BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF019D09

Length=715
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009354238.1|  PREDICTED: probable serine incorporator            251   1e-77   Pyrus x bretschneideri [bai li]
ref|XP_011073234.1|  PREDICTED: probable serine incorporator            250   4e-77   Sesamum indicum [beniseed]
ref|XP_007215456.1|  hypothetical protein PRUPE_ppa006404mg             249   1e-76   
ref|XP_007215457.1|  hypothetical protein PRUPE_ppa006404mg             248   2e-76   Prunus persica
ref|XP_008228861.1|  PREDICTED: probable serine incorporator            248   2e-76   Prunus mume [ume]
ref|XP_006493450.1|  PREDICTED: probable serine incorporator-like       248   2e-76   Citrus sinensis [apfelsine]
ref|XP_006427689.1|  hypothetical protein CICLE_v10025720mg             248   3e-76   Citrus clementina [clementine]
gb|KJB67006.1|  hypothetical protein B456_010G170100                    248   4e-76   Gossypium raimondii
gb|KHG09631.1|  Serine incorporator 3                                   248   4e-76   Gossypium arboreum [tree cotton]
ref|XP_008342757.1|  PREDICTED: probable serine incorporator            247   5e-76   
ref|XP_008381162.1|  PREDICTED: probable serine incorporator            247   5e-76   
gb|KJB68287.1|  hypothetical protein B456_010G236500                    247   7e-76   Gossypium raimondii
gb|KJB68285.1|  hypothetical protein B456_010G236500                    247   7e-76   Gossypium raimondii
ref|XP_004158797.1|  PREDICTED: probable serine incorporator-like       246   9e-76   
ref|XP_009365247.1|  PREDICTED: probable serine incorporator            246   2e-75   Pyrus x bretschneideri [bai li]
gb|KDO36650.1|  hypothetical protein CISIN_1g028965mg                   239   2e-75   Citrus sinensis [apfelsine]
ref|XP_007024820.1|  Serinc-domain containing serine and sphingol...    244   1e-74   
ref|XP_009759114.1|  PREDICTED: probable serine incorporator isof...    241   8e-74   Nicotiana sylvestris
ref|XP_010318692.1|  PREDICTED: probable serine incorporator            241   1e-73   Solanum lycopersicum
ref|XP_009615680.1|  PREDICTED: serine incorporator 3 isoform X2        241   1e-73   
ref|XP_011466994.1|  PREDICTED: serine incorporator 3                   241   2e-73   Fragaria vesca subsp. vesca
ref|XP_009615679.1|  PREDICTED: probable serine incorporator isof...    240   4e-73   Nicotiana tomentosiformis
gb|KJB68286.1|  hypothetical protein B456_010G236500                    239   5e-73   Gossypium raimondii
ref|XP_006341429.1|  PREDICTED: probable serine incorporator-like...    239   8e-73   Solanum tuberosum [potatoes]
gb|AFK43836.1|  unknown                                                 229   1e-71   Medicago truncatula
ref|XP_004135884.1|  PREDICTED: probable serine incorporator-like       236   1e-71   
ref|XP_009759116.1|  PREDICTED: probable serine incorporator isof...    234   6e-71   Nicotiana sylvestris
gb|EYU21792.1|  hypothetical protein MIMGU_mgv1a007183mg                234   7e-71   Erythranthe guttata [common monkey flower]
ref|XP_002270610.1|  PREDICTED: probable serine incorporator            233   1e-70   Vitis vinifera
ref|XP_011020548.1|  PREDICTED: probable serine incorporator            233   2e-70   Populus euphratica
ref|XP_009615681.1|  PREDICTED: probable serine incorporator isof...    232   3e-70   Nicotiana tomentosiformis
ref|XP_011082649.1|  PREDICTED: probable serine incorporator            232   4e-70   Sesamum indicum [beniseed]
gb|EMS53525.1|  putative serine incorporator                            229   4e-70   Triticum urartu
ref|XP_006341430.1|  PREDICTED: probable serine incorporator-like...    231   7e-70   Solanum tuberosum [potatoes]
ref|XP_007140603.1|  hypothetical protein PHAVU_008G126100g             231   1e-69   Phaseolus vulgaris [French bean]
gb|ABR25551.1|  serine incorporator 3                                   224   2e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_008461193.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    230   2e-69   Cucumis melo [Oriental melon]
ref|XP_009399576.1|  PREDICTED: probable serine incorporator            230   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP41926.1|  hypothetical protein JCGZ_26944                         229   4e-69   Jatropha curcas
ref|XP_010268463.1|  PREDICTED: serine incorporator 3-like              229   4e-69   Nelumbo nucifera [Indian lotus]
ref|XP_004492298.1|  PREDICTED: probable serine incorporator-like       229   8e-69   Cicer arietinum [garbanzo]
gb|EMT13726.1|  Putative serine incorporator                            229   8e-69   
gb|KDO36651.1|  hypothetical protein CISIN_1g028965mg                   219   2e-68   Citrus sinensis [apfelsine]
gb|EYU21795.1|  hypothetical protein MIMGU_mgv1a007183mg                227   4e-68   Erythranthe guttata [common monkey flower]
ref|XP_010687311.1|  PREDICTED: probable serine incorporator            226   6e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK46909.1|  unknown                                                 224   8e-68   Lotus japonicus
gb|KEH22798.1|  serinc-domain serine and sphingolipid biosynthesi...    226   9e-68   Medicago truncatula
gb|KEH22799.1|  serinc-domain serine and sphingolipid biosynthesi...    226   1e-67   Medicago truncatula
ref|XP_010107188.1|  putative serine incorporator                       225   1e-67   Morus notabilis
ref|XP_003570284.1|  PREDICTED: probable serine incorporator            225   1e-67   Brachypodium distachyon [annual false brome]
emb|CDO98258.1|  unnamed protein product                                224   3e-67   Coffea canephora [robusta coffee]
ref|XP_006649122.1|  PREDICTED: probable serine incorporator-like       223   7e-67   
gb|EAZ24909.1|  hypothetical protein OsJ_08689                          223   2e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048364.1|  Os02g0792900                                       223   2e-66   
ref|XP_008790112.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    222   3e-66   Phoenix dactylifera
ref|XP_008794380.1|  PREDICTED: probable serine incorporator            221   8e-66   Phoenix dactylifera
