTLRRENED  534

Query  375  LRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPFK  214
            L+ EL+++KM + +++N       +    S++ +  KP     +F SS+SKKLG+L+PF 
Sbjct  535  LKLELVKLKMRLKEIENSTLKSTVNSPAVSASPSADKPPLPRRSFMSSVSKKLGRLSPFV  594

Query  213  HGSKDTSNLDDGEVDITKP-RRRRFSIS  133
              +   S    G    TKP + RR SIS
Sbjct  595  R-ADGVSPFAKGR---TKPNKNRRHSIS  618



>ref|XP_006579934.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN06007.1| BTB/POZ domain-containing protein [Glycine soja]
Length=590

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 128/210 (61%), Gaps = 27/210 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVCSVMD  KLS EA  HA+QN R
Sbjct  388  VAELIPEQSRPTEDGMYRAIDIYLKAHPVLSDMEKKKVCSVMDCQKLSREACAHAAQNDR  447

Query  522  LPVQIVLHALYYDQLKIR------SGAEDP------KSTPNAI-ATRNQLQADVTLVKEN  382
            LPVQ+V+  LYY+Q ++R      +G + P       S+PN +    N+L     L +EN
Sbjct  448  LPVQMVVQVLYYEQQRLRDSMDGNAGWDSPNFRDKVNSSPNELNLVSNELS---ILRREN  504

Query  381  EALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNP  220
            E L+ E++++KM + +++       SS     ++ +  KP     +F +S+SKKLG+L+P
Sbjct  505  EDLKLEIVKLKMKLKEIERTSIRSASSSPVIFASPSADKPPLPRKSFINSVSKKLGRLSP  564

Query  219  FKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
            F  G+  T+ L  G V   KP + RR SIS
Sbjct  565  FSRGNAATTLL-KGHV---KPDKNRRHSIS  590



>ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis]
Length=621

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 116/183 (63%), Gaps = 13/183 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRAIDI+LKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  422  GLAELIPEQSRITEDGMYRAIDIFLKAHPAISDMERKKVCSLMDCQKLSREACAHAAQND  481

Query  525  RLPVQIVLHALYYDQLKIRS---GAEDPK--STPNAIATRNQLQAD--VTLVKENEALRT  367
            RLPVQ V+  LYY+Q ++R    G + P   +  N  AT N   +D   +L +ENE L+ 
Sbjct  482  RLPVQTVVQVLYYEQQRLRDVMIGGDSPTLPTKVNLYATNNHPVSDEISSLKRENEDLKL  541

Query  366  ELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP-----TFFSSMSKKLGKLNPFKHGS  205
            EL++MKM + +++ + G    +S    ++ +  KP     +F +S+SKKLG+L PF  G 
Sbjct  542  ELVKMKMRLKEIEKSGGGRSVTSSPALNSPSADKPPLPRKSFINSVSKKLGRLYPFVRGE  601

Query  204  KDT  196
             D+
Sbjct  602  GDS  604



>ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
Length=618

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 125/212 (59%), Gaps = 28/212 (13%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
              +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCSVMD  KLS EA  HA+QN
Sbjct  415  TSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVCSVMDCQKLSREACAHAAQN  474

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------TLVKENEA  376
             RLPVQ V+  LYY+Q ++R+     +S  +++ ++ N    D+        TL +ENE 
Sbjct  475  DRLPVQTVVQVLYYEQQRLRNAMNGSRSGESSVDSKLNVYSTDLHPVSNELSTLRRENED  534

Query  375  LRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPFK  214
            L+ EL+++KM + +++N       +    S++ +  KP     +F SS+SKKLG+L+PF 
Sbjct  535  LKLELVKLKMRLKEIENSTLKSTVNSPAVSASPSADKPPLPRRSFMSSVSKKLGRLSPFV  594

Query  213  HGSKDTSNLDDGEVDI----TKP-RRRRFSIS  133
                      DG +      TKP + RR SIS
Sbjct  595  RA--------DGVLPFPKGRTKPNKNRRHSIS  618



>ref|XP_008341358.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Malus domestica]
Length=568

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 123/214 (57%), Gaps = 31/214 (14%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA L+ + +R+ +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  363  GIAELIPEQSRETEDGMYRAIDIYLKAHPALSDMERKKVCSMMDCQKLSREACAHAAQND  422

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQA--------DVTLV  391
            RLPVQ V+  LYY+Q ++R        GAE      + + ++  L +        ++T++
Sbjct  423  RLPVQTVVQVLYYEQQRLRDVMNGNSIGAES-----SVLPSKGSLYSTDIHPVPDELTIL  477

Query  390  -KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-KP-----TFFSSMSKKLG  232
             ++NE L+ EL++MKM + +++   +         +      KP     +F +S+SKKLG
Sbjct  478  RRQNEELKMELVKMKMKLKELETSTTRTAMISPMGNTPTSXDKPPLPRKSFINSVSKKLG  537

Query  231  KLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            KL+PF      T     G    TKP + RR SIS
Sbjct  538  KLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  568



>ref|XP_010412681.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=243

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 116/214 (54%), Gaps = 36/214 (17%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G A  + K +R  +D +YRAIDIYLK HP + E+E++KVC++MD  KLS E   HA+QN 
Sbjct  43   GFAECIPKQSRITEDGMYRAIDIYLKTHPNISEMEKKKVCNLMDCQKLSREKCAHAAQND  102

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-------------RNQLQADVTLVKE  385
            RLPVQ V+  LYY+Q  +R    D  S P A AT              N+L     L +E
Sbjct  103  RLPVQTVVQVLYYEQQSLREILSDSDSPPAAAATVEDTHPPPELSSYNNELS---KLNRE  159

Query  384  NEALRTELLQMKMFIADMQNkgssqgss-----vkgssasaVRKP-----TFFSSMSKKL  235
            N+ L+ EL+++KM   +++    +   +         S ++V KP     +F SS+S++L
Sbjct  160  NQELKLELIKVKMKFKELEKNQKAFEVTSGSDCSSSVSIASVVKPRLPRKSFMSSVSRQL  219

Query  234  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            GKLNPF  G K        +V    P+ RR SIS
Sbjct  220  GKLNPF--GQK--------QVQTKPPKGRRHSIS  243



>ref|XP_008354715.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=626

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 123/214 (57%), Gaps = 31/214 (14%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA L+ + +R+ +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  421  GIAELIPEQSRETEDGMYRAIDIYLKAHPALSDMERKKVCSMMDCQKLSREACAHAAQND  480

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQA--------DVTLV  391
            RLPVQ V+  LYY+Q ++R        GAE      + + ++  L +        ++T++
Sbjct  481  RLPVQTVVQVLYYEQQRLRDVMNGNSIGAES-----SVLPSKGSLYSTDIHPVPDELTIL  535

Query  390  -KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVR-KP-----TFFSSMSKKLG  232
             ++NE L+ EL++MKM + +++   +         +      KP     +F +S+SKKLG
Sbjct  536  RRQNEELKMELVKMKMKLKELETSTTRTAMISPMGNTPTSXDKPPLPRKSFINSVSKKLG  595

Query  231  KLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            KL+PF      T     G    TKP + RR SIS
Sbjct  596  KLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  626



>ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Glycine max]
Length=618

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 123/208 (59%), Gaps = 20/208 (10%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
              +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCSVMD  KLS EA  HA+QN
Sbjct  415  TSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVCSVMDCQKLSREACAHAAQN  474

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------TLVKENEA  376
             RLPVQ V+  LYY+Q ++R       S  +++ ++ N    D+        TL +ENE 
Sbjct  475  DRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYSTDLHPVSNELSTLRRENED  534

Query  375  LRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPFK  214
            L+ EL+++KM + +++N       +    S++ +  KP     +F SS+SKKLG+L+PF 
Sbjct  535  LKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFV  594

Query  213  HGSKDTSNLDDGEVDITKP-RRRRFSIS  133
              +   S    G    TKP + RR SIS
Sbjct  595  R-ADGVSPFAKGR---TKPNKNRRHSIS  618



>ref|XP_008238282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
 ref|XP_008238290.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
Length=624

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 118/206 (57%), Gaps = 17/206 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA LV + +R  +D +YRA+DIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  419  GIAELVPEQSRATEDGMYRAVDIYLKAHPALSDMERKKVCSMMDCQKLSREACAHAAQND  478

Query  525  RLPVQIVLHALYYDQLKIR-------SGAEDP--KSTPNAIATRNQLQAD--VTLVKENE  379
            RLPVQ V+  LYY+Q ++R       +G E     S  N  +T      D    L ++NE
Sbjct  479  RLPVQTVVQVLYYEQQRLRDVMNGNLTGGESSVLPSKGNLYSTDIHPVPDELSILRRQNE  538

Query  378  ALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPF  217
             L+ EL++MKM + +++        S   G+ +++  KP     +F +S+SKKLG+L+PF
Sbjct  539  ELKIELVKMKMRLKELETSTMRTSMSSPMGNISTSADKPPLPRKSFINSVSKKLGRLSPF  598

Query  216  KHGSKDTSNLDDGEVDITKPRRRRFS  139
                  T ++  G     K RR   S
Sbjct  599  VRTDGVTPSIPKGRTRAAKDRRHSIS  624



>ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Glycine max]
Length=628

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 123/208 (59%), Gaps = 20/208 (10%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
              +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCSVMD  KLS EA  HA+QN
Sbjct  425  TSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVCSVMDCQKLSREACAHAAQN  484

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------TLVKENEA  376
             RLPVQ V+  LYY+Q ++R       S  +++ ++ N    D+        TL +ENE 
Sbjct  485  DRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYSTDLHPVSNELSTLRRENED  544

Query  375  LRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPFK  214
            L+ EL+++KM + +++N       +    S++ +  KP     +F SS+SKKLG+L+PF 
Sbjct  545  LKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFV  604

Query  213  HGSKDTSNLDDGEVDITKP-RRRRFSIS  133
              +   S    G    TKP + RR SIS
Sbjct  605  R-ADGVSPFAKGR---TKPNKNRRHSIS  628



>gb|KHN12984.1| BTB/POZ domain-containing protein [Glycine soja]
Length=640

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 123/208 (59%), Gaps = 20/208 (10%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
              +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCSVMD  KLS EA  HA+QN
Sbjct  437  TSLAELIPEQSRPTEDGMYRAIDIFLKAHPALSDMDRKKVCSVMDCQKLSREACAHAAQN  496

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------TLVKENEA  376
             RLPVQ V+  LYY+Q ++R       S  +++ ++ N    D+        TL +ENE 
Sbjct  497  DRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSVDSKLNVYSTDLHPVSNELSTLRRENED  556

Query  375  LRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPFK  214
            L+ EL+++KM + +++N       +    S++ +  KP     +F SS+SKKLG+L+PF 
Sbjct  557  LKLELVKLKMRLKEIENSTLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFV  616

Query  213  HGSKDTSNLDDGEVDITKP-RRRRFSIS  133
              +   S    G    TKP + RR SIS
Sbjct  617  R-ADGVSPFAKGR---TKPNKNRRHSIS  640



>gb|AAN77296.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94554.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|EEE58548.1| hypothetical protein OsJ_09846 [Oryza sativa Japonica Group]
Length=626

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 116/219 (53%), Gaps = 32/219 (15%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
              +A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC  MD  KLS EA  HA+QN
Sbjct  413  TALAELIPERARFNEDGMYRAIDIYLKAHPSLAEGERKKVCRAMDCQKLSREACAHAAQN  472

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------------RNQLQADV  400
             RLPVQ V+  LY++Q ++R+ ++ P + P+                     R  +  +V
Sbjct  473  DRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYAGGESPALSYRPTPSFNGRHRPGVPDEV  532

Query  399  T-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT---------FFSS  250
            + L +EN+ LR ELL+MKM + D  +   S G           +KP          F +S
Sbjct  533  SRLQRENDELRMELLRMKMRLRD-PSVAFSAGGVPPSGRPPLPKKPGGGGGGSSGGFMNS  591

Query  249  MSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            MSKKLG+LNPF      +  L  G V    P+ RR SIS
Sbjct  592  MSKKLGRLNPFLR----SDVLGGGRVRTKPPKDRRHSIS  626



>gb|EEC74727.1| hypothetical protein OsI_10455 [Oryza sativa Indica Group]
Length=626

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 116/219 (53%), Gaps = 32/219 (15%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
              +A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC  MD  KLS EA  HA+QN
Sbjct  413  TALAELIPERARFNEDGMYRAIDIYLKAHPSLAEGERKKVCRAMDCQKLSREACAHAAQN  472

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------------RNQLQADV  400
             RLPVQ V+  LY++Q ++R+ ++ P + P+                     R  +  +V
Sbjct  473  DRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYAGGESPALSYRPTPSFNGRHRPGVPDEV  532

Query  399  T-LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT---------FFSS  250
            + L +EN+ LR ELL+MKM + D  +   S G           +KP          F +S
Sbjct  533  SRLQRENDELRMELLRMKMRLRD-PSVAFSAGGVPPSGRPPLPKKPGGGGGGSSGGFMNS  591

Query  249  MSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            MSKKLG+LNPF      +  L  G V    P+ RR SIS
Sbjct  592  MSKKLGRLNPFLR----SDVLGGGRVRTKPPKDRRHSIS  626



>ref|XP_010559030.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Tarenaya hassleriana]
Length=588

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 116/206 (56%), Gaps = 24/206 (12%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRAIDIYLKAHP + E+ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  392  GLAELIPEQSRVTEDGMYRAIDIYLKAHPNISEVERKKVCSLMDCQKLSREACAHAAQND  451

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVT-------LVKENEALRT  367
            RLPVQ V+  LYY+Q +IR   ++     +   +        +       L +EN+ L+ 
Sbjct  452  RLPVQTVVQVLYYEQQRIRDVMKETDIPTDPPPSILPPPKPTSYNEELSKLKRENQDLKL  511

Query  366  ELLQMKMFIADMQNkgssqgssvkgssasaVRKP-----TFFSSMSKKLGKLNPFK---H  211
            ELL+MKM + + +       +S    SA ++ KP     +F SS+SKKLG+L PF    H
Sbjct  512  ELLKMKMKLKEYEKSEMGSSNSNSPVSAVSMGKPPLPKKSFMSSVSKKLGRLYPFGISPH  571

Query  210  GSKDTSNLDDGEVDITKPRRRRFSIS  133
             ++  +           P+ RR SIS
Sbjct  572  NARGRTK---------PPKDRRHSIS  588



>ref|XP_010559028.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Tarenaya hassleriana]
Length=589

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 116/206 (56%), Gaps = 24/206 (12%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRAIDIYLKAHP + E+ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  393  GLAELIPEQSRVTEDGMYRAIDIYLKAHPNISEVERKKVCSLMDCQKLSREACAHAAQND  452

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVT-------LVKENEALRT  367
            RLPVQ V+  LYY+Q +IR   ++     +   +        +       L +EN+ L+ 
Sbjct  453  RLPVQTVVQVLYYEQQRIRDVMKETDIPTDPPPSILPPPKPTSYNEELSKLKRENQDLKL  512

Query  366  ELLQMKMFIADMQNkgssqgssvkgssasaVRKP-----TFFSSMSKKLGKLNPFK---H  211
            ELL+MKM + + +       +S    SA ++ KP     +F SS+SKKLG+L PF    H
Sbjct  513  ELLKMKMKLKEYEKSEMGSSNSNSPVSAVSMGKPPLPKKSFMSSVSKKLGRLYPFGISPH  572

Query  210  GSKDTSNLDDGEVDITKPRRRRFSIS  133
             ++  +           P+ RR SIS
Sbjct  573  NARGRTK---------PPKDRRHSIS  589