ref|XP_009383181.1|  PREDICTED: probable serine incorporator            221   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK96018.1|  unknown                                                 220   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010532058.1|  PREDICTED: serine incorporator 3                   219   3e-65   Tarenaya hassleriana [spider flower]
ref|XP_010914044.1|  PREDICTED: probable serine incorporator            219   5e-65   Elaeis guineensis
ref|XP_010929190.1|  PREDICTED: probable serine incorporator isof...    219   8e-65   Elaeis guineensis
ref|XP_010929191.1|  PREDICTED: probable serine incorporator isof...    218   8e-65   Elaeis guineensis
ref|XP_002454688.1|  hypothetical protein SORBIDRAFT_04g035670          218   2e-64   Sorghum bicolor [broomcorn]
ref|XP_006307669.1|  hypothetical protein CARUB_v10009295mg             218   2e-64   Capsella rubella
ref|XP_004954190.1|  PREDICTED: probable serine incorporator-like       218   2e-64   Setaria italica
ref|XP_011034606.1|  PREDICTED: probable serine incorporator            217   2e-64   Populus euphratica
ref|XP_010459155.1|  PREDICTED: probable serine incorporator            217   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010063622.1|  PREDICTED: probable serine incorporator isof...    217   2e-64   
ref|XP_002297693.2|  TMS membrane family protein                        217   3e-64   
ref|XP_010497691.1|  PREDICTED: probable serine incorporator            216   4e-64   Camelina sativa [gold-of-pleasure]
ref|NP_001130490.1|  hypothetical protein precursor                     216   6e-64   Zea mays [maize]
gb|ACL54492.1|  unknown                                                 216   7e-64   Zea mays [maize]
ref|XP_006845424.1|  hypothetical protein AMTR_s00019p00091080          215   2e-63   Amborella trichopoda
gb|KCW70853.1|  hypothetical protein EUGRSUZ_F03990                     212   2e-63   Eucalyptus grandis [rose gum]
ref|XP_010476724.1|  PREDICTED: serine incorporator 3                   214   3e-63   Camelina sativa [gold-of-pleasure]
emb|CDY52849.1|  BnaA09g56410D                                          214   4e-63   Brassica napus [oilseed rape]
ref|XP_010246591.1|  PREDICTED: serine incorporator 3-like              213   5e-63   
ref|XP_009117776.1|  PREDICTED: serine incorporator 3 isoform X2        213   6e-63   Brassica rapa
ref|XP_009110458.1|  PREDICTED: serine incorporator 3-like              212   2e-62   Brassica rapa
emb|CDY70974.1|  BnaAnng35710D                                          212   2e-62   Brassica napus [oilseed rape]
emb|CDX81752.1|  BnaC08g38490D                                          212   2e-62   
ref|XP_010063623.1|  PREDICTED: probable serine incorporator isof...    212   2e-62   Eucalyptus grandis [rose gum]
ref|XP_003532291.1|  PREDICTED: probable serine incorporator-like       211   4e-62   Glycine max [soybeans]
ref|XP_003552131.1|  PREDICTED: probable serine incorporator-like       211   6e-62   Glycine max [soybeans]
ref|XP_002890152.1|  TMS membrane family protein                        209   2e-61   
ref|XP_002512768.1|  Membrane protein PB1A10.07c, putative              209   3e-61   
ref|NP_173069.1|  Serinc-domain containing serine and sphingolipi...    208   7e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006416842.1|  hypothetical protein EUTSA_v10007762mg             207   1e-60   Eutrema salsugineum [saltwater cress]
gb|ABR17762.1|  unknown                                                 204   2e-59   Picea sitchensis
emb|CDX83957.1|  BnaC08g16880D                                          210   3e-59   
ref|XP_006850791.1|  hypothetical protein AMTR_s00025p00104130          195   1e-56   
ref|XP_008673654.1|  PREDICTED: uncharacterized protein LOC100191...    189   2e-54   Zea mays [maize]
tpg|DAA49274.1|  TPA: hypothetical protein ZEAMMB73_017777              189   3e-54   
gb|ABR16232.1|  unknown                                                 190   4e-54   Picea sitchensis
ref|NP_001130812.1|  uncharacterized protein LOC100191916               189   1e-53   Zea mays [maize]
ref|XP_002466928.1|  hypothetical protein SORBIDRAFT_01g016840          189   1e-53   Sorghum bicolor [broomcorn]
ref|NP_001050476.1|  Os03g0454100                                       188   3e-53   
ref|XP_004982576.1|  PREDICTED: probable serine incorporator-like       186   2e-52   Setaria italica
ref|XP_008458551.1|  PREDICTED: serine incorporator 3                   186   2e-52   Cucumis melo [Oriental melon]
ref|XP_010546829.1|  PREDICTED: serine incorporator 3 isoform X1        185   4e-52   Tarenaya hassleriana [spider flower]
ref|XP_010237604.1|  PREDICTED: probable serine incorporator            184   7e-52   Brachypodium distachyon [annual false brome]
ref|XP_006650244.1|  PREDICTED: probable serine incorporator-like       184   7e-52   Oryza brachyantha
ref|XP_004150322.1|  PREDICTED: serine incorporator 3-like              184   1e-51   Cucumis sativus [cucumbers]
ref|XP_004169518.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...    184   1e-51   
ref|XP_011090806.1|  PREDICTED: probable serine incorporator            183   2e-51   Sesamum indicum [beniseed]
gb|EYU43840.1|  hypothetical protein MIMGU_mgv1a006662mg                184   2e-51   Erythranthe guttata [common monkey flower]
dbj|BAK02293.1|  predicted protein                                      176   3e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86142.1|  predicted protein                                      182   5e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008799134.1|  PREDICTED: probable serine incorporator            182   6e-51   Phoenix dactylifera
ref|XP_010546830.1|  PREDICTED: serine incorporator 3 isoform X2        180   2e-50   Tarenaya hassleriana [spider flower]
ref|XP_004296950.1|  PREDICTED: probable serine incorporator            179   5e-50   Fragaria vesca subsp. vesca
ref|XP_009391591.1|  PREDICTED: serine incorporator 3                   179   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938752.1|  PREDICTED: probable serine incorporator            177   4e-49   Elaeis guineensis
ref|XP_002280143.1|  PREDICTED: serine incorporator 3                   177   4e-49   Vitis vinifera