>gb|AFK45576.1| unknown [Medicago truncatula]
Length=468

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
            NGIA L+ K ARK+DDDLYRA+DIYLK HP+LDEIEREKVCSVMDPLKLSYEARVHASQN
Sbjct  383  NGIAVLIPKHARKIDDDLYRAVDIYLKVHPKLDEIEREKVCSVMDPLKLSYEARVHASQN  442

Query  528  KRLP  517
            KRLP
Sbjct  443  KRLP  446



>ref|XP_010905283.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Elaeis guineensis]
Length=533

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 119/202 (59%), Gaps = 19/202 (9%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + AR  +D +YRAIDIYLKAHP L ++ER+KVCS+M+  KLS EA  HA+QN R
Sbjct  339  LAELIPEQARVFEDGMYRAIDIYLKAHPSLSDMERKKVCSLMECQKLSREACAHAAQNDR  398

Query  522  LPVQIVLHALYYDQLKIR-------SGAEDP----KSTPNAIATRNQLQADVTLVKENEA  376
            LPVQIV+  L+++Q + R       SG E P    K+TP  +   N       L +EN  
Sbjct  399  LPVQIVVQVLHHEQQRRRDVMSGNFSGGESPALSQKATPFGVGYHNAPDELSRLRRENAD  458

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  196
            L+ EL +M+M + +++    +  S+ K        K +F +S+SKKLG+L PF     D+
Sbjct  459  LKLELFRMRMQLKEIEKSSGNITSAGKPPLP----KKSFINSVSKKLGRLYPFMR--SDS  512

Query  195  SNLDDGEVDITKPRR-RRFSIS  133
                 G+  +TKP + RR SIS
Sbjct  513  VKPPSGK-RMTKPHKDRRHSIS  533



>gb|KJB48679.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=355

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 119/208 (57%), Gaps = 26/208 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  157  GLAELIPEQSRVTEDGMYRAIDIYLKAHPTITDMERKKVCSLMDCQKLSREACAHAAQND  216

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------TLVKENEAL  373
            RLPVQ V+  LY++Q ++R        +P  I ++ N    DV        +L +EN+ L
Sbjct  217  RLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYPTDVHPVSGELSSLKRENQDL  276

Query  372  RTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFFSSMSKKLGKLNPFK  214
            + EL++MKM + +++   S++ +      +           K +F +S+SKKLG+L PF 
Sbjct  277  KLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPLPKKSFMNSVSKKLGRLYPF-  335

Query  213  HGSKDTSNLDDGEVDITKPRR-RRFSIS  133
                    +  G    T+P + RR SIS
Sbjct  336  --------VPSGAKGRTRPSKDRRHSIS  355



>ref|XP_010905282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Elaeis guineensis]
Length=609

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 119/202 (59%), Gaps = 19/202 (9%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + AR  +D +YRAIDIYLKAHP L ++ER+KVCS+M+  KLS EA  HA+QN R
Sbjct  415  LAELIPEQARVFEDGMYRAIDIYLKAHPSLSDMERKKVCSLMECQKLSREACAHAAQNDR  474

Query  522  LPVQIVLHALYYDQLKIR-------SGAEDP----KSTPNAIATRNQLQADVTLVKENEA  376
            LPVQIV+  L+++Q + R       SG E P    K+TP  +   N       L +EN  
Sbjct  475  LPVQIVVQVLHHEQQRRRDVMSGNFSGGESPALSQKATPFGVGYHNAPDELSRLRRENAD  534

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  196
            L+ EL +M+M + +++    +  S+ K        K +F +S+SKKLG+L PF     D+
Sbjct  535  LKLELFRMRMQLKEIEKSSGNITSAGKPPLP----KKSFINSVSKKLGRLYPFMR--SDS  588

Query  195  SNLDDGEVDITKPRR-RRFSIS  133
                 G+  +TKP + RR SIS
Sbjct  589  VKPPSGK-RMTKPHKDRRHSIS  609



>ref|XP_009411062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Musa 
acuminata subsp. malaccensis]
Length=583

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 111/201 (55%), Gaps = 17/201 (8%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +  LV + AR  +D +YRAIDIYLKAHP   + ER+KVCS+MD  KLS EA  HA+QN+R
Sbjct  389  LGELVSEQARVNEDGMYRAIDIYLKAHPSSTDEERKKVCSLMDCQKLSREACAHAAQNER  448

Query  522  LPVQIVLHALYYDQLKIR-------SGAEDP----KSTPNAIATRNQLQADVTLVKENEA  376
            LPVQ V+  L+ +Q + R       +G E P    +STP +   R        L +EN+ 
Sbjct  449  LPVQTVVQVLFCEQQRFRDATSGSFTGGESPALSLRSTPCSTKHRGGTDELSRLQRENDD  508

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  196
            LR +LL+M+M + +++       S+ K        K +F +S+SKKLG+L PF H     
Sbjct  509  LRMQLLRMRMLLKEVEKPSGQIPSAQKPPLP----KKSFINSLSKKLGRLYPFTHADGVK  564

Query  195  SNLDDGEVDITKPRRRRFSIS  133
                 G      P+ RR SIS
Sbjct  565  PFSSKGRTK--PPKDRRHSIS  583



>ref|XP_010028107.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Eucalyptus grandis]
 gb|KCW54768.1| hypothetical protein EUGRSUZ_I00715 [Eucalyptus grandis]
Length=614

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 112/182 (62%), Gaps = 24/182 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A LV + AR  +D +YRAIDIYLKAHP L E+ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  415  LAELVPEQARVTEDGIYRAIDIYLKAHPALSELERKKVCSLMDCQKLSREACAHAAQNDR  474

Query  522  LPVQIVLHALYYDQLKIRS------GAEDPKSTPNAIATRNQLQADV--------TLVKE  385
            LPVQ V+  LYY+Q ++R       G E P + P  +   N    D+         L +E
Sbjct  475  LPVQTVVQVLYYEQQRMRDAMNGSLGGESP-AAPRKL---NVYSTDIHPVSDELSRLKRE  530

Query  384  NEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP-----TFFSSMSKKLGKLN  223
            NE L+ EL++MKM + +++ +   S G S  GS+ S+  KP     +F +SMSKKLG+L 
Sbjct  531  NEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSADKPPLPRKSFINSMSKKLGRLY  590

Query  222  PF  217
            PF
Sbjct  591  PF  592



>ref|XP_010028106.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Eucalyptus grandis]
Length=615

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 112/182 (62%), Gaps = 24/182 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A LV + AR  +D +YRAIDIYLKAHP L E+ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  416  LAELVPEQARVTEDGIYRAIDIYLKAHPALSELERKKVCSLMDCQKLSREACAHAAQNDR  475

Query  522  LPVQIVLHALYYDQLKIRS------GAEDPKSTPNAIATRNQLQADV--------TLVKE  385
            LPVQ V+  LYY+Q ++R       G E P + P  +   N    D+         L +E
Sbjct  476  LPVQTVVQVLYYEQQRMRDAMNGSLGGESP-AAPRKL---NVYSTDIHPVSDELSRLKRE  531

Query  384  NEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP-----TFFSSMSKKLGKLN  223
            NE L+ EL++MKM + +++ +   S G S  GS+ S+  KP     +F +SMSKKLG+L 
Sbjct  532  NEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSADKPPLPRKSFINSMSKKLGRLY  591

Query  222  PF  217
            PF
Sbjct  592  PF  593



>emb|CDP02580.1| unnamed protein product [Coffea canephora]
Length=620

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 109/178 (61%), Gaps = 15/178 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCSVMD  KLS EA  HA+QN 
Sbjct  417  GLAELLPERSRITEDGMYRAIDIYLKAHPALSDMERKKVCSVMDCQKLSREACAHAAQND  476

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKS-TPNAIATRNQLQAD--------VTLVKENEAL  373
            RLPVQ V+  LYY+Q ++R   +  +  TPN     NQ  A          +L KEN+ L
Sbjct  477  RLPVQTVVQVLYYEQQRLREAVDGTEGETPNLALKVNQHPAGSHTAPQELSSLRKENQDL  536

Query  372  RTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP-----TFFSSMSKKLGKLNPF  217
            + EL++M+  + +++ +   S  +S    +  +  KP     +  SS+S+KLGK+NPF
Sbjct  537  KLELVKMRTRLRELEKSSDKSYAASPLVITLPSAEKPPLPRKSLISSVSRKLGKINPF  594



>ref|XP_010028108.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Eucalyptus grandis]
Length=597

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 112/182 (62%), Gaps = 24/182 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A LV + AR  +D +YRAIDIYLKAHP L E+ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  398  LAELVPEQARVTEDGIYRAIDIYLKAHPALSELERKKVCSLMDCQKLSREACAHAAQNDR  457

Query  522  LPVQIVLHALYYDQLKIRS------GAEDPKSTPNAIATRNQLQADV--------TLVKE  385
            LPVQ V+  LYY+Q ++R       G E P + P  +   N    D+         L +E
Sbjct  458  LPVQTVVQVLYYEQQRMRDAMNGSLGGESP-AAPRKL---NVYSTDIHPVSDELSRLKRE  513

Query  384  NEALRTELLQMKMFIADMQ-NkgssqgssvkgssasaVRKP-----TFFSSMSKKLGKLN  223
            NE L+ EL++MKM + +++ +   S G S  GS+ S+  KP     +F +SMSKKLG+L 
Sbjct  514  NEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTPSSADKPPLPRKSFINSMSKKLGRLY  573

Query  222  PF  217
            PF
Sbjct  574  PF  575



>gb|KJB48678.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=501

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 119/208 (57%), Gaps = 26/208 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  303  GLAELIPEQSRVTEDGMYRAIDIYLKAHPTITDMERKKVCSLMDCQKLSREACAHAAQND  362

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------TLVKENEAL  373
            RLPVQ V+  LY++Q ++R        +P  I ++ N    DV        +L +EN+ L
Sbjct  363  RLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYPTDVHPVSGELSSLKRENQDL  422

Query  372  RTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFFSSMSKKLGKLNPFK  214
            + EL++MKM + +++   S++ +      +           K +F +S+SKKLG+L PF 
Sbjct  423  KLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPLPKKSFMNSVSKKLGRLYPF-  481

Query  213  HGSKDTSNLDDGEVDITKPRR-RRFSIS  133
                    +  G    T+P + RR SIS
Sbjct  482  --------VPSGAKGRTRPSKDRRHSIS  501



>ref|XP_009342777.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Pyrus 
x bretschneideri]
Length=629

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 126/214 (59%), Gaps = 31/214 (14%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA L+ + +R+ +D +YRAIDIYLKAH  L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  424  GIAELIPEQSRETEDGMYRAIDIYLKAHSALSDMERKKVCSMMDCQKLSREACAHAAQND  483

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQA--------DVTLV  391
            RLPVQ V+  LYY+Q ++R        GAE      + + ++  L +        ++T++
Sbjct  484  RLPVQTVVQVLYYEQQRLRDVMNGNPIGAES-----SVLPSKGSLYSTDIHPVPDELTIL  538

Query  390  -KENEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLG  232
             ++NE L+ EL++MKM + +++   +        G++ ++  KP     +F +S+SKKLG
Sbjct  539  RRQNEELKIELVKMKMKLKELETSTTRTTMISPMGNTPTSADKPPLPRKSFMNSVSKKLG  598

Query  231  KLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            KL+PF      T     G    TKP + RR SIS
Sbjct  599  KLSPFVRADGVTPTGAKGR---TKPAKDRRHSIS  629



>ref|XP_006600924.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN28330.1| BTB/POZ domain-containing protein [Glycine soja]
Length=583

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 111/181 (61%), Gaps = 15/181 (8%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+   +R+ +D +YRAIDIYLKAHP L ++E++KVCSVMD  KLS EA  HA+QN R
Sbjct  388  VAELIPDQSRETEDGMYRAIDIYLKAHPILSDMEKKKVCSVMDCQKLSREACAHAAQNDR  447

Query  522  LPVQIVLHALYYDQLKIR------SGAEDPKSTPNAIATRNQLQADVTLVKENEALRTEL  361
            LPVQ+V+  LYY+Q ++R      +G + P       ++ N+L     L +EN+ L+ E+
Sbjct  448  LPVQMVVQVLYYEQQRLRDSMDSSAGWDSPNFLDKVNSSPNELS---ILRRENQDLKLEI  504

Query  360  LQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKD  199
            +++KM + + +       SS     ++ +  KP     +F +S+SKKLG+L+PF  G   
Sbjct  505  VKLKMRLKEFERTSIRSASSSPVIYASRSADKPPLPRKSFINSVSKKLGRLSPFSRGDAA  564

Query  198  T  196
            T
Sbjct  565  T  565



>ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=623

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 125/211 (59%), Gaps = 24/211 (11%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  417  GLAELIPEQSRVTEDGMYRAIDIYLKAHPTISDLERKKVCSLMDCQKLSREACAHAAQND  476

Query  525  RLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATR-NQLQAD--------VTLVKEN  382
            RLPVQ V+  LYY+Q ++R   +G+     +P AI++R N   AD         +L +EN
Sbjct  477  RLPVQTVVQVLYYEQQRLRDVMNGSISSGDSP-AISSRVNLYTADSHPVSDELSSLKREN  535

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssas--aVRKP-----TFFSSMSKKLGKLN  223
            E L+ EL++MKM + +++   S + +          +  KP     +F +S+SKKLG+L 
Sbjct  536  EDLKLELVKMKMRLKEIEKSSSVKSAVSSPMGIILPSSDKPPLPRKSFMNSVSKKLGRLY  595

Query  222  PFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            PF      + +   G    T+P + RR SIS
Sbjct  596  PFVRSDGVSPSSAKGR---TRPSKDRRHSIS  623



>ref|XP_002465671.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
 gb|EER92669.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
Length=598

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 111/205 (54%), Gaps = 22/205 (11%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
             G+A ++ + AR  +D +YRAIDIYLKAHP L E  R+KVC VMD  KLS EA  HA+QN
Sbjct  400  TGLAEMIPERARFNEDGMYRAIDIYLKAHPHLSEAGRKKVCRVMDCQKLSREACAHAAQN  459

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA--------DVT-LVKENEA  376
             RLPVQ V+  LY++Q ++R   + P S P   A    LQ         +V+ L +ENE 
Sbjct  460  DRLPVQTVVQVLYHEQRRLREAPKAP-SPPYRPAPTPSLQGRHARTVLDEVSRLQRENEE  518

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT-----FFSSMSKKLGKLNPFKH  211
            L+ ELL+MKM + +          +         +K       F +++SKKLG+LNPF  
Sbjct  519  LKMELLRMKMHMREPPAALPQPSGAPPPGRRPPPKKAAGGSGGFMNNVSKKLGRLNPFLR  578

Query  210  GSKDTSNLDDGEVDITKPRRRRFSI  136
                   LD    +  K RRRR SI
Sbjct  579  -------LDAVGTEPPKDRRRRRSI  596



>gb|KJB48677.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=614

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 119/208 (57%), Gaps = 26/208 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  416  GLAELIPEQSRVTEDGMYRAIDIYLKAHPTITDMERKKVCSLMDCQKLSREACAHAAQND  475

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------TLVKENEAL  373
            RLPVQ V+  LY++Q ++R        +P  I ++ N    DV        +L +EN+ L
Sbjct  476  RLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVIPSKVNLYPTDVHPVSGELSSLKRENQDL  535

Query  372  RTELLQMKMFIADMQNkgssqgssvkgssasaVR-------KPTFFSSMSKKLGKLNPFK  214
            + EL++MKM + +++   S++ +      +           K +F +S+SKKLG+L PF 
Sbjct  536  KLELVKMKMRLKEIEKSTSAKTAISSPMGSITPSSDKPPLPKKSFMNSVSKKLGRLYPF-  594

Query  213  HGSKDTSNLDDGEVDITKPRR-RRFSIS  133
                    +  G    T+P + RR SIS
Sbjct  595  --------VPSGAKGRTRPSKDRRHSIS  614



>gb|AAV50010.1| phototropic response-like protein [Malus domestica]
Length=114

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = -2

Query  456  DPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkg-ssqgssvkgssas  280
            D     +AI TR+Q+Q DV+L +ENE LRTELL+MKM+I D+   G ++  ++       
Sbjct  6    DENDVQDAITTRSQVQHDVSLARENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGG  65

Query  279  aVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              +K  FFS +SKKLG+LNPFK GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct  66   GPKKAKFFSYVSKKLGRLNPFKQGSKDTSNIVDEDVDITKPRRRRFSIS  114



>ref|XP_010086959.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=624

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 121/215 (56%), Gaps = 31/215 (14%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  417  GLAELIPEQSRVTEDGMYRAIDIYLKAHPVLSDMERKKVCSLMDCQKLSREACAHAAQND  476

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDPKST-PNAIATRNQLQADV--------TL  394
            RLPVQ V+  LYY+Q ++R        G E P S  P+ +   N    D+         L
Sbjct  477  RLPVQTVVQVLYYEQQRLRDVMNGSLVGGESPASALPSKL---NLYSTDIHPVSDELSGL  533

Query  393  VKENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----TFFSSMSKKL  235
             +ENE L+ EL++MKM + +++   + + +         S+  KP     +F +S+SK+L
Sbjct  534  RRENEDLKIELVKMKMKMKEIERSTAVKSAVNSPQSVIMSSADKPPRPRKSFMNSVSKRL  593

Query  234  GKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            G+L PF      T +        TKP + RR SIS
Sbjct  594  GRLYPFVRSDGVTPSYKGR----TKPSKDRRHSIS  624



>ref|XP_007208165.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
 gb|EMJ09364.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
Length=624

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 116/206 (56%), Gaps = 17/206 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA LV + +R  +D +YRA+DIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  419  GIAELVPEQSRATEDGMYRAVDIYLKAHPALSDMERKKVCSMMDCQKLSREACAHAAQND  478

Query  525  RLPVQIVLHALYYDQLKIRS-------GAEDP--KSTPNAIATRNQLQAD--VTLVKENE  379
            RLPVQ V+  LYY+Q ++R        G E     S  N  +T      D    L ++NE
Sbjct  479  RLPVQTVVQVLYYEQQRLRDVMNGNLIGGESSVLPSKGNLYSTDIHPVPDELSILRRQNE  538

Query  378  ALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPF  217
             L+ EL++MK  + +++        S   G+ +++  KP     +F +S+SKKLG+L+PF
Sbjct  539  ELKIELVKMKKRLKELETSTVRTSISSPMGNISTSADKPPLPRKSFINSVSKKLGRLSPF  598

Query  216  KHGSKDTSNLDDGEVDITKPRRRRFS  139
                  T ++  G     K RR   S
Sbjct  599  VRTDGVTPSIPKGRTRAAKDRRHSIS  624



>ref|XP_010412682.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 116/214 (54%), Gaps = 36/214 (17%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G A  + K +R  +D +YRAIDIYLK HP + E+E++KVC++MD  KLS E   HA+QN 
Sbjct  371  GFAECIPKQSRITEDGMYRAIDIYLKTHPNISEMEKKKVCNLMDCQKLSREKCAHAAQND  430

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-------------RNQLQADVTLVKE  385
            RLPVQ V+  LYY+Q  +R    D  S P A AT              N+L     L +E
Sbjct  431  RLPVQTVVQVLYYEQQSLREILSDSDSPPAAAATVEDTHPPPELSSYNNELS---KLNRE  487

Query  384  NEALRTELLQMKMFIADMQNkgssqgss-----vkgssasaVRKP-----TFFSSMSKKL  235
            N+ L+ EL+++KM   +++    +   +         S ++V KP     +F SS+S++L
Sbjct  488  NQELKLELIKVKMKFKELEKNQKAFEVTSGSDCSSSVSIASVVKPRLPRKSFMSSVSRQL  547

Query  234  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            GKLNPF  G K        +V    P+ RR SIS
Sbjct  548  GKLNPF--GQK--------QVQTKPPKGRRHSIS  571



>ref|XP_009115684.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Brassica rapa]
Length=566

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 108/188 (57%), Gaps = 18/188 (10%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA  + + +R  DD +YRAID+YLK HP + E+E++K+CS+M+  KLS EA  HA+QNK
Sbjct  368  GIAECIPEQSRITDDGIYRAIDMYLKVHPNISEVEKKKICSLMNSQKLSQEACAHAAQNK  427

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA---------TRNQLQADVT-LVKENEA  376
            RLPV IV   L+ +Q  +R    D  S   A A         T +    +++ L +EN+ 
Sbjct  428  RLPVHIVAQVLHQEQQSLRQVLCDSDSPVAATAIAPESPPPPTLSSYNNELSKLNRENQD  487

Query  375  LRTELLQMKMFIADMQ--------NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  220
            L+ ELL++KM + +++        +       S      S +R+ +F SS+S+KLGKLNP
Sbjct  488  LKLELLKVKMTLKELEREKDFEIKSCSDCSSVSTASVVKSPLRRKSFISSVSRKLGKLNP  547

Query  219  FKHGSKDT  196
            F H  + T
Sbjct  548  FGHTQRRT  555



>ref|XP_009115683.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Brassica rapa]
Length=567

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 108/188 (57%), Gaps = 18/188 (10%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA  + + +R  DD +YRAID+YLK HP + E+E++K+CS+M+  KLS EA  HA+QNK
Sbjct  369  GIAECIPEQSRITDDGIYRAIDMYLKVHPNISEVEKKKICSLMNSQKLSQEACAHAAQNK  428

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA---------TRNQLQADVT-LVKENEA  376
            RLPV IV   L+ +Q  +R    D  S   A A         T +    +++ L +EN+ 
Sbjct  429  RLPVHIVAQVLHQEQQSLRQVLCDSDSPVAATAIAPESPPPPTLSSYNNELSKLNRENQD  488

Query  375  LRTELLQMKMFIADMQ--------NkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNP  220
            L+ ELL++KM + +++        +       S      S +R+ +F SS+S+KLGKLNP
Sbjct  489  LKLELLKVKMTLKELEREKDFEIKSCSDCSSVSTASVVKSPLRRKSFISSVSRKLGKLNP  548

Query  219  FKHGSKDT  196
            F H  + T
Sbjct  549  FGHTQRRT  556



>ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
Length=617

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 124/206 (60%), Gaps = 20/206 (10%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCSVMD  KLS EA  HA+QN R
Sbjct  416  LAELIPEQSRPTEDGMYRAIDIYLKAHPALSDMERKKVCSVMDCQKLSREACAHAAQNDR  475

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR-NQLQADV--------TLVKENEALR  370
            LPVQ V+  LYY+Q ++R       S  +++ ++ N   +D+        TL +EN+ L+
Sbjct  476  LPVQTVVQVLYYEQQRLRDAMNGNGSGESSVDSKLNVYSSDLQPASNELSTLRRENQDLK  535

Query  369  TELLQMKMFIADMQNkg-ssqgssvkgssasaVRKP-----TFFSSMSKKLGKLNPFKHG  208
             EL+++K  + +++     S  +S   S++ +  KP     +F SS+SKKLG+L+PF   
Sbjct  536  LELVKLKRRLKEIETTTPKSAVNSPAVSASPSADKPPLPRRSFMSSVSKKLGRLSPFVR-  594

Query  207  SKDTSNLDDGEVDITKP-RRRRFSIS  133
            +   +    G    TKP + RR SIS
Sbjct  595  ADGVAPFAKGR---TKPNKNRRHSIS  617



>ref|XP_004149698.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=621

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 113/208 (54%), Gaps = 23/208 (11%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  417  LAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVCSLMDCQKLSREACAHAAQNDR  476

Query  522  LPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV-------------TLV  391
            LPVQ V+  LYY+Q ++R   +G+      P   A  N   A+               L 
Sbjct  477  LPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPAVPAKLNIYSAETAAAAAHPVSDELSILR  536

Query  390  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP----TFFSSMSKKLGKLN  223
            +EN+ L+ EL++MKM + + +    S   +      +A + P    +F +S+SK+LG+L 
Sbjct  537  RENQDLKLELVKMKMKMREFEKPSISSPQTNTQLQPNAEKPPLPKKSFINSVSKRLGRLY  596

Query  222  PFKHGSKDTSNLDDGEVDITKPRRRRFS  139
            PF      TS    G V   K RR   S
Sbjct  597  PFVRADGVTSK---GRVRPAKDRRHSIS  621



>ref|XP_009379312.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Pyrus x bretschneideri]
Length=505

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 113/205 (55%), Gaps = 16/205 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  301  GIAELIPEQSRATEDGMYRAIDIYLKAHPALSDMERKKVCSMMDCQKLSREASAHAAQND  360

Query  525  RLPVQIVLHALYYDQLKIRS------GAEDP--KSTPNAIATRNQLQAD--VTLVKENEA  376
            RLPV  V+  LYY+Q ++R       G E     S  +  +T   +  D    L ++NE 
Sbjct  361  RLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVYSTDVHMVPDELTILRRQNEE  420

Query  375  LRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPFK  214
            L+ EL +MKM + +++   +    S   G++  +  KP     +F + +SK+LGKL+PF 
Sbjct  421  LKIELGKMKMKLKELETSTARTAMSSPMGNTPISADKPPLPRKSFMNLVSKRLGKLSPFV  480

Query  213  HGSKDTSNLDDGEVDITKPRRRRFS  139
                 T     G     K RR   S
Sbjct  481  RADGVTPTGTKGRTKSAKDRRHSIS  505



>gb|ACL53070.1| unknown [Zea mays]
 tpg|DAA43884.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=500

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 100/177 (56%), Gaps = 13/177 (7%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
             G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC VMD  KLS EA  HA+QN
Sbjct  298  TGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKTVCRVMDCQKLSREACAHAAQN  357

Query  528  KRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD--VTLVKENEA  376
             RLPVQ V+  L+++Q ++R        G E P   P+      +   D    L +ENE 
Sbjct  358  NRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSVPDEMSQLQRENEE  417

Query  375  LRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  217
            L+ ELL++KM + D     Q+  +           +A     F +++SKKLG+LNPF
Sbjct  418  LKMELLRLKMNLRDPSAPPQHSDAPPSGRRPLPKKAAGGSGGFINNVSKKLGRLNPF  474



>ref|XP_002989054.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
 gb|EFJ09848.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
Length=607

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 120/225 (53%), Gaps = 38/225 (17%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A L+ + +R V+D LYRA+DI+LKAHP L E +R+++C +MDP +LS EA  HA+QN+
Sbjct  387  ALAELLPEHSRMVEDGLYRAVDIFLKAHPLLVEADRKRICKLMDPQRLSQEACSHAAQNE  446

Query  525  RLPVQIVLHALYYDQLKIRS-----GAEDPKS----TPNAIATRNQLQADV---------  400
            RLP   ++  LY++QL+I++       E PK     TP A A R+   A           
Sbjct  447  RLPAHFIIQVLYFEQLRIKTALANYAIEMPKGDHGPTPIAAALRSSTAAANAAAAAAAAA  506

Query  399  -------TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT-------  262
                    L +EN+ L+ EL +MK+ ++D++ + S   S        +    +       
Sbjct  507  ADANPQSALRRENKELKIELTRMKIRLSDLEKEQSPGVSRASEEKRLSSPTSSAASSPGS  566

Query  261  --FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
              FF ++S++LGKLNPF   S           ++ KPRRRR SIS
Sbjct  567  GRFFHTVSRRLGKLNPFGKSSLKPP----ATPELQKPRRRRHSIS  607



>gb|KFK28391.1| hypothetical protein AALP_AA8G509000 [Arabis alpina]
Length=604

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 112/190 (59%), Gaps = 30/190 (16%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  396  GLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQND  455

Query  525  RLPVQIVLHALYYDQLKIR--------SGAEDPKSTPNAI------ATRNQLQADVTLVK  388
            RLPVQ ++  LYY+Q ++R        S A  P     A+      +  ++L     L +
Sbjct  456  RLPVQTIVQVLYYEQQRLRGEVTNDSESSAPQPPQQATAVLPPKLSSYNDELS---KLKR  512

Query  387  ENEALRTELLQMKMFIADMQNkgssqgssvkgs-------sasaVRKP------TFFSSM  247
            EN+ L+ ELL+MKM + + + +   +  S   S       S +++ KP      +F +S+
Sbjct  513  ENQDLKLELLKMKMKLKEFEKESDKKSVSTTMSSIPGSPMSTASMDKPPLPPKKSFINSV  572

Query  246  SKKLGKLNPF  217
            SKKLGKLNPF
Sbjct  573  SKKLGKLNPF  582



>ref|XP_002983725.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
 gb|EFJ15221.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
Length=604

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 120/222 (54%), Gaps = 35/222 (16%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A ++ + +R V+D LYRA+DI+LKAHP L E +R+++C +MDP +LS EA  HA+QN+
Sbjct  387  ALAEVLPEHSRMVEDGLYRAVDIFLKAHPLLVEADRKRICKLMDPQRLSQEACSHAAQNE  446

Query  525  RLPVQIVLHALYYDQLKIRS-----GAEDPKS----TPNAIATRNQLQADV---------  400
            RLP   ++  LY++QL+I++       E PK     TP A A R+   A           
Sbjct  447  RLPAHFIIQVLYFEQLRIKTALANYAIEMPKGDHGPTPIAAALRSSTAAANAAAAAAADA  506

Query  399  ----TLVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPT---------F  259
                 L +EN+ L+ EL +MK+ ++D++ + S   S        +    +         F
Sbjct  507  NPQSALRRENKELKIELTRMKIRLSDLEKEQSPGVSRASEEKRLSSPTSSAASSPGSGRF  566

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            F ++S++LGKLNPF   S           ++ KPRRRR SIS
Sbjct  567  FYTVSRRLGKLNPFGKSSLKPP----ATPELQKPRRRRHSIS  604



>ref|XP_009782405.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
sylvestris]
Length=620

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 107/180 (59%), Gaps = 21/180 (12%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A ++ + A+  +D +YRAIDIYLKAHP L ++ER+KVC VMD  KLS EA  HA+QN R
Sbjct  417  LAEVIPEQAKITEDGMYRAIDIYLKAHPALSDMERKKVCGVMDCQKLSREACAHAAQNDR  476

Query  522  LPVQIVLHALYYDQLKIRS---GAEDPKSTPNAI--ATRNQLQADV--------TLVKEN  382
            LPVQ V+  LYY+Q ++R    G++   + P A+  +  NQ   D+        +L +EN
Sbjct  477  LPVQTVVQVLYYEQQRLREVMDGSQLVATEPPALIPSKTNQFSTDIRPISDEVSSLKREN  536

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssasaV-------RKPT-FFSSMSKKLGKL  226
            + L+ ELL+MKM + +++   +   +S                RKP+ F SS+SKKLGK 
Sbjct  537  QELKFELLKMKMRLKEIEKPSNKSATSSPLVITHPSADKPPLPRKPSNFISSVSKKLGKF  596



>ref|XP_009379310.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Pyrus x bretschneideri]
Length=625

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 113/205 (55%), Gaps = 16/205 (8%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  421  GIAELIPEQSRATEDGMYRAIDIYLKAHPALSDMERKKVCSMMDCQKLSREASAHAAQND  480

Query  525  RLPVQIVLHALYYDQLKIRS------GAEDP--KSTPNAIATRNQLQAD--VTLVKENEA  376
            RLPV  V+  LYY+Q ++R       G E     S  +  +T   +  D    L ++NE 
Sbjct  481  RLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVYSTDVHMVPDELTILRRQNEE  540