ref|XP_006419802.1|  hypothetical protein CICLE_v10005070mg             174   4e-48   Citrus clementina [clementine]
ref|XP_010693925.1|  PREDICTED: serine incorporator 3                   174   5e-48   Beta vulgaris subsp. vulgaris [field beet]
emb|CDO98987.1|  unnamed protein product                                174   5e-48   Coffea canephora [robusta coffee]
emb|CDY05246.1|  BnaC05g45570D                                          174   6e-48   
ref|XP_009365800.1|  PREDICTED: probable serine incorporator isof...    173   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_009365799.1|  PREDICTED: probable serine incorporator isof...    173   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_006356686.1|  PREDICTED: serine incorporator 3-like              172   2e-47   Solanum tuberosum [potatoes]
emb|CDY24707.1|  BnaA05g31060D                                          172   3e-47   Brassica napus [oilseed rape]
ref|XP_009342179.1|  PREDICTED: probable serine incorporator            172   3e-47   Pyrus x bretschneideri [bai li]
gb|KHN37564.1|  Putative serine incorporator                            172   5e-47   Glycine soja [wild soybean]
ref|XP_010464184.1|  PREDICTED: probable serine incorporator            171   6e-47   Camelina sativa [gold-of-pleasure]
gb|ACJ84561.1|  unknown                                                 171   7e-47   Medicago truncatula
ref|XP_010486107.1|  PREDICTED: probable serine incorporator            171   7e-47   Camelina sativa [gold-of-pleasure]
gb|KDO74827.1|  hypothetical protein CISIN_1g039061mg                   171   8e-47   Citrus sinensis [apfelsine]
gb|KJB28193.1|  hypothetical protein B456_005G040500                    171   1e-46   Gossypium raimondii
ref|XP_009129653.1|  PREDICTED: probable serine incorporator            171   1e-46   Brassica rapa
ref|XP_006297798.1|  hypothetical protein CARUB_v10013833mg             170   2e-46   
ref|XP_010436570.1|  PREDICTED: probable serine incorporator            170   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009799680.1|  PREDICTED: probable serine incorporator            170   2e-46   Nicotiana sylvestris
gb|AAF30310.1|AC018907_10  hypothetical protein                         165   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147778.1|  hypothetical protein PHAVU_006G154400g             167   2e-45   Phaseolus vulgaris [French bean]
ref|XP_010322266.1|  PREDICTED: serine incorporator 3                   167   3e-45   Solanum lycopersicum
ref|XP_002882452.1|  TMS membrane family protein                        167   3e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_001765634.1|  predicted protein                                  166   5e-45   
ref|XP_006595390.1|  PREDICTED: probable serine incorporator-like       165   8e-45   
ref|NP_187268.2|  Serinc-domain containing serine and sphingolipi...    166   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623079.1|  PREDICTED: probable serine incorporator            165   2e-44   Nicotiana tomentosiformis
ref|XP_007034589.1|  Serinc-domain containing serine and sphingol...    164   2e-44   
emb|CAN71158.1|  hypothetical protein VITISV_036762                     162   3e-44   Vitis vinifera
gb|AFK47365.1|  unknown                                                 159   4e-44   Lotus japonicus
ref|XP_010255869.1|  PREDICTED: probable serine incorporator            164   6e-44   Nelumbo nucifera [Indian lotus]
ref|XP_004486156.1|  PREDICTED: probable serine incorporator-like       163   8e-44   Cicer arietinum [garbanzo]
ref|XP_008340909.1|  PREDICTED: probable serine incorporator            163   1e-43   Malus domestica [apple tree]
ref|XP_010103434.1|  putative serine incorporator                       162   2e-43   Morus notabilis
gb|EPS68630.1|  hypothetical protein M569_06136                         162   2e-43   Genlisea aurea
ref|XP_008223013.1|  PREDICTED: probable serine incorporator            162   3e-43   Prunus mume [ume]
ref|XP_008390818.1|  PREDICTED: probable serine incorporator            161   6e-43   
ref|XP_011010290.1|  PREDICTED: probable serine incorporator            160   2e-42   Populus euphratica
ref|XP_006407969.1|  hypothetical protein EUTSA_v10020853mg             157   2e-42   
gb|KDP40096.1|  hypothetical protein JCGZ_02094                         159   3e-42   Jatropha curcas
ref|XP_002312742.1|  TMS membrane family protein                        159   5e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006407970.1|  hypothetical protein EUTSA_v10020853mg             157   8e-42   Eutrema salsugineum [saltwater cress]
ref|XP_002516786.1|  Membrane protein PB1A10.07c, putative              157   2e-41   Ricinus communis
ref|XP_007222705.1|  hypothetical protein PRUPE_ppa006444mg             156   3e-41   Prunus persica
ref|XP_010024424.1|  PREDICTED: serine incorporator 3                   155   7e-41   Eucalyptus grandis [rose gum]
gb|KJB67012.1|  hypothetical protein B456_010G170100                    144   5e-37   Gossypium raimondii
ref|XP_009117775.1|  PREDICTED: wall-associated receptor kinase-l...    147   8e-37   Brassica rapa
ref|XP_002956760.1|  hypothetical protein VOLCADRAFT_83749              142   5e-36   Volvox carteri f. nagariensis
ref|XP_005651318.1|  TMS membrane protein/tumor differentially hy...    141   2e-35   Coccomyxa subellipsoidea C-169
ref|XP_002979274.1|  hypothetical protein SELMODRAFT_110336             138   8e-35   
gb|ABF97020.1|  TMS membrane family protein, putative, expressed        131   4e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002506090.1|  predicted protein                                  130   9e-32   Micromonas commoda
gb|KIZ05916.1|  putative serine incorporator                            130   1e-31   Monoraphidium neglectum
ref|XP_002988580.1|  hypothetical protein SELMODRAFT_128126             129   2e-31   
ref|XP_001416509.1|  predicted protein                                  128   7e-31   Ostreococcus lucimarinus CCE9901
ref|XP_011397622.1|  putative serine incorporator                       124   1e-29   Auxenochlorella protothecoides
gb|AEW08633.1|  hypothetical protein CL976Contig1_02                    112   8e-28   Pinus radiata
ref|XP_004302121.1|  PREDICTED: serine incorporator 3-like              115   4e-27   Fragaria vesca subsp. vesca
ref|XP_003075128.1|  OJ1249_F12.26 gene product (ISS)                   114   9e-26   
emb|CEG01070.1|  TMS membrane protein/tumour differentially expre...    114   9e-26   Ostreococcus tauri
dbj|BAD94992.1|  hypothetical protein                                   105   1e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CAN80334.1|  hypothetical protein VITISV_009413                     103   6e-25   Vitis vinifera
gb|ACG35592.1|  hypothetical protein                                    102   2e-24   Zea mays [maize]
gb|EFA77480.1|  TMS membrane protein                                    100   3e-21   Heterostelium album PN500
emb|CEG74958.1|  hypothetical protein RMATCC62417_10078               97.4    2e-20   Rhizopus microsporus
emb|CEG74957.1|  hypothetical protein RMATCC62417_10078               97.1    3e-20   Rhizopus microsporus
ref|XP_002982341.1|  hypothetical protein SELMODRAFT_179397           97.4    3e-20   Selaginella moellendorffii
emb|CEG74955.1|  hypothetical protein RMATCC62417_10078               96.7    6e-20   Rhizopus microsporus
emb|CEG74956.1|  hypothetical protein RMATCC62417_10078               96.7    6e-20   Rhizopus microsporus
emb|CEG67769.1|  hypothetical protein RMATCC62417_04149               96.7    7e-20   Rhizopus microsporus
emb|CEG74954.1|  hypothetical protein RMATCC62417_10078               96.7    1e-19   Rhizopus microsporus
emb|CEJ03265.1|  hypothetical protein RMCBS344292_17253               95.1    2e-19   Rhizopus microsporus
emb|CEJ00743.1|  hypothetical protein RMCBS344292_14792               96.3    2e-19   Rhizopus microsporus
emb|CEG74953.1|  hypothetical protein RMATCC62417_10078               96.3    2e-19   Rhizopus microsporus
ref|XP_001770496.1|  predicted protein                                94.4    5e-19   
ref|XP_002304839.2|  hypothetical protein POPTR_0003s18530g           94.0    5e-19   
ref|XP_007202140.1|  hypothetical protein PRUPE_ppa006940mg           92.0    3e-18   
ref|XP_008242601.1|  PREDICTED: probable serine incorporator          91.7    4e-18   Prunus mume [ume]
ref|XP_009336915.1|  PREDICTED: probable serine incorporator          90.9    9e-18   
ref|XP_010049913.1|  PREDICTED: probable serine incorporator isof...  90.5    1e-17   Eucalyptus grandis [rose gum]
ref|NP_189089.3|  Serinc-domain containing serine and sphingolipi...  90.5    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32305.1|  hypothetical protein JCGZ_13230                       90.5    1e-17   Jatropha curcas
ref|XP_002965853.1|  hypothetical protein SELMODRAFT_83891            89.7    1e-17   
ref|XP_008337449.1|  PREDICTED: probable serine incorporator          89.4    3e-17   
ref|XP_003620496.1|  Serine incorporator                              89.4    3e-17   Medicago truncatula
ref|XP_010656350.1|  PREDICTED: probable serine incorporator isof...  88.6    3e-17   
ref|XP_010656344.1|  PREDICTED: probable serine incorporator isof...  89.0    3e-17   
ref|XP_010435285.1|  PREDICTED: probable serine incorporator          89.0    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010049722.1|  PREDICTED: probable serine incorporator          89.0    4e-17   Eucalyptus grandis [rose gum]
ref|XP_006285723.1|  hypothetical protein CARUB_v10007195mg           88.6    5e-17   Capsella rubella
ref|XP_010450223.1|  PREDICTED: probable serine incorporator          88.6    6e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010440600.1|  PREDICTED: probable serine incorporator          88.2    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002863245.1|  hypothetical protein ARALYDRAFT_497050           88.2    8e-17   
ref|XP_002324973.1|  TMS membrane family protein                      87.8    9e-17   
ref|NP_567403.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            87.8    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008362934.1|  PREDICTED: probable serine incorporator          87.8    1e-16   
gb|EXX70672.1|  Tms1p                                                 86.3    1e-16   Rhizophagus irregularis DAOM 197198w
ref|XP_004336528.1|  serine incorporator 3, putative                  88.2    1e-16   Acanthamoeba castellanii str. Neff
ref|XP_008224089.1|  PREDICTED: probable serine incorporator          87.8    1e-16   Prunus mume [ume]
emb|CDX93013.1|  BnaA03g37350D                                        87.4    2e-16   
ref|XP_004366977.1|  TMS membrane protein                             87.4    2e-16   Cavenderia fasciculata
ref|XP_002157067.2|  PREDICTED: probable serine incorporator-like     87.4    2e-16   Hydra vulgaris
ref|XP_004230114.1|  PREDICTED: probable serine incorporator          87.0    2e-16   Solanum lycopersicum
ref|XP_010469509.1|  PREDICTED: probable serine incorporator isof...  85.9    2e-16   
ref|XP_010542976.1|  PREDICTED: probable serine incorporator          87.0    2e-16   Tarenaya hassleriana [spider flower]
ref|NP_001240143.1|  uncharacterized protein LOC100788574             86.7    2e-16   Glycine max [soybeans]
ref|XP_003062471.1|  predicted protein                                87.4    2e-16   Micromonas pusilla CCMP1545
ref|XP_009107689.1|  PREDICTED: probable serine incorporator          86.7    3e-16   
ref|XP_011043440.1|  PREDICTED: probable serine incorporator          86.7    3e-16   Populus euphratica
ref|XP_003528920.1|  PREDICTED: probable serine incorporator-like     86.7    3e-16   Glycine max [soybeans]
ref|XP_006347785.1|  PREDICTED: probable serine incorporator-like...  86.7    3e-16   Solanum tuberosum [potatoes]
ref|XP_004301051.1|  PREDICTED: probable serine incorporator          86.7    3e-16   Fragaria vesca subsp. vesca
ref|XP_002515588.1|  conserved hypothetical protein                   86.3    3e-16   Ricinus communis
ref|XP_010532841.1|  PREDICTED: probable serine incorporator          86.3    3e-16   
ref|XP_006414928.1|  hypothetical protein EUTSA_v10025402mg           86.3    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_007226418.1|  hypothetical protein PRUPE_ppa023345mg           86.7    3e-16   Prunus persica
emb|CDY66714.1|  BnaCnng52050D                                        86.7    4e-16   Brassica napus [oilseed rape]