Query  375  LRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPFK  214
            L+ EL +MKM + +++   +    S   G++  +  KP     +F + +SK+LGKL+PF 
Sbjct  541  LKIELGKMKMKLKELETSTARTAMSSPMGNTPISADKPPLPRKSFMNLVSKRLGKLSPFV  600

Query  213  HGSKDTSNLDDGEVDITKPRRRRFS  139
                 T     G     K RR   S
Sbjct  601  RADGVTPTGTKGRTKSAKDRRHSIS  625



>tpg|DAA43883.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=597

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 100/177 (56%), Gaps = 13/177 (7%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
             G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC VMD  KLS EA  HA+QN
Sbjct  395  TGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKTVCRVMDCQKLSREACAHAAQN  454

Query  528  KRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD--VTLVKENEA  376
             RLPVQ V+  L+++Q ++R        G E P   P+      +   D    L +ENE 
Sbjct  455  NRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSVPDEMSQLQRENEE  514

Query  375  LRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  217
            L+ ELL++KM + D     Q+  +           +A     F +++SKKLG+LNPF
Sbjct  515  LKMELLRLKMNLRDPSAPPQHSDAPPSGRRPLPKKAAGGSGGFINNVSKKLGRLNPF  571



>dbj|BAK07863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=613

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 88/227 (39%), Positives = 117/227 (52%), Gaps = 40/227 (18%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
             G+A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC VMD  KLS EA  HA+QN
Sbjct  392  TGLAELIPERARFNEDGMYRAIDIYLKAHPSLGEGERKKVCGVMDCQKLSREACAHAAQN  451

Query  528  KRLPVQIVLHALYYDQLKIR--------------SGAEDP----KSTPNAIA-TRNQLQA  406
             RLPVQ V+  LY++Q ++R              +G E P    K TP+     R+   +
Sbjct  452  DRLPVQTVVQVLYHEQRRLRVPPPSQAPSGAPSYAGGESPALSYKPTPSFNGRERSAPSS  511

Query  405  DVT-LVKENEALRTELLQMKMFIAD---MQNkgssqgssvkgssasaVRKPTF-------  259
            +V+ L +EN+ LR EL+QMKM + D        +   ++    S+ A  KP         
Sbjct  512  EVSRLQRENDELRMELMQMKMRLRDPSGAAPAAAPPLAAGATRSSPASGKPPLPKKQGGA  571

Query  258  -----FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
                      KKLG+LNPF         L  G+V    P+ RR SIS
Sbjct  572  SGGGGGGGFMKKLGRLNPFVR-----DPLAGGKVRTKPPKDRRHSIS  613



>ref|XP_006426057.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
 gb|ESR39297.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
Length=623

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 113/184 (61%), Gaps = 26/184 (14%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  418  LAELIPEQSRITEDGMYRAIDIYLKAHPTLSDMERKKVCSLMDCQKLSREACAHAAQNDR  477

Query  522  LPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQLQADV--------TLVK  388
            LPVQ V+  LY++Q +IR       +G + P + P+ I   N   AD+        +L +
Sbjct  478  LPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI---NLYSADLHPVSNELSSLRR  533

Query  387  ENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----TFFSSMSKKLGK  229
            ENE L+ ELL+MKM + +++   +   ++     ++  +  KP     +F +S+SKKLG+
Sbjct  534  ENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYSADKPPLPRKSFINSVSKKLGR  593

Query  228  LNPF  217
            L PF
Sbjct  594  LYPF  597



>gb|KDO78972.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=623

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 113/184 (61%), Gaps = 26/184 (14%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  418  LAELIPEQSRITEDGMYRAIDIYLKAHPTLSDMERKKVCSLMDCQKLSREACAHAAQNDR  477

Query  522  LPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQLQADV--------TLVK  388
            LPVQ V+  LY++Q +IR       +G + P + P+ I   N   AD+        +L +
Sbjct  478  LPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI---NLYSADLHPVSNELSSLRR  533

Query  387  ENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----TFFSSMSKKLGK  229
            ENE L+ ELL+MKM + +++   +   ++     ++  +  KP     +F +S+SKKLG+
Sbjct  534  ENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYSADKPPLPRKSFINSVSKKLGR  593

Query  228  LNPF  217
            L PF
Sbjct  594  LYPF  597



>ref|XP_006466487.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Citrus 
sinensis]
Length=623

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 113/184 (61%), Gaps = 26/184 (14%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  418  LAELIPEQSRITEDGMYRAIDIYLKAHPTLSDMERKKVCSLMDCQKLSREACAHAAQNDR  477

Query  522  LPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQLQADV--------TLVK  388
            LPVQ V+  LY++Q +IR       +G + P + P+ I   N   AD+        +L +
Sbjct  478  LPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP-AVPSKI---NLYSADLHPVSNELSSLRR  533

Query  387  ENEALRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----TFFSSMSKKLGK  229
            ENE L+ ELL+MKM + +++   +   ++     ++  +  KP     +F +S+SKKLG+
Sbjct  534  ENEDLKIELLKMKMKLKEIEKSSAKSSAASSPLVNAQYSADKPPLPRKSFINSVSKKLGR  593

Query  228  LNPF  217
            L PF
Sbjct  594  LYPF  597



>dbj|BAF95168.1| similar to ROOT PHOTOTROPISM2 protein binding [Ipomoea nil]
Length=71

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = -2

Query  342  IADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  163
            IADMQNKGSSQGSSVKGSSASAVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT
Sbjct  2    IADMQNKGSSQGSSVKGSSASAVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  61

Query  162  KPRRRRFSIS  133
            KPRRRRFSIS
Sbjct  62   KPRRRRFSIS  71



>ref|XP_006339816.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=596

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 104/176 (59%), Gaps = 17/176 (10%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A ++ + AR  +D +YRAIDIYLKAHP L +IER+KVC VMD  KLS EA  HA+QN R
Sbjct  397  LAEVIPEQARITEDGMYRAIDIYLKAHPVLSDIERKKVCGVMDCQKLSREACAHAAQNDR  456

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA--------TRNQLQADV-TLVKENEALR  370
            LPVQ V+  LYY+Q ++  G++   + P A+         + N +  +V +L +EN+ L+
Sbjct  457  LPVQTVVQVLYYEQQRLHDGSQLVATEPPALVPSKRDHQFSTNPVSDEVSSLKRENQELK  516

Query  369  TELLQMKMFIADMQNkgssqgssvkgssas--------aVRKPTFFSSMSKKLGKL  226
             ELL+MK  + D++    +  ++      +          RK  F SS+SKKLG+ 
Sbjct  517  FELLKMKTRLIDIEKPNLNTSATSSPLVITHPSAGKPPLPRKSNFMSSVSKKLGRF  572



>ref|XP_004231910.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
lycopersicum]
Length=596

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 109/185 (59%), Gaps = 20/185 (11%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A ++ + AR  +D +YRAIDIYLKAHP L +IER+KVC +MD  KLS EA  HA+QN R
Sbjct  397  LAEVIPEQARITEDGMYRAIDIYLKAHPALSDIERKKVCGIMDCQKLSREACAHAAQNDR  456

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR--------NQLQADV-TLVKENEALR  370
            LPVQ V+  LYY+Q ++ +G++   + P A+ +         N +  +V +L +EN+ L+
Sbjct  457  LPVQTVVQVLYYEQQRLHNGSQLVATEPPALVSSKRDDQFSTNPVSDEVSSLKRENQELK  516

Query  369  TELLQMKMFIADMQNkgssqgssvkgssasa--------VRKPTFFSSMSKKLGKL---N  223
             ELL+MK  + +++   S+  +S      +          RK  F SS+SKKLG+    +
Sbjct  517  FELLKMKTRLIEIEKPKSNTSASSSPLVITQPSAGKPPLPRKSNFMSSVSKKLGRFIRAD  576

Query  222  PFKHG  208
               HG
Sbjct  577  GLTHG  581



>emb|CDY37857.1| BnaAnng05180D [Brassica napus]
Length=600

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 119/220 (54%), Gaps = 39/220 (18%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
             G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN
Sbjct  392  TGLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQN  451

Query  528  KRLPVQIVLHALYYDQLKIRSGAEDPKST--------------PNAIATRNQLQADVTLV  391
             RLPVQ ++  LYY+Q ++R    +   +              P  +++ N   + V   
Sbjct  452  DRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPTATVLPPPKLSSYNDELSKVK--  509

Query  390  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP--------------TFFS  253
            +EN+ L+ ELL+MKM + + + + + + SS   + +S    P              +F +
Sbjct  510  RENQDLKLELLKMKMKLKEFEKENNEKKSSTTTTMSSNHSSPRSTASMDKPPLPRKSFIN  569

Query  252  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            S+SKKLGKLNPF    +  +           P+ RR SIS
Sbjct  570  SVSKKLGKLNPFGIPPRGRTK---------PPKDRRHSIS  600



>gb|ACL52494.1| unknown [Zea mays]
Length=597

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 99/177 (56%), Gaps = 13/177 (7%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
             G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC VMD  KLS EA  HA+QN
Sbjct  395  TGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKTVCRVMDCQKLSREACAHAAQN  454

Query  528  KRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD--VTLVKENEA  376
             RLPVQ V+  L+++Q ++R        G E P   P+      +   D    L +ENE 
Sbjct  455  NRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSVPDEMSQLQRENEE  514

Query  375  LRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  217
            L+ ELL++KM + D     Q   +           +A     F +++SKKLG+LNPF
Sbjct  515  LKMELLRLKMNLRDPSAPPQPSDAPPSGRRPLPKKAAGGSGGFINNVSKKLGRLNPF  571



>ref|XP_008368005.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=232

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 113/208 (54%), Gaps = 20/208 (10%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD   LS EA  HA+QN 
Sbjct  28   GIAELIPEQSRATEDGMYRAIDIYLKAHPALSDMERKKVCSMMDCQXLSREACXHAAQND  87

Query  525  RLPVQIVLHALYYDQLKIRS------GAED----PKSTPNAIATRNQLQADVTLVKENEA  376
            RLPV  V+  LYY+Q ++R       G E      K + ++            L ++N  
Sbjct  88   RLPVHTVVQVLYYEQQRLRDVMNGNIGGESSVLPSKGSVHSTDIHTVPDELTILRRQNAE  147

Query  375  LRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLNPFK  214
            L+ EL++MKM + +++        S   G++  +  KP     +F + +SK+LG L+PF 
Sbjct  148  LKIELVKMKMKLKELETSTMRTAMSSPMGNTPISADKPPLPRKSFMNLVSKRLGXLSPFV  207

Query  213  HGSKDTSNLDDGEVDITKPRR-RRFSIS  133
                 T     G    TKP + RR SIS
Sbjct  208  RADGVTPTGTKGR---TKPSKDRRHSIS  232



>gb|KFK34271.1| hypothetical protein AALP_AA5G123300 [Arabis alpina]
Length=551

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 113/197 (57%), Gaps = 20/197 (10%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A  + + +R  +D +YRAIDIYLKAHP + E+E++KVCS+MD  KLS EA  HA+QN 
Sbjct  369  GLAECIPEQSRITEDGMYRAIDIYLKAHPNISEVEKKKVCSLMDCNKLSQEASAHAAQND  428

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKM  346
            RL VQ V+  L+Y+Q  +R    D  S P A    ++L     L +EN+ L+ ELL++KM
Sbjct  429  RLHVQTVVKVLHYEQQSLRQILRDTDS-PAAYNNDDELS---QLNRENQELKLELLKVKM  484

Query  345  ------FIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLD  184
                       +   SS  S V  +S    R+ +F S +S+KLGKLNPF        ++ 
Sbjct  485  NFKEFEEEKTFEVMSSSDYSLVSIASVVKPRRKSFISYVSRKLGKLNPF--------SMT  536

Query  183  DGEVDITKPRRRRFSIS  133
             G   I  P+ RR SIS
Sbjct  537  QGR--IIPPKGRRHSIS  551



>gb|EPS72379.1| hypothetical protein M569_02379, partial [Genlisea aurea]
Length=583

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 102/168 (61%), Gaps = 18/168 (11%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            ++ L+   +R  +D +YRAIDIYLKAHP L + ER+ VCSVMD  KLS EA  HA+QN R
Sbjct  398  LSELIPDRSRATEDGMYRAIDIYLKAHPGLSDTERKTVCSVMDCQKLSREACAHAAQNDR  457

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD----VTLVKENEALRTELLQ  355
            LPVQ V+  LYY+Q ++R   +  +S+P A A   +   D      L +EN  L+ E+L+
Sbjct  458  LPVQTVVQVLYYEQQRLREAVDGGESSPAAAAAAAKGSPDSEEVAFLRRENRELKMEVLR  517

Query  354  MKMFIADMQNkgssqgssvkgssasaVRKP-----TFFSSMSKKLGKL  226
            +KM + + +            ++AS VRKP     +F SS+S+KLGKL
Sbjct  518  LKMKLKEWET---------PAAAASVVRKPPLPKKSFMSSVSQKLGKL  556



>emb|CAN71562.1| hypothetical protein VITISV_007563 [Vitis vinifera]
Length=621

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 120/222 (54%), Gaps = 35/222 (16%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVCS+MD  KLS EA  HA+QN R
Sbjct  403  LAELLPEQSRVKEDGMYRAIDIYLKAHPSLSDMEKKKVCSLMDCQKLSREACAHAAQNDR  462

Query  522  LPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQ--AD--VTLVKENEA  376
            LPVQ V+  LYY+Q ++R        G E P   P +    N L   +D  ++L +ENE 
Sbjct  463  LPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNLFSNDLHPVSDELLSLRRENED  522

Query  375  LRTELLQMKM---------------------FIADMQNkgssqgssvkgssasaVRKPTF  259
            L+ EL++MKM                     + + +Q+  SS  ++   +    + + +F
Sbjct  523  LKLELMKMKMRLKEIEKSAVPSGVPTSLPSAYSSILQSAASSPRNTPPSADKPPLPRKSF  582

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
             +S+SK+LG+L PF           DG+      R RR SIS
Sbjct  583  MNSVSKRLGRLYPFVRADGVAP---DGKARTKPSRDRRHSIS  621



>ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Vitis 
vinifera]
Length=636

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 120/222 (54%), Gaps = 35/222 (16%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVCS+MD  KLS EA  HA+QN R
Sbjct  418  LAELLPEQSRVKEDGMYRAIDIYLKAHPSLSDMEKKKVCSLMDCQKLSREACAHAAQNDR  477

Query  522  LPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQ--AD--VTLVKENEA  376
            LPVQ V+  LYY+Q ++R        G E P   P +    N L   +D  ++L +ENE 
Sbjct  478  LPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNLFSNDLHPVSDELLSLRRENED  537

Query  375  LRTELLQMKM---------------------FIADMQNkgssqgssvkgssasaVRKPTF  259
            L+ EL++MKM                     + + +Q+  SS  ++   +    + + +F
Sbjct  538  LKLELMKMKMRLKEIEKSAVPSGVPTSLPSAYSSILQSAASSPRNTPPSADKPPLPRKSF  597

Query  258  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
             +S+SK+LG+L PF           DG+      R RR SIS
Sbjct  598  MNSVSKRLGRLYPFVRADGVAP---DGKARTKPSRDRRHSIS  636



>ref|XP_006393938.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
 gb|ESQ31224.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
Length=603

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 107/186 (58%), Gaps = 26/186 (14%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  399  GLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQND  458

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKST-----------PNAIATRNQLQADVTLVKENE  379
            RLPVQ ++  LYY+Q ++R    +   +           P  +++ N   +   L +EN+
Sbjct  459  RLPVQTIVQVLYYEQQRLRGEVTNDSDSPPPPPPPATVLPPKLSSYNDELSK--LKRENQ  516

Query  378  ALRTELLQMKMFI------------ADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
             L+ ELL+MKM +              M +  SS  S+         RK TF +S+S+KL
Sbjct  517  DLKLELLKMKMKLKEFEKESEKKSSTTMSSNPSSPISTASMDKPPLPRK-TFINSVSRKL  575

Query  234  GKLNPF  217
            GKLNPF
Sbjct  576  GKLNPF  581



>ref|XP_004511860.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X4 [Cicer arietinum]
 ref|XP_004511861.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X5 [Cicer arietinum]
Length=628

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 111/186 (60%), Gaps = 25/186 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  419  LAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVCSMMDCQKLSREACAHAAQNDR  478

Query  522  LPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQAD----------VTLVKEN  382
            LPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D            L +EN
Sbjct  479  LPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDTQFHPVSNEITGLRREN  537

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------KP-----TFFSSMSKKL  235
            E L+ EL+++KM + +++       ++V  S +          KP     +F SS+SKKL
Sbjct  538  EDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADKPPLPRRSFISSVSKKL  597

Query  234  GKLNPF  217
            GKL+PF
Sbjct  598  GKLSPF  603



>ref|XP_004511862.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X6 [Cicer arietinum]
Length=627

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 111/186 (60%), Gaps = 25/186 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  418  LAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVCSMMDCQKLSREACAHAAQNDR  477

Query  522  LPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQAD----------VTLVKEN  382
            LPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D            L +EN
Sbjct  478  LPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDTQFHPVSNEITGLRREN  536

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------KP-----TFFSSMSKKL  235
            E L+ EL+++KM + +++       ++V  S +          KP     +F SS+SKKL
Sbjct  537  EDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADKPPLPRRSFISSVSKKL  596

Query  234  GKLNPF  217
            GKL+PF
Sbjct  597  GKLSPF  602



>dbj|BAJ34215.1| unnamed protein product [Thellungiella halophila]
Length=603

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 107/186 (58%), Gaps = 26/186 (14%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  399  GLAELIPEQSRITEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQND  458

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKST-----------PNAIATRNQLQADVTLVKENE  379
            RLPVQ ++  LYY+Q ++R    +   +           P  +++ N   +   L +EN+
Sbjct  459  RLPVQTIVQVLYYEQQRLRGEVTNDSDSPPPPPPPATVLPPKLSSYNDELSK--LKRENQ  516

Query  378  ALRTELLQMKMFI------------ADMQNkgssqgssvkgssasaVRKPTFFSSMSKKL  235
             L+ ELL+MKM +              M +  SS  S+         RK TF +S+S+KL
Sbjct  517  DLKLELLKMKMKLKEFEKESEKKSSTTMSSNPSSPISTASMDKPPLPRK-TFINSVSRKL  575

Query  234  GKLNPF  217
            GKLNPF
Sbjct  576  GKLNPF  581



>ref|XP_004509079.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509080.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=598

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 119/210 (57%), Gaps = 22/210 (10%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A L+ + +R  +D +YRAIDIYLKAHP L + +R+KVCS+MD  KLS EAR HA+QN 
Sbjct  392  SLAELIPEQSRTTEDGMYRAIDIYLKAHPFLSDTDRKKVCSMMDCQKLSREARAHAAQNN  451

Query  525  RLPVQIVLHALYYDQLKIRS--------GAEDPKSTPNAIATRNQL---QADVT-LVKEN  382
            RLPVQ V   LYYDQ + R+        G+E P +  N     ++L     +V+ L +EN
Sbjct  452  RLPVQSVAQVLYYDQQRRRNDMDGIGSVGSESPLTPENRNVYSSELYPVSNEVSKLRREN  511

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssasa-------VRKPTFFSSMSKKLGKLN  223
            E L+ E+ ++ M I + +        S    + ++       + K +F +S+S+KLG+L+
Sbjct  512  EELKLEIAKLTMKIKESEKCKLESAVSSPLLNVTSPSADKPPLHKKSFLNSVSRKLGRLS  571

Query  222  PFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            PF       ++  D    + + + RRFSIS
Sbjct  572  PFSRQDPVITHPKD---PVKQDKIRRFSIS  598



>gb|KEH27511.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=516

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 109/191 (57%), Gaps = 29/191 (15%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A L+ + ++  +D +YRA+DIYLKAHP L ++ER+KVCS+MD  +LS EA  HA+QN 
Sbjct  303  SLAELIPEQSKPTEDGMYRALDIYLKAHPNLSDMERKKVCSIMDCQRLSREACAHAAQND  362

Query  525  RLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV-------TLVKENEA  376
            RLPVQ V+  LYY+Q ++R   +G+E  +S P+     N    D+       +L +ENE 
Sbjct  363  RLPVQTVVQVLYYEQQRLRDAMNGSETAES-PSIHTKLNVYSGDIQVSNELTSLRRENED  421

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssas-------------aVRKP-----TFFSS  250
            L+ E++++KM + +++             S               +  KP     +F SS
Sbjct  422  LKLEVVKLKMKLKEIEISTLKSTVKSTVKSTVNSPIANASPSHSHSADKPPLPRKSFISS  481

Query  249  MSKKLGKLNPF  217
            +SKKLGKL+PF
Sbjct  482  VSKKLGKLSPF  492



>ref|XP_008457767.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis melo]
Length=620

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 115/210 (55%), Gaps = 25/210 (12%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  414  LAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVCSLMDCQKLSREACAHAAQNDR  473

Query  522  LPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV-------------TLV  391
            LPVQ V+  LYY+Q ++R   +G+      P   A  +   A+               L 
Sbjct  474  LPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPTVPAKLSIYSAETAAAAAHPVSDELSILR  533

Query  390  KENEALRTELLQMKMFIADMQN-kgssqgssvkgssasaVRKP-----TFFSSMSKKLGK  229
            +EN+ L+ EL++MKM + + +    SS  ++ +    +   KP     +F +S+SK+LG+
Sbjct  534  RENQDLKLELVKMKMKMREFEKPSISSPQTNTRLQPTTTAEKPPLPKKSFINSVSKRLGR  593

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
            L PF      TS    G V   K RR   S
Sbjct  594  LYPFVRADGVTSK---GRVRPAKDRRHSIS  620



>ref|XP_008457766.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis melo]
Length=621

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 79/210 (38%), Positives = 115/210 (55%), Gaps = 25/210 (12%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  415  LAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVCSLMDCQKLSREACAHAAQNDR  474

Query  522  LPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV-------------TLV  391
            LPVQ V+  LYY+Q ++R   +G+      P   A  +   A+               L 
Sbjct  475  LPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPTVPAKLSIYSAETAAAAAHPVSDELSILR  534

Query  390  KENEALRTELLQMKMFIADMQN-kgssqgssvkgssasaVRKP-----TFFSSMSKKLGK  229
            +EN+ L+ EL++MKM + + +    SS  ++ +    +   KP     +F +S+SK+LG+
Sbjct  535  RENQDLKLELVKMKMKMREFEKPSISSPQTNTRLQPTTTAEKPPLPKKSFINSVSKRLGR  594

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFS  139
            L PF      TS    G V   K RR   S
Sbjct  595  LYPFVRADGVTSK---GRVRPAKDRRHSIS  621



>ref|XP_004511859.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X3 [Cicer arietinum]
Length=678

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 111/186 (60%), Gaps = 25/186 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  469  LAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVCSMMDCQKLSREACAHAAQNDR  528

Query  522  LPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQAD----------VTLVKEN  382
            LPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D            L +EN
Sbjct  529  LPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDTQFHPVSNEITGLRREN  587

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------KP-----TFFSSMSKKL  235
            E L+ EL+++KM + +++       ++V  S +          KP     +F SS+SKKL
Sbjct  588  EDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADKPPLPRRSFISSVSKKL  647

Query  234  GKLNPF  217
            GKL+PF
Sbjct  648  GKLSPF  653



>ref|XP_004511857.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511858.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=679

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 111/186 (60%), Gaps = 25/186 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + ++  +D +YRA DI+LKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  470  LAELIPEQSKPTEDGMYRATDIFLKAHPNLSDMERKKVCSMMDCQKLSREACAHAAQNDR  529

Query  522  LPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQAD----------VTLVKEN  382
            LPVQ V+  LYY+Q ++R   +G E+ +S P+A A  N    D            L +EN
Sbjct  530  LPVQTVVQVLYYEQQRLRDAMNGNENVES-PSANAKLNVYSGDTQFHPVSNEITGLRREN  588

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssasaVR------KP-----TFFSSMSKKL  235
            E L+ EL+++KM + +++       ++V  S +          KP     +F SS+SKKL
Sbjct  589  EDLKLELVKLKMKLKEIEKSTVKVKATVINSPSVNSSPSGSADKPPLPRRSFISSVSKKL  648

Query  234  GKLNPF  217
            GKL+PF
Sbjct  649  GKLSPF  654



>ref|NP_001152299.1| transposon protein Mutator sub-class [Zea mays]
 gb|ACG46890.1| transposon protein Mutator sub-class [Zea mays]
Length=597

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 98/177 (55%), Gaps = 13/177 (7%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
             G+A ++ + AR  DD +YR+IDIYLKAHP L E ER+ VC VMD  KLS EA  HA+ N
Sbjct  395  TGLAEMIPERARFNDDGMYRSIDIYLKAHPYLSEAERKAVCRVMDCQKLSREACAHAAHN  454

Query  528  KRLPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQAD--VTLVKENEA  376
             RLPVQ V+  L+++Q ++R        G E P   P+      +   D    L +ENE 
Sbjct  455  NRLPVQTVVQVLHHEQRRLREAPTSSFYGGESPTPAPSLQGRHGRSVPDEMSQLQRENEE  514

Query  375  LRTELLQMKMFIAD----MQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  217
            L+ ELL++KM + D     Q   +           +A     F +++SKKLG+LNPF
Sbjct  515  LKMELLRLKMNLRDPSAPPQPSDAPPSGRRPLPKKAAGGSGGFINNVSKKLGRLNPF  571



>ref|NP_680473.2| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
 sp|Q66GP0.2|Y5738_ARATH RecName: Full=BTB/POZ domain-containing protein At5g67385 [Arabidopsis 
thaliana]
 gb|AED98336.1| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
Length=604

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/213 (37%), Positives = 117/213 (55%), Gaps = 28/213 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  398  GLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQND  457

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV----------KENEA  376
            RLPVQ ++  LYY+Q ++R    +   +P     +        L           +EN+ 
Sbjct  458  RLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPAAVLPPKLSSYTDELSKLKRENQD  517

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TFFSSMSKKLG  232
            L+ ELL+MKM + + + +   + SS   S+        ++  KP     +F +S+SKKLG
Sbjct  518  LKLELLKMKMKLKEFEKESEKKTSSSTISTNPSSPISTASTGKPPLPRKSFINSVSKKLG  577

Query  231  KLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            KLNPF      +    +G      P+ RR SIS
Sbjct  578  KLNPF------SITPYNGRGRTKPPKDRRHSIS  604



>gb|AAU05485.1| At5g67385 [Arabidopsis thaliana]
 gb|AAU95431.1| At5g67385 [Arabidopsis thaliana]
Length=604

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/213 (37%), Positives = 117/213 (55%), Gaps = 28/213 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  398  GLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQND  457

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV----------KENEA  376
            RLPVQ ++  LYY+Q ++R    +   +P     +        L           +EN+ 
Sbjct  458  RLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPAAVLPPKLSSYTDELSKLKRENQD  517

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TFFSSMSKKLG  232
            L+ ELL+MKM + + + +   + SS   S+        ++  KP     +F +S+SKKLG
Sbjct  518  LKLELLKMKMKLKEFEKESEKKTSSSTISTNPSSPISTASTGKPPLPRKSFINSVSKKLG  577

Query  231  KLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            KLNPF      +    +G      P+ RR SIS
Sbjct  578  KLNPF------SITPYNGRGRTKPPKDRRHSIS  604



>ref|XP_003597110.1| Root phototropism protein [Medicago truncatula]
 ref|XP_003611625.1| Root phototropism protein [Medicago truncatula]
 gb|AES94583.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 109/191 (57%), Gaps = 29/191 (15%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A L+ + ++  +D +YRA+DIYLKAHP L ++ER+KVCS+MD  +LS EA  HA+QN 
Sbjct  417  SLAELIPEQSKPTEDGMYRALDIYLKAHPNLSDMERKKVCSIMDCQRLSREACAHAAQND  476

Query  525  RLPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV-------TLVKENEA  376
            RLPVQ V+  LYY+Q ++R   +G+E  +S P+     N    D+       +L +ENE 
Sbjct  477  RLPVQTVVQVLYYEQQRLRDAMNGSETAES-PSIHTKLNVYSGDIQVSNELTSLRRENED  535

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssas-------------aVRKP-----TFFSS  250
            L+ E++++KM + +++             S               +  KP     +F SS
Sbjct  536  LKLEVVKLKMKLKEIEISTLKSTVKSTVKSTVNSPIANASPSHSHSADKPPLPRKSFISS  595

Query  249  MSKKLGKLNPF  217
            +SKKLGKL+PF
Sbjct  596  VSKKLGKLSPF  606



>ref|XP_010484509.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Camelina sativa]
Length=548

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 119/212 (56%), Gaps = 27/212 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  343  GLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQND  402

Query  525  RLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVT--------LVKENEAL  373
            RLPVQ ++  LYY+Q ++R     D  S          L   ++        L +EN+ L
Sbjct  403  RLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLPPKLSSYNDELSKLKRENQDL  462

Query  372  RTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TFFSSMSKKLGK  229
            + ELL+MKM + + + +   + SS   S+        +++ KP     +F +S+S+KLGK
Sbjct  463  KLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTASMDKPPLPRKSFINSVSRKLGK  522

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPF  G    S    G      P+ RR SIS
Sbjct  523  LNPF--GITPYS----GRGRTKPPKDRRHSIS  548



>ref|XP_004985270.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Setaria 
italica]
Length=614

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 118/222 (53%), Gaps = 35/222 (16%)
 Frame = -2

Query  708  NGIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN  529
             G+A ++ + AR  +D +YRAIDIYLKAHP L E ER+KVC  MD  KLS EA  HA+QN
Sbjct  397  TGLAEMIPERARFNEDGMYRAIDIYLKAHPHLSEPERKKVCKAMDCQKLSREACAHAAQN  456

Query  528  KRLPVQIVLHALYYDQLKIRS-------------GAEDP------KSTPNAIATRNQLQA  406
             RLPVQ V+  LY++Q ++R              G E P      K TP+ +    +  A
Sbjct  457  DRLPVQTVVQVLYHEQRRLREAPTHAPSGASSFYGGESPPPSLPYKPTPSLMGRHARGGA  516

Query  405  ----DVT-LVKENEALRTELLQMKMFIADMQN-kgssqgssvkgssasaVRKP----TFF  256
                +V+ L +EN+ L+ ELL++KM + D       +  +       S  +KP     F 
Sbjct  517  APAEEVSQLQRENDELKMELLRLKMRLRDPSAPLPPTGAAPPPSGRHSMPKKPGAGGGFM  576

Query  255  SSMSKKLGKLNPF-KHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +++SKKLGKLNPF +H +         +V    P+ RR SI 
Sbjct  577  NNVSKKLGKLNPFVRHDAMGVP-----KVRTKPPKDRRHSIG  613



>ref|XP_010464139.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Camelina 
sativa]
Length=603

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 119/212 (56%), Gaps = 27/212 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  398  GLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQND  457

Query  525  RLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVT--------LVKENEAL  373
            RLPVQ ++  LYY+Q ++R     D  S          L   ++        L +EN+ L
Sbjct  458  RLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLPPKLSSYNDELSKLKRENQDL  517

Query  372  RTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TFFSSMSKKLGK  229
            + ELL+MKM + + + +   + SS   S+        +++ KP     +F +S+S+KLGK
Sbjct  518  KLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTTSMDKPPLPRKSFINSVSRKLGK  577