ref|NP_850202.4|  Serinc-domain containing serine and sphingolipi...  86.3    4e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AGG19193.1|  maternal effect embryo arrest 55-1                    86.3    4e-16   Dimocarpus longan [longan]
ref|XP_001625531.1|  predicted protein                                86.7    4e-16   Nematostella vectensis
ref|XP_009408948.1|  PREDICTED: probable serine incorporator          86.3    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009141295.1|  PREDICTED: probable serine incorporator isof...  86.3    5e-16   Brassica rapa
ref|XP_002994401.1|  hypothetical protein SELMODRAFT_449363           85.5    5e-16   Selaginella moellendorffii
ref|XP_010469504.1|  PREDICTED: probable serine incorporator isof...  85.9    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009493459.1|  hypothetical protein H696_01290                  81.6    6e-16   Fonticula alba
ref|XP_010469507.1|  PREDICTED: probable serine incorporator isof...  85.9    7e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009336936.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  84.0    7e-16   
ref|NP_849373.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            85.5    7e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KDD71727.1|  hypothetical protein H632_c4498p0                     82.4    8e-16   Helicosporidium sp. ATCC 50920
ref|XP_010469508.1|  PREDICTED: probable serine incorporator isof...  85.5    9e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006295917.1|  hypothetical protein CARUB_v10025054mg           85.1    1e-15   
emb|CBI33332.3|  unnamed protein product                              84.7    1e-15   Vitis vinifera
ref|XP_010650214.1|  PREDICTED: probable serine incorporator          84.7    2e-15   Vitis vinifera
gb|ESA19644.1|  hypothetical protein GLOINDRAFT_19362                 85.1    2e-15   
ref|XP_009352478.1|  PREDICTED: probable serine incorporator          84.0    2e-15   
gb|KHG16194.1|  Serine incorporator 3                                 84.0    3e-15   Gossypium arboreum [tree cotton]
ref|XP_010527190.1|  PREDICTED: probable serine incorporator          84.0    3e-15   Tarenaya hassleriana [spider flower]
gb|KJB54127.1|  hypothetical protein B456_009G023600                  83.6    3e-15   Gossypium raimondii
ref|XP_007152808.1|  hypothetical protein PHAVU_004G161400g           83.6    3e-15   Phaseolus vulgaris [French bean]
ref|XP_010413903.1|  PREDICTED: probable serine incorporator          84.0    3e-15   Camelina sativa [gold-of-pleasure]
ref|NP_741562.1|  Protein Y57E12AL.1, isoform b                       83.2    3e-15   
gb|KJB54130.1|  hypothetical protein B456_009G023600                  83.6    4e-15   Gossypium raimondii
ref|XP_010688168.1|  PREDICTED: probable serine incorporator          83.6    4e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002881267.1|  TMS membrane family protein                      83.6    4e-15   
ref|NP_741561.1|  Protein Y57E12AL.1, isoform a                       84.0    4e-15   Caenorhabditis elegans [roundworm]
ref|XP_004287083.1|  PREDICTED: probable serine incorporator isof...  83.2    4e-15   Fragaria vesca subsp. vesca
ref|XP_011458210.1|  PREDICTED: probable serine incorporator isof...  83.2    4e-15   Fragaria vesca subsp. vesca
dbj|GAM29010.1|  hypothetical protein SAMD00019534_121860             82.4    5e-15   Acytostelium subglobosum LB1
ref|XP_009381145.1|  PREDICTED: probable serine incorporator          83.2    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006297795.1|  hypothetical protein CARUB_v10013830mg           83.2    5e-15   Capsella rubella
ref|XP_007013230.1|  Serinc-domain containing serine and sphingol...  82.8    5e-15   
ref|XP_007013229.1|  Serinc-domain containing serine and sphingol...  82.8    5e-15   
ref|XP_010466851.1|  PREDICTED: probable serine incorporator          83.2    6e-15   Camelina sativa [gold-of-pleasure]
gb|KIH42470.1|  TMS membrane protein/tumor differentially express...  78.2    6e-15   Ancylostoma duodenale
gb|KEH21361.1|  serinc-domain serine and sphingolipid biosynthesi...  80.9    6e-15   Medicago truncatula
ref|XP_010440599.1|  PREDICTED: probable serine incorporator          78.2    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002885648.1|  TMS membrane family protein                      82.8    6e-15   
ref|XP_004512855.1|  PREDICTED: probable serine incorporator-like     82.8    6e-15   Cicer arietinum [garbanzo]
ref|XP_010513493.1|  PREDICTED: probable serine incorporator          82.8    7e-15   Camelina sativa [gold-of-pleasure]
gb|ESA13270.1|  hypothetical protein GLOINDRAFT_347023                81.6    7e-15   
ref|XP_010249828.1|  PREDICTED: probable serine incorporator          82.4    7e-15   Nelumbo nucifera [Indian lotus]
gb|EGT39434.1|  hypothetical protein CAEBREN_08033                    82.8    8e-15   Caenorhabditis brenneri
gb|EJW79555.1|  serine incorporator 2                                 82.4    8e-15   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_007013228.1|  Serinc-domain containing serine and sphingol...  82.4    8e-15   
gb|KDO54164.1|  hypothetical protein CISIN_1g0159802mg                81.3    8e-15   Citrus sinensis [apfelsine]
ref|XP_004665239.1|  PREDICTED: serine incorporator 2                 82.8    1e-14   
ref|NP_001141791.1|  hypothetical protein                             80.1    1e-14   
gb|KEH21360.1|  serinc-domain serine and sphingolipid biosynthesi...  80.9    1e-14   
ref|XP_004968422.1|  PREDICTED: probable serine incorporator-like...  82.0    1e-14   
gb|EXX52304.1|  Tms1p                                                 82.4    1e-14   
ref|XP_003136987.1|  hypothetical protein LOAG_01400                  82.4    1e-14   
ref|XP_009141296.1|  PREDICTED: probable serine incorporator isof...  82.0    1e-14   
ref|XP_006451100.1|  hypothetical protein CICLE_v10008536mg           81.6    1e-14   
ref|XP_003524388.1|  PREDICTED: probable serine incorporator-like...  81.6    1e-14   
ref|XP_002968524.1|  hypothetical protein SELMODRAFT_89240            81.6    1e-14   
ref|XP_006645562.1|  PREDICTED: probable serine incorporator-like     82.0    2e-14   