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPF  G    S    G      P+ RR SIS
Sbjct  578  LNPF--GITPYS----GRGRTKPPKDRRHSIS  603



>ref|XP_010484507.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
 ref|XP_010484508.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
Length=603

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 119/212 (56%), Gaps = 27/212 (13%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  398  GLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQND  457

Query  525  RLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVT--------LVKENEAL  373
            RLPVQ ++  LYY+Q ++R     D  S          L   ++        L +EN+ L
Sbjct  458  RLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPAAAVLPPKLSSYNDELSKLKRENQDL  517

Query  372  RTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TFFSSMSKKLGK  229
            + ELL+MKM + + + +   + SS   S+        +++ KP     +F +S+S+KLGK
Sbjct  518  KLELLKMKMKLKEFEKESDKKSSSSTISTNPNSPISTASMDKPPLPRKSFINSVSRKLGK  577

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPF  G    S    G      P+ RR SIS
Sbjct  578  LNPF--GITPYS----GRGRTKPPKDRRHSIS  603



>gb|KDP32052.1| hypothetical protein JCGZ_12513 [Jatropha curcas]
Length=622

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 121/209 (58%), Gaps = 24/209 (11%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDI+LKAHP L +++R+KVCS+MD  KLS EA  HA+QN R
Sbjct  419  LAELIPEQSRITEDGMYRAIDIFLKAHPALSDMDRKKVCSLMDCQKLSREACAHAAQNDR  478

Query  522  LPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV--------TLVKENEA  376
            LPVQ V+  LYY+Q ++R   +G      +P      N   A +         L +ENE 
Sbjct  479  LPVQTVVQVLYYEQQRLRDVMNGNIIGGDSPALPQKMNLYSAGIPPVSDEISNLKRENED  538

Query  375  LRTELLQMKMFIADMQNkgssqgssvk--gssasaVRKP-----TFFSSMSKKLGKLNPF  217
            L+ EL++MKM + +++    S+ ++     +S  +  KP     +F +S+SK+LG+L PF
Sbjct  539  LKIELVKMKMRLKEIEKSAGSRSATNSPLSNSTPSADKPPLPRKSFINSVSKRLGRLYPF  598

Query  216  KHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
                 D+  +  G    TKP + RR SIS
Sbjct  599  VRAEGDS--IPKGR---TKPSKNRRHSIS  622



>ref|XP_009628088.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
tomentosiformis]
Length=620

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 105/180 (58%), Gaps = 21/180 (12%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A ++ + A+  +D +YRAIDIYLKAHP L ++ER+KVC VMD  KLS EA  HA+QN R
Sbjct  417  LAEVIPEQAKITEDGMYRAIDIYLKAHPALSDMERKKVCGVMDCQKLSREACAHAAQNDR  476

Query  522  LPVQIVLHALYYDQLKIRS---GAEDPKSTPNAI--ATRNQLQADV--------TLVKEN  382
            LPVQ V+  LYY+Q ++R    G++   + P  +  +  N    D+        +L +EN
Sbjct  477  LPVQTVVQVLYYEQQRLREVMDGSQLVATEPPTLIPSKTNHFSIDIPPVSDEVSSLKREN  536

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssasaV-------RKPT-FFSSMSKKLGKL  226
            + L+ ELL+MKM + +++   +   +S                RKP+ F SS+SKKLGK 
Sbjct  537  QELKFELLKMKMRLKEIEKPSNKSAASSPLVITHPSADKPPLPRKPSNFISSVSKKLGKF  596



>ref|XP_007155848.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 ref|XP_007155849.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27842.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27843.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
Length=591

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 120/211 (57%), Gaps = 28/211 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ +  R  +D +YRAIDIYLKAHP L + E++KVCSVMD  KLS +A  HA+QN R
Sbjct  388  LAELIPQLYRSTEDGMYRAIDIYLKAHPILSDTEKKKVCSVMDCQKLSRDACAHAAQNDR  447

Query  522  LPVQIVLHALYYDQLKIRS------GAEDPKS-------TPNAI-ATRNQLQADVTLVKE  385
            LPVQ V+  LYY+Q ++R       G + P +       +PN +    N+      L +E
Sbjct  448  LPVQTVVQVLYYEQQRLRDSVDGSVGWDSPNNFRDKANLSPNGLNPVSNEFS---NLRRE  504

Query  384  NEALRTELLQMKMFIADMQNkgssqgssv-kgssasaVRKP-----TFFSSMSKKLGKLN  223
            NE L+ E++++KM + +++       SS     ++ +  KP     +F +S+SKKLG+L+
Sbjct  505  NEELKLEIVKLKMKLKEIERSSLISASSSPVIYASPSADKPPLPRKSFMNSVSKKLGRLS  564

Query  222  PFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  133
            PF      T N   G V   KP + RR SIS
Sbjct  565  PFSRAGAAT-NPVKGRV---KPDKNRRHSIS  591



>ref|XP_010426528.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 115/215 (53%), Gaps = 38/215 (18%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G A  + K +R  +D +Y AIDIYLK HP + E+E++KVC +MD  KLS E   HA+QN 
Sbjct  371  GFAECIPKQSRITEDGMYLAIDIYLKTHPNISEMEKKKVCKLMDSQKLSREKCAHAAQND  430

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-------------RNQLQADVTLVKE  385
            RLPVQ V+  LYY+Q  +R    D  S P A AT              N+L     L +E
Sbjct  431  RLPVQTVVQVLYYEQKSLREILSDSDSPPAAAATVEDTLPPPELRTYNNELS---KLNRE  487

Query  384  NEALRTELLQMKMFIADMQNkg-----ssqgssvkgssasaVRKP-----TFFSSMSKKL  235
            N+ L+ EL+++KM   +++ +      +S        S ++V KP     +F SS+S++L
Sbjct  488  NQDLKLELIKVKMKFKELEKEQKDFEVTSGSDCSSSVSIASVVKPRLPRKSFMSSVSRQL  547

Query  234  GKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            GKLNPF  G K            TKP + RR SIS
Sbjct  548  GKLNPF--GLKQVQ---------TKPAKGRRHSIS  571



>ref|XP_010939121.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Elaeis 
guineensis]
Length=606

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 112/201 (56%), Gaps = 17/201 (8%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A+L+ + +R ++D +YRAIDIYLK+HP L ++ER K+CS+MD  KLS EA  H ++N R
Sbjct  412  LADLIPEQSRVIEDGMYRAIDIYLKSHPSLSDMERRKICSLMDSQKLSREACAHVARNDR  471

Query  522  LPVQIVLHALYYDQLKIRS-------GAEDP----KSTPNAIATRNQLQADVTLVKENEA  376
            LPV IV+  LYY+Q ++R        G E P    K+T   I   N       L +EN+ 
Sbjct  472  LPVPIVVQVLYYEQQRLRDVTSGNLIGGESPALSQKATSYGIGYHNAPDELSRLRRENDD  531

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  196
            L+ EL++++M + +++    +  ++ K        K +F  S+S KLG L  F H   DT
Sbjct  532  LKLELVRLRMQLKEIEKSSGNIAAADKPPLP----KKSFIHSISNKLGHLFAFMHS--DT  585

Query  195  SNLDDGEVDITKPRRRRFSIS  133
              L   +     P+  R SIS
Sbjct  586  VKLLSDKTRRKPPKVLRHSIS  606



>gb|AES90666.2| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=595

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 122/213 (57%), Gaps = 30/213 (14%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP + + +R+KVCS+MD  KLS EAR HA+QN R
Sbjct  390  LAELMPEKSRTTEDGMYRAIDIYLKAHPFVSDTDRKKVCSMMDFQKLSREARTHAAQNNR  449

Query  522  LPVQIVLHALYYDQLKIR-------SGAEDPKSTPNAIATRNQLQADV--------TLVK  388
            LP Q V   LYY+Q ++R       S   D  STP+    RN   +++         L +
Sbjct  450  LPAQNVAQILYYEQQRLRDNMDGTGSVGSDSPSTPD---KRNVYSSELYPATNEVSKLRR  506

Query  387  ENEALRTELLQMKMFIADMQNkgssqg---ssvkgssasaVRKP-----TFFSSMSKKLG  232
            ENE L+ E++++K+ I +M+     +    S +   S+ +  KP     +F +S+S+KLG
Sbjct  507  ENEELKLEIVKLKIKIKEMEKSTVLESPINSPLLNVSSPSADKPPLPRKSFLNSVSRKLG  566

Query  231  KLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +L+PF+         D  ++D    + RR+SIS
Sbjct  567  RLSPFQRAHPVIRPKDRIQLD----KIRRYSIS  595



>ref|XP_011099322.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Sesamum 
indicum]
Length=616

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 117/209 (56%), Gaps = 25/209 (12%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCSVMD  KLS EA  HA+QN R
Sbjct  414  LAELIPEQSRLTEDGMYRAIDIYLKAHPALSDMERKKVCSVMDCQKLSREACAHAAQNDR  473

Query  522  LPVQIVLHALYYDQLKIRSG-----AEDP------KSTPNAIATRNQLQADVTLVKENEA  376
            LPVQ V+  LYY+Q ++R       +E P      K +P +I          TL +EN+ 
Sbjct  474  LPVQTVVQVLYYEQQRLREVMDGNLSEAPALPAPSKLSPYSINVHPVNDEVSTLRRENQD  533

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasaVR--KP-----TFFSSMSKKLGKLNPF  217
            L+ EL++MKM + +M+   S+  +    ++A      KP     +F SS+ KKLG+   F
Sbjct  534  LKLELVKMKMRLKEMEKPLSASSTPSPLAAARPTSLDKPPLPRKSFISSVGKKLGR---F  590

Query  216  KHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
                  +     G    TKP + RR SIS
Sbjct  591  IRADGISPQSSKGR---TKPAKDRRHSIS  616



>ref|XP_006290338.1| hypothetical protein CARUB_v10016995mg [Capsella rubella]
 gb|EOA23236.1| hypothetical protein CARUB_v10016995mg [Capsella rubella]
Length=532

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 118/213 (55%), Gaps = 34/213 (16%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G A  + K +R  +D LY+AIDIYLK HP + E+E++KVCS++D  KLS E   HA+QN 
Sbjct  332  GFAECIPKQSRITEDGLYQAIDIYLKTHPNISEMEKKKVCSLIDCQKLSREKCAHAAQND  391

Query  525  RLPVQIVLHALYYDQLKIR------------SGAEDPKSTPNAIATRNQLQADVTLVKEN  382
            RLPVQ ++  LYY+Q  +R            + A D    P+ +++ N   + +   +EN
Sbjct  392  RLPVQTMVQVLYYEQQHLREILSESDSPAVAATARDTLPPPDELSSYNNELSKLN--REN  449

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssasaV----------RKPTFFSSMSKKLG  232
            + L+ EL+++KM   +++ + + +  +     +S+V          ++ +F SS+S+KLG
Sbjct  450  QDLKLELIKVKMKFKELEKEKAFEVLTSGSDCSSSVSTASVVKPRLQRKSFISSISRKLG  509

Query  231  KLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            KLNPF         L  G+     P+ RR SIS
Sbjct  510  KLNPF--------GLKQGQTK--PPKGRRHSIS  532



>ref|XP_009130549.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Brassica rapa]
Length=600

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 117/218 (54%), Gaps = 39/218 (18%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  394  LAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQNDR  453

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKST--------------PNAIATRNQLQADVTLVKE  385
            LPVQ ++  LYY+Q ++R    +   +              P  +++ N   + V   +E
Sbjct  454  LPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPTATVLPPPKLSSYNDELSKVK--RE  511

Query  384  NEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP--------------TFFSSM  247
            N+ L+ ELL+MKM + + + + + + SS   + +S    P              +F +S+
Sbjct  512  NQDLKLELLKMKMKLKEFEKENNEKKSSTTTTMSSNHSSPRSTASMDKPPLPRKSFINSV  571

Query  246  SKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            SKKLGKL PF    +  +           P+ RR SIS
Sbjct  572  SKKLGKLXPFGIPPRGRTK---------PPKDRRHSIS  600



>ref|XP_010503666.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 118/211 (56%), Gaps = 30/211 (14%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G A  + K +R  +D +Y+AIDIYLK HP + E+E++KVCS+MD  KLS E   HA+QN 
Sbjct  371  GFAECIPKQSRITEDGMYQAIDIYLKTHPNISEMEKKKVCSLMDCQKLSREKCAHAAQND  430

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRN------QLQA---DVT-LVKENEA  376
            RLPVQ V+  LYY+Q  +R    D  S P A  T        +L+    D++ L +EN+ 
Sbjct  431  RLPVQTVVQVLYYEQQSLREILSDSDSPPAAAVTVEDTLTPPELRTYNNDLSKLNRENQD  490

Query  375  LRTELLQMKMFIADMQNkgssqgss-----vkgssasaVRKP-----TFFSSMSKKLGKL  226
            L+ EL+++KM   +++ +  +   +         S ++V KP     +F SS+S++LGKL
Sbjct  491  LKLELIKVKMKFKELEKEQKAFEVTSGSDCSSSVSIASVVKPRLPRKSFMSSVSRQLGKL  550

Query  225  NPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            N F  G +        +V    P+ RR SIS
Sbjct  551  NLF--GQR--------QVQTKPPKGRRHSIS  571



>ref|XP_009780159.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nicotiana 
sylvestris]
Length=621

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 116/202 (57%), Gaps = 12/202 (6%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             IA ++ + +R  +D +Y+AID YLKAHP L +IER++VCSVM+  KL+ EA  HA+QN+
Sbjct  421  SIAEVIPEKSRITEDRMYKAIDTYLKAHPALSDIERKRVCSVMNCQKLTREACAHAAQNE  480

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD--VTLVKENEALRTELLQM  352
            RLPVQ V+  LY++Q ++R   +      +  +T N    D   +L +EN+ L+ EL++M
Sbjct  481  RLPVQTVVQVLYFEQQRLRQVMDGSLDGADESSTDNNPVTDEVSSLKRENQDLKFELVKM  540

Query  351  KMFIADMQNkgssqgssvkgssas-------aVRKPTFFSSMSKKLGKLNPFKHGSKDTS  193
            K  + +++  G    +S      +        +R+ +F SS+S+ LGKL P   G+ D  
Sbjct  541  KTRLNEIEKCGDISATSTPVEITTPISSDKPRLRRKSFISSVSETLGKLYPISFGA-DHV  599

Query  192  NLDDGEVDITKP--RRRRFSIS  133
             +        KP  R RR+SIS
Sbjct  600  IMPSASKGRYKPISRDRRYSIS  621



>ref|XP_006280202.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
 gb|EOA13100.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
Length=605

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 117/214 (55%), Gaps = 29/214 (14%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  398  GLAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQND  457

Query  525  RLPVQIVLHALYYDQLKIRSGA-EDPKSTPNAIATRNQLQADVTLV----------KENE  379
            RLPVQ ++  LYY+Q ++R    +D  S                L           +EN+
Sbjct  458  RLPVQTIVQVLYYEQQRLRGEVTKDADSPAPPPPAVAAAVLPPKLSSYNDELSKLKRENQ  517

Query  378  ALRTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TFFSSMSKKL  235
             L+ ELL+MKM + + + +   + SS   S+        +++ KP     +F +S+S+KL
Sbjct  518  DLKLELLKMKMKLKEFEKESEKKSSSSTISTNPNSPISTASMDKPPLPRKSFINSVSRKL  577

Query  234  GKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            GKLNPF  G    S    G      P+ RR SIS
Sbjct  578  GKLNPF--GITPYS----GRGRTKPPKDRRHSIS  605