ref|XP_001901605.1|  TDE2 protein                                     82.0    2e-14   
gb|ETN74193.1|  TMS membrane protein/tumor differentially express...  82.0    2e-14   
gb|EGT35951.1|  hypothetical protein CAEBREN_13181                    82.0    2e-14   
ref|XP_008778515.1|  PREDICTED: serine incorporator 1-like            79.3    2e-14   
gb|ESA09597.1|  hypothetical protein GLOINDRAFT_80906                 81.6    2e-14   
ref|XP_003530635.1|  PREDICTED: probable serine incorporator isof...  81.3    2e-14   
ref|XP_010488550.1|  PREDICTED: probable serine incorporator          81.3    2e-14   
emb|CEP13524.1|  hypothetical protein                                 81.6    2e-14   
ref|XP_005665214.1|  PREDICTED: serine incorporator 2-like            77.4    2e-14   
gb|ENN78699.1|  hypothetical protein YQE_04871                        81.6    2e-14   
dbj|GAN07994.1|  TMS membrane protein/tumor differentially expres...  81.6    3e-14   
gb|EGT34050.1|  hypothetical protein CAEBREN_24071                    81.3    3e-14   
ref|XP_002602420.1|  hypothetical protein BRAFLDRAFT_117027           81.6    3e-14   
gb|EXX55775.1|  Tms1p                                                 81.3    3e-14   
ref|XP_011174068.1|  PREDICTED: probable serine incorporator          76.6    3e-14   
dbj|BAK01836.1|  predicted protein                                    81.3    3e-14   
ref|XP_010933234.1|  PREDICTED: serine incorporator 1                 80.5    3e-14   
gb|EPB88143.1|  hypothetical protein HMPREF1544_05087                 81.3    3e-14   
gb|KHN74385.1|  Serine incorporator 3                                 81.6    3e-14   
gb|ERL86825.1|  hypothetical protein D910_04228                       81.6    4e-14   
ref|XP_009613799.1|  PREDICTED: probable serine incorporator isof...  80.1    4e-14   
ref|XP_006418745.1|  hypothetical protein EUTSA_v10002545mg           80.5    4e-14   
ref|XP_010915041.1|  PREDICTED: probable serine incorporator          80.1    5e-14   
ref|XP_003114570.1|  hypothetical protein CRE_26972                   80.9    5e-14   
emb|CEG70157.1|  hypothetical protein RMATCC62417_06104               80.9    5e-14   
ref|XP_009613796.1|  PREDICTED: probable serine incorporator isof...  80.1    5e-14   
ref|XP_007034497.1|  Serinc-domain containing serine and sphingol...  80.9    6e-14   
ref|XP_007637556.1|  PREDICTED: serine incorporator 2 isoform X2      80.1    6e-14   
ref|XP_008342071.1|  PREDICTED: probable serine incorporator          80.1    6e-14   
ref|XP_008667561.1|  PREDICTED: hypothetical protein isoform X1       79.7    6e-14   
ref|XP_007624716.1|  PREDICTED: serine incorporator 2 isoform X1      80.1    7e-14   
gb|ACG46077.1|  TMS membrane protein/tumor differentially express...  79.7    7e-14   
gb|EGW01137.1|  Serine incorporator 2                                 79.7    7e-14   
gb|ERE85397.1|  serine incorporator 2-like protein                    80.1    7e-14   
ref|XP_002637793.1|  Hypothetical protein CBG04578                    80.1    8e-14   
gb|KJB06650.1|  hypothetical protein B456_001G003900                  79.7    8e-14   
ref|XP_009390129.1|  PREDICTED: probable serine incorporator          79.7    9e-14   
gb|KFH68151.1|  hypothetical protein MVEG_06880                       80.1    9e-14   
ref|XP_005079567.1|  PREDICTED: serine incorporator 2 isoform X1      79.7    1e-13   
gb|EYU43805.1|  hypothetical protein MIMGU_mgv1a018435mg              79.3    1e-13   
ref|XP_007318557.1|  hypothetical protein SERLADRAFT_356127           79.7    1e-13   
ref|NP_001042203.1|  Os01g0179800                                     79.3    1e-13   
ref|XP_010509918.1|  PREDICTED: probable serine incorporator          79.3    1e-13   
gb|EEC70050.1|  hypothetical protein OsI_00646                        79.3    1e-13   
ref|XP_009787199.1|  PREDICTED: probable serine incorporator isof...  79.0    1e-13   
ref|XP_003102359.1|  hypothetical protein CRE_05000                   79.3    1e-13   
ref|XP_007160349.1|  hypothetical protein PHAVU_002G314300g           79.0    1e-13   
gb|EEE53986.1|  hypothetical protein OsJ_00615                        79.3    1e-13   
ref|XP_006653583.1|  PREDICTED: probable serine incorporator-like     79.0    1e-13   
emb|CDJ97729.1|  TMS membrane protein tumour differentially expre...  78.6    1e-13   
ref|XP_005079568.1|  PREDICTED: serine incorporator 2 isoform X2      78.6    1e-13   
ref|XP_004167946.1|  PREDICTED: serine incorporator 1-like            77.0    2e-13   
ref|XP_006410459.1|  hypothetical protein EUTSA_v10016703mg           79.0    2e-13   
ref|XP_008458232.1|  PREDICTED: probable serine incorporator isof...  77.8    2e-13   
gb|EIE81637.1|  hypothetical protein RO3G_06342                       79.3    2e-13   
dbj|BAM19260.1|  membrane protein tms1d                               79.0    2e-13   
emb|CDJ92178.1|  TMS membrane protein tumour differentially expre...  79.0    2e-13   
ref|XP_007558462.1|  PREDICTED: serine incorporator 1-like            79.0    2e-13   
ref|XP_006492163.1|  PREDICTED: probable serine incorporator-like     78.6    2e-13   
ref|XP_010666477.1|  PREDICTED: probable serine incorporator isof...  77.8    2e-13   
ref|XP_004591703.1|  PREDICTED: serine incorporator 2 isoform X1      78.6    2e-13   
ref|XP_009267712.1|  Membrane protein TMS1                            78.6    2e-13   
ref|XP_004512960.1|  PREDICTED: probable serine incorporator-like     78.2    2e-13   
gb|KFH68448.1|  hypothetical protein MVEG_05263                       78.6    2e-13   
ref|XP_006420513.1|  hypothetical protein CICLE_v10006912mg           78.2    2e-13   
emb|CDP03356.1|  unnamed protein product                              78.2    2e-13   
ref|XP_008846447.1|  PREDICTED: serine incorporator 2                 78.6    2e-13   
ref|XP_010047750.1|  PREDICTED: probable serine incorporator isof...  78.2    2e-13   
gb|EYB93216.1|  hypothetical protein Y032_0184g1001                   78.2    2e-13   
ref|XP_008272011.1|  PREDICTED: serine incorporator 2                 78.6    2e-13   
ref|XP_004591704.1|  PREDICTED: serine incorporator 2 isoform X2      78.6    2e-13   
ref|XP_005353216.1|  PREDICTED: serine incorporator 2                 78.6    2e-13   