>emb|CBI33715.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 89/136 (65%), Gaps = 11/136 (8%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++E++KVCS+MD  KLS EA  HA+QN R
Sbjct  381  LAELLPEQSRVKEDGMYRAIDIYLKAHPSLSDMEKKKVCSLMDCQKLSREACAHAAQNDR  440

Query  522  LPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQ--AD--VTLVKENEA  376
            LPVQ V+  LYY+Q ++R        G E P   P +    N L   +D  ++L +ENE 
Sbjct  441  LPVQTVVQVLYYEQQRLRDVMNGSLMGGESPAIPPKSNLFSNDLHPVSDELLSLRRENED  500

Query  375  LRTELLQMKMFIADMQ  328
            L+ EL++MKM + +++
Sbjct  501  LKLELMKMKMRLKEIE  516



>ref|XP_002866705.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42964.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
Length=604

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 115/212 (54%), Gaps = 28/212 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  399  LAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQNDR  458

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLV----------KENEAL  373
            LPVQ ++  LYY+Q ++R    +   +P              L           +EN+ L
Sbjct  459  LPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPPPAAVLPPKLSSYTDELSKLKRENQDL  518

Query  372  RTELLQMKMFIADMQNkgssqgssvkgss-------asaVRKP-----TFFSSMSKKLGK  229
            + ELL+MKM + + + +   + SS   S+        +++ KP     +F +S+SKKLGK
Sbjct  519  KLELLKMKMKLKEFEKESEKKSSSSTISTNPSSPISTASMGKPPLPRKSFINSVSKKLGK  578

Query  228  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            LNPF           +G      P+ RR SIS
Sbjct  579  LNPFGITPY------NGRGRTKPPKDRRHSIS  604



>gb|EYU44474.1| hypothetical protein MIMGU_mgv1a027075mg [Erythranthe guttata]
Length=577

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 114/214 (53%), Gaps = 30/214 (14%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            IA L  +  R  +D +YRAIDIYLKAHP L ++ER+KVCSVMD  KLS EA  HA+QN R
Sbjct  370  IAELTPEQYRMTEDGMYRAIDIYLKAHPALSDMERKKVCSVMDCQKLSREACAHAAQNDR  429

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKS---TPNAIATRNQLQADVTLV--------KENEA  376
            LPVQ V+  LYY+Q ++R   +   S   T    A       DV +V        KEN+ 
Sbjct  430  LPVQTVVQVLYYEQQRLREAVDGSSSLNDTSAIPAKPGPYSGDVHIVTDEVSSLRKENQD  489

Query  375  LRTELLQMKMFIADMQNkgssqgssvkgssasa------------VRKPTFFSSMSKKLG  232
            L+ EL++MKM + +++    +   S   ++  +            + K +F SS+SKKLG
Sbjct  490  LKLELVKMKMRLNEIEKPSPTAFGSPSPATTVSRPGSADKPPLPPLPKKSFISSVSKKLG  549

Query  231  KLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  133
            +   F      ++    G    TKP + RR SIS
Sbjct  550  R---FIRADGLSAQGSRGR---TKPAKDRRHSIS  577



>gb|KJB43883.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=375

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 109/183 (60%), Gaps = 20/183 (11%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+  L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  171  GLTELIPEQSRITEDGMYRAIDIYLKAHPTITDLERKKVCSLMDCQKLSREACAHAAQND  230

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQ----ADV--------TLVKEN  382
            RLPVQ V+  LYY+Q ++R       S+  + +  +++      D+        +L +EN
Sbjct  231  RLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSPSISSRVNLYPPTDIHPVSDELSSLKREN  290

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssas---aVRKP-----TFFSSMSKKLGKL  226
            E L+ EL++MKM + +++   S+  S+          +  KP     +F +S+SKKLG+L
Sbjct  291  EDLKLELVKMKMRLKEIERPSSAVPSAASSPMGIIVPSSDKPPLPRKSFMNSVSKKLGRL  350

Query  225  NPF  217
             PF
Sbjct  351  YPF  353



>ref|XP_006364419.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=602

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 115/204 (56%), Gaps = 28/204 (14%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A +V +  R  +D +Y+AID+YLKAHP L ++ER+KVCSVM+  KL+ EA  HA+QN+R
Sbjct  397  VAEVVPEQLRITEDMMYKAIDMYLKAHPALSDVERKKVCSVMNCQKLTREACAHAAQNER  456

Query  522  LPVQIVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQADVT-----LVKENE  379
            LPVQIV+  LYY+Q ++R        GA DP S P      +   + VT     L +EN+
Sbjct  457  LPVQIVVQVLYYEQQRLREVMDVSLVGA-DPPSRPPKFNWFSSGISPVTDEVSSLKRENQ  515

Query  378  ALRTELLQMKMFIADMQ----NkgssqgssvkgssasaVRKP--TFFSSMSKKLGKLNPF  217
             L+ EL+++KM   +++       +S    +    +   R P  +F +++S+KLGKL P 
Sbjct  516  DLKFELMKLKMKCREIEKRDDKSAASTPLGITTPPSDKPRLPRKSFITAVSRKLGKLYP-  574

Query  216  KHGSKDTSNLDDGEVDITKPRRRR  145
                    +    EV I  P +R+
Sbjct  575  --------SFGTDEVTIPSPSKRK  590



>gb|KJB43882.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
 gb|KJB43884.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=487

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 109/183 (60%), Gaps = 20/183 (11%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+  L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  283  GLTELIPEQSRITEDGMYRAIDIYLKAHPTITDLERKKVCSLMDCQKLSREACAHAAQND  342

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQ----ADV--------TLVKEN  382
            RLPVQ V+  LYY+Q ++R       S+  + +  +++      D+        +L +EN
Sbjct  343  RLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSPSISSRVNLYPPTDIHPVSDELSSLKREN  402

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssas---aVRKP-----TFFSSMSKKLGKL  226
            E L+ EL++MKM + +++   S+  S+          +  KP     +F +S+SKKLG+L
Sbjct  403  EDLKLELVKMKMRLKEIERPSSAVPSAASSPMGIIVPSSDKPPLPRKSFMNSVSKKLGRL  462

Query  225  NPF  217
             PF
Sbjct  463  YPF  465



>ref|XP_009103425.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brassica 
rapa]
Length=601

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 111/216 (51%), Gaps = 35/216 (16%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP ++++E++KVCS+MD  KLS EA  HA+QN 
Sbjct  396  GLAELIPEQSRVTEDGMYRAVDIYLKAHPNMNDVEKKKVCSLMDCQKLSREACAHAAQND  455

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVT-------------LVKE  385
            RLPVQ ++  LYY+Q ++R    +               A V              L +E
Sbjct  456  RLPVQTIVQVLYYEQQRLRGEVTNDSEALPPQPPPPAAAATVLPPKLSSYNDELSKLKRE  515

Query  384  NEALRTELLQMKM-------FIADMQNkgssqgssvkgssasaVRKP-----TFFSSMSK  241
            N+ L+ E+L+MKM             +  +   +     S +++ KP     +F +S+S+
Sbjct  516  NQDLKLEILKMKMKLKEFEKENEKKSSSTAMSSNHSSPISTASMDKPPLPRKSFMNSVSR  575

Query  240  KLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            KLGKLNPF      T            P+ RR SIS
Sbjct  576  KLGKLNPFGITPGRTK----------PPKDRRHSIS  601



>ref|XP_003558544.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brachypodium 
distachyon]
Length=625

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 107/221 (48%), Gaps = 36/221 (16%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + AR  +D +YRAIDIYLKAHP L E ER+KVC VMD  KLS EA  HA+QN R
Sbjct  410  LATLIPERARFNEDGMYRAIDIYLKAHPGLGEGERKKVCGVMDCQKLSREACAHAAQNDR  469

Query  522  LPVQIVLHALYYDQLKIRS---------------GAEDPK-STPNAIATRNQLQADVT--  397
            LPVQ V+  LY++Q ++R+               G E P  S   +   R++     +  
Sbjct  470  LPVQTVVQVLYHEQRRLRASQTPSHSQAPSYAGGGGESPALSYKPSFNGRDRSAPSPSSS  529

Query  396  -----LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKP--------TFF  256
                 L +EN+ LR EL+QMKM + D               ++     P           
Sbjct  530  SEMSRLQRENDELRLELMQMKMRLRDPSAAPPVAAGRGGAPASGKPPLPKKQGGAGGGGG  589

Query  255  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
                KKLG+LNPF   S     +   +V    P+ RR SIS
Sbjct  590  GGFMKKLGRLNPFVRDS-----VGGAKVRAKPPKDRRHSIS  625



>gb|KJB43880.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=611

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 109/183 (60%), Gaps = 20/183 (11%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+  L+ + +R  +D +YRAIDIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN 
Sbjct  407  GLTELIPEQSRITEDGMYRAIDIYLKAHPTITDLERKKVCSLMDCQKLSREACAHAAQND  466

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQ----ADV--------TLVKEN  382
            RLPVQ V+  LYY+Q ++R       S+  + +  +++      D+        +L +EN
Sbjct  467  RLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSPSISSRVNLYPPTDIHPVSDELSSLKREN  526

Query  381  EALRTELLQMKMFIADMQNkgssqgssvkgssas---aVRKP-----TFFSSMSKKLGKL  226
            E L+ EL++MKM + +++   S+  S+          +  KP     +F +S+SKKLG+L
Sbjct  527  EDLKLELVKMKMRLKEIERPSSAVPSAASSPMGIIVPSSDKPPLPRKSFMNSVSKKLGRL  586

Query  225  NPF  217
             PF
Sbjct  587  YPF  589



>ref|XP_006841959.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
 gb|ERN03634.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
Length=609

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 101/177 (57%), Gaps = 21/177 (12%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+  L+ + ++  +D +YRAIDIYLKAH  L EIER+KVCS+MD  KLS EA  HA+QN 
Sbjct  416  GLVELIPEQSKANEDGIYRAIDIYLKAHASLIEIERKKVCSLMDCQKLSREACAHAAQND  475

Query  525  RLPVQIVLHALYYDQLKIR--------------SGAEDPKSTPNAIATRNQLQADVTLVK  388
            RLPVQ V+  LYY+Q  +R              S +    +    ++  N+L   + L +
Sbjct  476  RLPVQTVVQVLYYEQQSLRDAMNGNLTEKEEWLSQSHKANAHSKDLSPHNEL---LLLRR  532

Query  387  ENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  217
            ENE L+ E+++++M + +++        + K        K +  +SMSKKLGKL PF
Sbjct  533  ENEDLKLEMVKLRMRLKELEKLEKPPNRANKPPLP----KKSLLNSMSKKLGKLYPF  585



>ref|XP_006650337.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Oryza 
brachyantha]
Length=624

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 10/136 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD  KLS EA  HA+QN+
Sbjct  415  ALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDCQKLSLEACTHAAQNE  474

Query  525  RLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATRNQLQADVTLVKENEA  376
            RLP+++V+  L+++QL++R+            E  +   + IAT  +     T V+EN+ 
Sbjct  475  RLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSGIATSGEAGGWATAVRENQV  534

Query  375  LRTELLQMKMFIADMQ  328
            L+  +  M+M +++++
Sbjct  535  LKVGMDNMRMRLSELE  550



>ref|XP_010687037.1| PREDICTED: BTB/POZ domain-containing protein At1g30440 [Beta 
vulgaris subsp. vulgaris]
Length=633

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 86/135 (64%), Gaps = 10/135 (7%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A  V + AR +DD LYRAIDIYLK+HP L E ERE++C +MD  KLS EA  HA+QN+R
Sbjct  427  LAAAVPEFARPLDDGLYRAIDIYLKSHPWLSESEREQLCRLMDCQKLSLEACTHAAQNER  486

Query  522  LPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATRNQLQADVTLVKENEAL  373
            LP++I++  L+++QL++R+            E  +   + +   N+    VT V+EN+ L
Sbjct  487  LPLRIIVQVLFFEQLQLRNSIAGCFLVSENLEGSRQLRSGMVGSNEGGGWVTAVRENQVL  546

Query  372  RTELLQMKMFIADMQ  328
            +  +  M+M +++++
Sbjct  547  KVGMDNMRMRVSELE  561



>gb|EEE59569.1| hypothetical protein OsJ_11863 [Oryza sativa Japonica Group]
Length=513

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 86/136 (63%), Gaps = 10/136 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD  KLS EA  HA+QN+
Sbjct  304  ALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDCQKLSLEACTHAAQNE  363

Query  525  RLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATRNQLQADVTLVKENEA  376
            RLP+++V+  L+++QL++R+            E  +   ++I T  +     T V+EN+ 
Sbjct  364  RLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSSITTSGEAGGWATAVRENQV  423

Query  375  LRTELLQMKMFIADMQ  328
            L+  +  M+M +++++
Sbjct  424  LKVGMDNMRMRLSELE  439



>ref|XP_003561994.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Brachypodium 
distachyon]
Length=624

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 10/136 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD  KLS EA  HA+QN+
Sbjct  415  ALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDCQKLSLEACTHAAQNE  474

Query  525  RLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATRNQLQADVTLVKENEA  376
            RLP+++V+  L+++QL++R+            E  +   + IAT  +     T V+EN+ 
Sbjct  475  RLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLERSRPLRSGIATSGEAGGWTTAVRENQV  534

Query  375  LRTELLQMKMFIADMQ  328
            L+  +  M++ +A+++
Sbjct  535  LKVGMDNMRIRLAELE  550



>gb|ABR25380.1| transposon protein [Oryza sativa Indica Group]
Length=279

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 81/128 (63%), Gaps = 11/128 (9%)
 Frame = -2

Query  678  ARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLH  499
            AR +DD LYRAIDIYLKAHP L E E+E++C VMD  KLS EA  HA+QN+RLP+++++ 
Sbjct  74   ARPIDDGLYRAIDIYLKAHPHLSESEKEELCRVMDCQKLSLEACTHAAQNERLPLRVIVQ  133

Query  498  ALYYDQLKIRSG-AEDPKSTPNAIATRNQLQADVT----------LVKENEALRTELLQM  352
             L+++QL++RS  AE    + N      QL   ++            +EN+ALR  +  M
Sbjct  134  VLFFEQLQLRSSIAECLMVSENLEGGSRQLIPTISGEQYRPGWPLASRENQALREGMDNM  193

Query  351  KMFIADMQ  328
            K  +AD++
Sbjct  194  KQRVADLE  201



>emb|CDY57436.1| BnaAnng14510D [Brassica napus]
Length=603

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 111/217 (51%), Gaps = 36/217 (17%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A L+ + +R  +D +YRA+DIYLKAHP ++++E++KVCS+MD  KLS EA  HA+QN 
Sbjct  397  GLAELIPEQSRVTEDGMYRAVDIYLKAHPNINDVEKKKVCSLMDCQKLSREACAHAAQND  456

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVT-------------LVKE  385
            RLPVQ ++  LYY+Q ++R    +               A V              L +E
Sbjct  457  RLPVQTIVQVLYYEQQRLRGEVTNDSEALPPQPPPPAAAATVLPPKLSSYNDELSKLKRE  516

Query  384  NEALRTELLQMKM--------FIADMQNkgssqgssvkgssasaVRKP-----TFFSSMS  244
            N+ L+ E+L+MKM              +   S  +     S +++ KP     +F +S+S
Sbjct  517  NQDLKLEILKMKMKLKEFEKENEKKSSSTAMSSSNHSSPISTASMDKPPLPRKSFMNSVS  576

Query  243  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  133
            +KLGKLNPF      T            P+ RR SIS
Sbjct  577  RKLGKLNPFGITPGRTK----------PPKDRRHSIS  603



>ref|XP_004294000.1| PREDICTED: BTB/POZ domain-containing protein At1g30440 [Fragaria 
vesca subsp. vesca]
Length=638

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 87/138 (63%), Gaps = 13/138 (9%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A  V + AR +DD LYRAIDIYLK+HP L E +RE++C +MD  KLS EA  HA+QN+R
Sbjct  428  LAAAVPEYARHLDDGLYRAIDIYLKSHPWLAEADREQLCRLMDCQKLSLEACTHAAQNER  487

Query  522  LPVQIVLHALYYDQLKIRS-------------GAEDPKSTPNAIATRNQLQADVTLVKEN  382
            LP++IV+  L+++QL++RS             G+   ++  +  +  N+     T V+EN
Sbjct  488  LPLRIVVQVLFFEQLQLRSSIAGCFLVSDNLDGSRQIRNGFSGFSGSNEGGGWATTVREN  547

Query  381  EALRTELLQMKMFIADMQ  328
            + L+  +  M+M +++++
Sbjct  548  QVLKVGMDSMRMRVSELE  565



>ref|XP_001769248.1| predicted protein [Physcomitrella patens]
 gb|EDQ65960.1| predicted protein, partial [Physcomitrella patens]
Length=586

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 121/219 (55%), Gaps = 34/219 (16%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A ++ + AR+VDD LYRA+D++LKAHP + E ER+ +C ++D  KLS +A  HA+QN+
Sbjct  374  ALAEVLPEHARRVDDGLYRAVDVFLKAHPAIIEAERKTLCKIIDCQKLSQDACTHAAQNE  433

Query  525  RLPVQIVLHALYYDQLKIRSG-----AEDP--------KSTPNAIATRNQLQADVTLV-K  388
            RLPVQ+V+  LY++QL++R+        DP        + T   +AT      +   V +
Sbjct  434  RLPVQVVVQVLYFEQLRLRNAMSTINTRDPVLRLQLSQRMTVGNVATGQPPNENYESVRR  493

Query  387  ENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF-KH  211
            EN  L+ E+ +M+M + +++   ++    +  +   +     F  SMSKKL KLNPF + 
Sbjct  494  ENRDLKLEIARMRMRMTELERDQNNLKVDIVKNGGGSR----FIDSMSKKLSKLNPFQRR  549

Query  210  GSKDTSNLDDGEVDI-------------TKPRRRRFSIS  133
             S+D  N   GE+                KPRRRR S+S
Sbjct  550  ESRDFKN--SGELGTNSSGTPLTPDTRSAKPRRRRHSVS  586



>gb|ABF97835.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|EEC75816.1| hypothetical protein OsI_12774 [Oryza sativa Indica Group]
Length=624

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 86/136 (63%), Gaps = 10/136 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD  KLS EA  HA+QN+
Sbjct  415  ALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDCQKLSLEACTHAAQNE  474

Query  525  RLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATRNQLQADVTLVKENEA  376
            RLP+++V+  L+++QL++R+            E  +   ++I T  +     T V+EN+ 
Sbjct  475  RLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSSITTSGEAGGWATAVRENQV  534

Query  375  LRTELLQMKMFIADMQ  328
            L+  +  M+M +++++
Sbjct  535  LKVGMDNMRMRLSELE  550



>ref|XP_003520918.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
 gb|KHN29840.1| BTB/POZ domain-containing protein [Glycine soja]
Length=612

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 105/181 (58%), Gaps = 25/181 (14%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            IA  +   AR + D LYRAIDIYLKAH  L +++++K+C ++D  KLS EA  HA+QN+R
Sbjct  411  IAETLPAHARTIHDGLYRAIDIYLKAHQGLTDLDKKKLCKLIDFQKLSQEAGAHAAQNER  470

Query  522  LPVQIVLHALYYDQLKIRS------GAEDPK-----------STPNAIATRNQLQADVTL  394
            LPVQ ++  LY++QL++R+      G +DPK           +   A++ R+      +L
Sbjct  471  LPVQSIVQVLYFEQLRLRNSLSCSYGEDDPKPIHQSWRISSGALSAAMSPRDNY---ASL  527

Query  393  VKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  214
             +EN  L+ EL +++M + D++          +  + S  RK  F SS SKK+GKL+ F 
Sbjct  528  RRENRELKLELARLRMRLNDLER---EHVCMKRDMAKSGSRK--FMSSFSKKIGKLSLFG  582

Query  213  H  211
            H
Sbjct  583  H  583



>gb|ABF97836.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
Length=615

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 86/136 (63%), Gaps = 10/136 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD  KLS EA  HA+QN+
Sbjct  406  ALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDCQKLSLEACTHAAQNE  465

Query  525  RLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATRNQLQADVTLVKENEA  376
            RLP+++V+  L+++QL++R+            E  +   ++I T  +     T V+EN+ 
Sbjct  466  RLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSSITTSGEAGGWATAVRENQV  525

Query  375  LRTELLQMKMFIADMQ  328
            L+  +  M+M +++++
Sbjct  526  LKVGMDNMRMRLSELE  541



>gb|AAT85278.1| NPH3 family protein [Oryza sativa Japonica Group]
Length=650

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 86/136 (63%), Gaps = 10/136 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C +MD  KLS EA  HA+QN+
Sbjct  441  ALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDCQKLSLEACTHAAQNE  500

Query  525  RLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATRNQLQADVTLVKENEA  376
            RLP+++V+  L+++QL++R+            E  +   ++I T  +     T V+EN+ 
Sbjct  501  RLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSSITTSGEAGGWATAVRENQV  560

Query  375  LRTELLQMKMFIADMQ  328
            L+  +  M+M +++++
Sbjct  561  LKVGMDNMRMRLSELE  576



>ref|XP_007201187.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
 gb|EMJ02386.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
Length=614

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 105/180 (58%), Gaps = 24/180 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            IA+ + + AR V D LYRAIDIYLKAH  L + +++K+C ++D  KLS EA  HA+QN+R
Sbjct  414  IADALPEHARTVHDGLYRAIDIYLKAHQGLSDTDKKKLCKMIDFQKLSQEAGAHAAQNER  473

Query  522  LPVQIVLHALYYDQLKIR-----SGAEDPK-----------STPNAIATRNQLQADVTLV  391
            LP+Q ++  LY++Q+++R     SG ++PK           +   A++ R+      +L 
Sbjct  474  LPLQSIVQVLYFEQIRLRNSLGCSGEDEPKPMHQSWRISSGALSAAMSPRDNY---ASLR  530

Query  390  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  211
            +EN  L+ EL +++M + D++          +    S  RK  F SS SKKLGKL+ F H
Sbjct  531  RENRELKLELARLRMRLNDLER---EHVCMKRDMEKSNSRK--FMSSFSKKLGKLSFFGH  585



>ref|XP_004166154.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=802

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 82/135 (61%), Gaps = 16/135 (12%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A L+ + +R  +D +YRAIDIYLKAHP L ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct  417  LAELIPEQSRATEDGMYRAIDIYLKAHPSLSDMERKKVCSLMDCQKLSREACAHAAQNDR  476

Query  522  LPVQIVLHALYYDQLKIR---SGAEDPKSTPNAIATRNQLQADV-------------TLV  391
            LPVQ V+  LYY+Q ++R   +G+      P   A  N   A+               L 
Sbjct  477  LPVQTVVQVLYYEQQRLRDVMNGSPTGVEVPAVPAKLNIYSAETAAAAAHPVSDELSILR  536

Query  390  KENEALRTELLQMKM  346
            +EN+ L+ EL++MKM
Sbjct  537  RENQDLKLELVKMKM  551



>ref|XP_010679605.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=520

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            G+A ++ + AR  +D +YRAIDI+LKAHP L ++E++KVCS+MD  KLS EA  HA+QN 
Sbjct  305  GVAEVIPEQARVTEDGMYRAIDIFLKAHPLLSDLEKKKVCSLMDCQKLSREACAHAAQND  364

Query  525  RLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA  427
            RLPVQ V+  LYY+Q ++R    +   +PN+ A
Sbjct  365  RLPVQTVVQVLYYEQQRLRESMNETTGSPNSSA  397



>ref|XP_006845260.1| hypothetical protein AMTR_s00005p00262560 [Amborella trichopoda]
 gb|ERN06935.1| hypothetical protein AMTR_s00005p00262560 [Amborella trichopoda]
Length=615

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 103/180 (57%), Gaps = 25/180 (14%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             IA ++   AR +DD LYRAIDIYLKAH  L ++ER K+C ++D  KLS EA  HA+QN+
Sbjct  412  AIAEILPGDARMLDDGLYRAIDIYLKAHQGLSDLERRKLCKLIDFQKLSQEAGAHAAQNE  471

Query  525  RLPVQIVLHALYYDQLKIRSGA------EDPK-----------STPNAIATRNQLQADVT  397
            RLPVQ V+  LY++QL++R+        +DPK           +   A++ R+      +
Sbjct  472  RLPVQAVVQVLYFEQLRLRNALCGSFPDDDPKLAFQSRRISSGALSAAMSPRDNY---AS  528

Query  396  LVKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  217
            L +EN  L+ EL +M+M + D++         ++ SS+       F  + S+K+G++N F
Sbjct  529  LRRENRELKLELARMRMRLNDLEKDHVCMKQDLEKSSSHK-----FMGTFSRKIGRMNLF  583



>ref|XP_011096666.1| PREDICTED: BTB/POZ domain-containing protein At1g30440 [Sesamum 
indicum]
Length=633

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 113/199 (57%), Gaps = 18/199 (9%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            +A  V + AR +DD LYRAIDIYLK+HP L E +RE++C +MD  KLS EA  HA+QN+R
Sbjct  427  LAAAVPEYARPLDDGLYRAIDIYLKSHPWLAESDREQLCRLMDCQKLSLEACTHAAQNER  486

Query  522  LPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADV---------TLVKENEALR  370
            LP+++++  L+++QL++R+         + +    QL++ +         T V+EN+ L+
Sbjct  487  LPLRVIVQVLFFEQLQLRTSIAGCFLVSDNLDGSRQLRSGLMGPNDGGWATAVRENQVLK  546

Query  369  TELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLG-----KLNPFKHGS  205
              +  M+M +++++          +      V+ P+ + ++SKKLG     ++   + GS
Sbjct  547  VGMDNMRMRVSELEK--ECSNMRQEIEKLGKVKGPSTWGNVSKKLGFRLKSQMCSAQEGS  604

Query  204  KDTSNLDDGEVDITKPRRR  148
               S  ++G V I K + +
Sbjct  605  --VSKQNNGNVKIEKAKEK  621



>gb|KJB26098.1| hypothetical protein B456_004G225600 [Gossypium raimondii]
Length=612

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 100/181 (55%), Gaps = 21/181 (12%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
            GIA  + + AR + D LYRAIDIYLKAHP L + +R+++C ++D  KLS EA  HA+QN+
Sbjct  408  GIAETLPEHARTIHDGLYRAIDIYLKAHPSLPDEDRKRLCKLIDFQKLSQEAGAHAAQNE  467

Query  525  RLPVQIVLHALYYDQLKIRSGA------EDPKSTPNAIATR---NQLQADV-------TL  394
            RLP+Q ++  LY++QL++R+        +D K   +  + R     L A +       +L
Sbjct  468  RLPIQSIVQVLYFEQLRLRNALCCSYPDDDHKPAVHHQSWRISSGALSAAMSPRDNYASL  527

Query  393  VKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  214
             +EN  L+ EL +M+M + D++                  R   F  S SKK+GKL+ F 
Sbjct  528  RRENRELKLELTRMRMRLNDLEK-----EHVCMKRDMVKSRSRRFMRSFSKKIGKLSLFG  582

Query  213  H  211
            H
Sbjct  583  H  583



>ref|XP_004982336.1| PREDICTED: uncharacterized protein LOC101754459 [Setaria italica]
Length=1185

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 54/136 (40%), Positives = 85/136 (63%), Gaps = 10/136 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A+ V + AR +DD LYRAIDIYLKAH  L E ERE++C ++D  KLS EA  HA+QN+
Sbjct  414  ALASAVPEYARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLLDCQKLSLEACTHAAQNE  473

Query  525  RLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATRNQLQADVTLVKENEA  376
            RLP+++V+  L+++QL +R+            E  +   + IAT  +     T V+EN+ 
Sbjct  474  RLPLRVVVQVLFFEQLHLRTSIAGCLLVSDNLEGSRPLRSGIATSGEAGGWATAVRENQV  533

Query  375  LRTELLQMKMFIADMQ  328
            L+  +  M+M +A+++
Sbjct  534  LKVGMDNMRMRLAELE  549



>ref|XP_007133999.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
 gb|ESW05993.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
Length=610

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 105/181 (58%), Gaps = 25/181 (14%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            IA  +   AR V D LYRAIDIYLKAH  L +++++K+C ++D  KLS EA  HA+QN+R
Sbjct  409  IAETLPAHARTVHDALYRAIDIYLKAHQGLSDLDKKKLCRLIDFQKLSQEAGAHAAQNER  468

Query  522  LPVQIVLHALYYDQLKIRS------GAEDPK-----------STPNAIATRNQLQADVTL  394
            LP+Q ++  LY++QL++R+      G +DPK           +   A++ R+      +L
Sbjct  469  LPLQSIVQVLYFEQLRLRNSLSCSFGEDDPKPIHQSWRISSGALSAAMSPRDNY---ASL  525

Query  393  VKENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFK  214
             +EN  L+ EL +++M + D++          +  + S  RK  F SS SKK+GKL+ F 
Sbjct  526  RRENRELKLELARLRMRLNDLER---EHACMKRDMAKSGSRK--FMSSFSKKIGKLSLFG  580

Query  213  H  211
            H
Sbjct  581  H  581



>ref|XP_002464177.1| hypothetical protein SORBIDRAFT_01g013680 [Sorghum bicolor]
 gb|EER91175.1| hypothetical protein SORBIDRAFT_01g013680 [Sorghum bicolor]
Length=631

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 85/136 (63%), Gaps = 10/136 (7%)
 Frame = -2

Query  705  GIANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK  526
             +A+ + + AR +DD LYRAIDIYLKAH  L E ERE++C ++D  KLS EA  HA+QN+
Sbjct  416  ALASAIPEYARPLDDGLYRAIDIYLKAHSWLSEGEREQLCRLLDCQKLSLEACTHAAQNE  475

Query  525  RLPVQIVLHALYYDQLKIRSGA----------EDPKSTPNAIATRNQLQADVTLVKENEA  376
            RLP+++V+  L+++QL++R+            E  +   + I T  +     T V+EN+ 
Sbjct  476  RLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSGITTSGEAGGWATAVRENQV  535

Query  375  LRTELLQMKMFIADMQ  328
            L+  +  M+M +A+++
Sbjct  536  LKVGMDNMRMRLAELE  551



>ref|XP_008235484.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Prunus 
mume]
Length=614

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 105/180 (58%), Gaps = 24/180 (13%)
 Frame = -2

Query  702  IANLVXKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR  523
            IA+ + + AR V D LYRAIDIYLKAH  L + +++K+C ++D  KLS EA  HA+QN+R
Sbjct  414  IADALPEHARTVHDGLYRAIDIYLKAHQGLSDTDKKKLCKMIDFQKLSQEAGAHAAQNER  473

Query  522  LPVQIVLHALYYDQLKIR-----SGAEDPK-----------STPNAIATRNQLQADVTLV  391
            LP+Q ++  LY++Q+++R     SG ++PK           +   A++ R+      +L 
Sbjct  474  LPLQSIVQVLYFEQIRLRNSLGCSGEDEPKPMHQSWRISSGALSAAMSPRDNY---ASLR  530

Query  390  KENEALRTELLQMKMFIADMQNkgssqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKH  211
            +EN  L+ EL +++M + D++          +    S  RK  F SS SKK+GKL+ F H
Sbjct  531  RENRELKLELARLRMRLNDLER---EHVCMKRDMEKSNSRK--FMSSFSKKIGKLSFFGH  585



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365