ref|XP_004134388.1|  PREDICTED: serine incorporator 3-like            78.6    2e-13   
gb|EYB93217.1|  hypothetical protein Y032_0184g1001                   78.2    2e-13   
gb|KFD55197.1|  hypothetical protein M513_03838                       79.0    3e-13   
gb|EPY77486.1|  hypothetical protein CB1_001251006                    74.7    3e-13   
ref|XP_002957018.1|  hypothetical protein VOLCADRAFT_77374            78.2    3e-13   
gb|KGN56781.1|  hypothetical protein Csa_3G133320                     78.2    3e-13   
ref|NP_766290.2|  serine incorporator 2 isoform 1 precursor           78.2    3e-13   
ref|XP_006503126.1|  PREDICTED: serine incorporator 2 isoform X1      78.2    3e-13   
ref|XP_010047746.1|  PREDICTED: probable serine incorporator isof...  78.2    3e-13   
ref|NP_001026826.1|  serine incorporator 2 precursor                  78.2    3e-13   
ref|NP_001240315.1|  serine incorporator 2 isoform 2                  77.8    3e-13   
ref|XP_008146179.1|  PREDICTED: serine incorporator 2 isoform X2      78.2    3e-13   
ref|XP_006734246.1|  PREDICTED: serine incorporator 2-like            76.6    3e-13   
ref|XP_010666475.1|  PREDICTED: probable serine incorporator isof...  77.8    3e-13   
ref|XP_002126357.1|  PREDICTED: serine incorporator 5-like            78.2    3e-13   
ref|NP_506611.1|  Protein R11H6.2                                     78.2    3e-13   
ref|XP_008438413.1|  PREDICTED: probable serine incorporator isof...  78.2    4e-13   
gb|ETE65034.1|  Serine incorporator 2                                 77.8    4e-13   
ref|XP_008146178.1|  PREDICTED: serine incorporator 2 isoform X1      77.8    4e-13   
ref|XP_002411145.1|  conserved hypothetical protein                   77.8    4e-13   
ref|XP_009688001.1|  PREDICTED: serine incorporator 2-like            77.4    4e-13   
gb|KJB37768.1|  hypothetical protein B456_006G219300                  77.4    4e-13   
ref|XP_004976160.1|  PREDICTED: probable serine incorporator-like     77.4    5e-13   
emb|CAP36379.2|  Protein CBG19072                                     77.8    5e-13   
sp|Q58CW5.1|SERC2_BOVIN  RecName: Full=Serine incorporator 2; Alt...  77.8    5e-13   
ref|XP_008458214.1|  PREDICTED: probable serine incorporator isof...  77.4    5e-13   
gb|KJB37769.1|  hypothetical protein B456_006G219300                  77.4    5e-13   
gb|KFK39759.1|  serinc-domain containing serine and sphingolipid ...  77.4    5e-13   
ref|XP_008458224.1|  PREDICTED: probable serine incorporator isof...  77.4    5e-13   
ref|XP_010264006.1|  PREDICTED: probable serine incorporator isof...  77.4    5e-13   
gb|KJB37767.1|  hypothetical protein B456_006G219300                  77.0    5e-13   
ref|XP_002637371.1|  Hypothetical protein CBG19072                    77.8    5e-13   
ref|XP_002448136.1|  hypothetical protein SORBIDRAFT_06g021920        77.4    5e-13   
dbj|BAC37344.1|  unnamed protein product                              73.9    5e-13   
gb|AAX46603.1|  tumor differentially expressed 2-like                 77.4    5e-13   
ref|XP_004139427.1|  PREDICTED: serine incorporator 1-like            77.0    5e-13   
ref|XP_002426175.1|  serine incorporator, putative                    77.4    5e-13   
ref|XP_005993191.1|  PREDICTED: serine incorporator 1-like            77.4    5e-13   
ref|XP_002455066.1|  hypothetical protein SORBIDRAFT_03g003750        77.4    5e-13   
gb|EEE61298.1|  hypothetical protein OsJ_15387                        77.8    5e-13   
ref|NP_001090209.1|  serine incorporator 1 precursor                  77.4    6e-13   
emb|CAH67268.1|  OSIGBa0145C12.5                                      77.0    6e-13   
gb|AIC61740.1|  SERINC2                                               72.8    6e-13   
gb|AAI26722.1|  SERINC2 protein                                       77.4    6e-13   
ref|XP_006340916.1|  PREDICTED: probable serine incorporator-like     77.0    6e-13   
ref|NP_593521.1|  sphingolipid biosynthesis protein (predicted)       77.4    6e-13   
ref|XP_008408640.1|  PREDICTED: serine incorporator 1-like            77.4    6e-13   
ref|XP_005676784.1|  PREDICTED: serine incorporator 2 isoform X1      77.4    6e-13   
ref|NP_001053258.1|  Os04g0506300                                     77.0    6e-13   
ref|XP_003738027.1|  PREDICTED: probable serine incorporator-like...  77.0    7e-13   
gb|AAH07375.2|  SERINC2 protein                                       73.2    7e-13   
ref|XP_007573353.1|  PREDICTED: serine incorporator 1-like            77.4    7e-13   
ref|NP_001030362.1|  serine incorporator 2                            76.6    8e-13   
ref|XP_007952319.1|  PREDICTED: serine incorporator 2                 77.0    8e-13   
ref|XP_007145428.1|  hypothetical protein PHAVU_007G238300g           77.0    8e-13   
ref|XP_004314553.1|  PREDICTED: serine incorporator 1                 76.3    8e-13   
ref|NP_001231077.1|  serine incorporator 2 precursor                  77.0    8e-13   
ref|XP_004741007.1|  PREDICTED: serine incorporator 2                 77.0    8e-13   
emb|CDY37743.1|  BnaA04g19250D                                        77.4    8e-13   
ref|XP_006680018.1|  hypothetical protein BATDEDRAFT_37095            77.0    8e-13   
emb|CEF63556.1|  TMS1                                                 77.0    8e-13   
ref|XP_011356110.1|  PREDICTED: serine incorporator 2 isoform X1      77.0    8e-13   
ref|XP_005959570.1|  PREDICTED: serine incorporator 2 isoform X2      77.0    9e-13   
ref|XP_011091387.1|  PREDICTED: probable serine incorporator          76.6    9e-13   
ref|XP_004422332.1|  PREDICTED: serine incorporator 1                 77.0    9e-13   
ref|NP_001037624.1|  membrane protein TMS1 precursor                  76.6    9e-13   
gb|KFV77205.1|  Serine incorporator 1                                 76.6    9e-13   
ref|XP_005959571.1|  PREDICTED: serine incorporator 2 isoform X3      76.6    9e-13   
gb|KFZ58338.1|  Serine incorporator 1                                 76.6    9e-13   
ref|XP_004312132.1|  PREDICTED: serine incorporator 2 isoform 3       76.6    1e-12   
ref|XP_005906241.1|  PREDICTED: serine incorporator 2 isoform X2      76.6    1e-12   
ref|XP_011134962.1|  PREDICTED: probable serine incorporator isof...  76.6    1e-12   
ref|XP_004005092.1|  PREDICTED: serine incorporator 2 isoform 3       76.6    1e-12   
ref|XP_004005091.1|  PREDICTED: serine incorporator 2 isoform 2       76.6    1e-12   
ref|XP_008064965.1|  PREDICTED: serine incorporator 2                 76.6    1e-12   
ref|XP_004612673.1|  PREDICTED: serine incorporator 3                 77.0    1e-12   
ref|XP_005676785.1|  PREDICTED: serine incorporator 2 isoform X2      76.6    1e-12   
ref|XP_006842248.1|  hypothetical protein AMTR_s00078p00195500        76.6    1e-12   
ref|XP_010166344.1|  PREDICTED: serine incorporator 1                 76.3    1e-12   
ref|XP_007534228.1|  PREDICTED: serine incorporator 2                 76.6    1e-12   
ref|XP_008579104.1|  PREDICTED: serine incorporator 2                 76.6    1e-12   
ref|XP_005911789.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...  76.6    1e-12   
ref|XP_004266597.1|  PREDICTED: serine incorporator 2 isoform 3       76.6    1e-12   
ref|XP_007454962.1|  PREDICTED: serine incorporator 1                 76.6    1e-12   
ref|XP_004263915.1|  PREDICTED: serine incorporator 1                 76.6    1e-12   
ref|XP_005959572.1|  PREDICTED: serine incorporator 2 isoform X4      76.3    1e-12   
ref|XP_005676787.1|  PREDICTED: serine incorporator 2 isoform X4      76.3    1e-12   
gb|KFM12545.1|  Serine incorporator 2                                 76.6    1e-12   
ref|XP_003638965.2|  PREDICTED: serine incorporator 2                 76.6    1e-12   
ref|XP_004312131.1|  PREDICTED: serine incorporator 2 isoform 2       76.6    1e-12   
ref|XP_004312133.1|  PREDICTED: serine incorporator 2 isoform 4       76.3    1e-12   
ref|XP_004266598.1|  PREDICTED: serine incorporator 2 isoform 4       76.3    1e-12   
ref|XP_009907826.1|  PREDICTED: serine incorporator 1                 76.6    1e-12   
ref|XP_005959569.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    1e-12   
gb|ELR48720.1|  Serine incorporator 2                                 76.6    1e-12   
ref|XP_005906240.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    1e-12   
ref|XP_002114508.1|  expressed hypothetical protein                   76.3    1e-12   
ref|XP_011356111.1|  PREDICTED: serine incorporator 2 isoform X2      76.3    1e-12   
gb|ERG80713.1|  serine incorporator 3                                 76.6    1e-12   
ref|XP_004312130.1|  PREDICTED: serine incorporator 2 isoform 1       76.6    1e-12   
gb|AAQ88795.1|  GSVL396                                               76.6    1e-12   
ref|XP_003228070.1|  PREDICTED: serine incorporator 2                 76.6    1e-12   
ref|XP_008319400.1|  PREDICTED: serine incorporator 1-like            76.6    1e-12   
ref|XP_004266596.1|  PREDICTED: serine incorporator 2 isoform 2       76.6    1e-12   
ref|XP_007897489.1|  PREDICTED: serine incorporator 1                 76.6    1e-12   
ref|XP_009284929.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_004266595.1|  PREDICTED: serine incorporator 2 isoform 1       76.3    1e-12   
ref|XP_004642983.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_011304466.1|  PREDICTED: probable serine incorporator isof...  76.3    1e-12   
ref|XP_006767103.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    1e-12   
ref|XP_005906242.1|  PREDICTED: serine incorporator 2 isoform X3      75.9    1e-12   
ref|XP_007128527.1|  PREDICTED: serine incorporator 2                 75.9    1e-12   
ref|XP_006767104.1|  PREDICTED: serine incorporator 2 isoform X2      76.3    1e-12   
gb|KIJ14234.1|  hypothetical protein PAXINDRAFT_163421                76.3    1e-12   
ref|XP_007145427.1|  hypothetical protein PHAVU_007G238300g           76.3    1e-12   
ref|XP_010974399.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    1e-12   
ref|XP_004005090.1|  PREDICTED: serine incorporator 2 isoform 1       75.9    1e-12   
ref|XP_005875118.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    1e-12   
gb|EKC27359.1|  DNA/RNA-binding protein KIN17                         74.7    1e-12   
ref|XP_006767105.1|  PREDICTED: serine incorporator 2 isoform X3      75.9    1e-12   
ref|XP_010835380.1|  PREDICTED: serine incorporator 2                 75.9    1e-12   
ref|XP_001836185.1|  membrane protein                                 75.9    1e-12   
ref|XP_006102950.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
gb|KJB06649.1|  hypothetical protein B456_001G003900                  75.9    1e-12   
gb|EPQ13210.1|  Serine incorporator 2                                 75.9    2e-12   
ref|XP_003937635.1|  PREDICTED: serine incorporator 2                 76.3    2e-12   
ref|XP_005875119.1|  PREDICTED: serine incorporator 2 isoform X2      75.9    2e-12   
ref|XP_004406452.1|  PREDICTED: serine incorporator 2                 76.3    2e-12   
ref|XP_010950491.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    2e-12   
ref|XP_002155155.2|  PREDICTED: probable serine incorporator-like     74.7    2e-12   
gb|KIK77929.1|  hypothetical protein PAXRUDRAFT_834805                76.3    2e-12   
ref|XP_006176241.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    2e-12   
ref|XP_003977493.1|  PREDICTED: serine incorporator 1-like isoform 1  75.9    2e-12   
ref|XP_006196964.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    2e-12   
ref|XP_007190839.1|  PREDICTED: serine incorporator 1                 75.9    2e-12   
ref|NP_001011399.1|  serine incorporator 1 precursor                  75.9    2e-12   
ref|XP_006605737.1|  PREDICTED: probable serine incorporator-like...  75.9    2e-12   
ref|XP_011304467.1|  PREDICTED: probable serine incorporator isof...  75.9    2e-12   



>ref|XP_009354238.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009354239.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370970.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370971.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVL
Sbjct  234  LHPAVNGSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPP SPRAG GKPLLPLDK DEHEE EKSK V+YSYSFFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPGSPRAGAGKPLLPLDKVDEHEEKEKSKPVSYSYSFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TA L++WSL+APILFP+R+F
Sbjct  354  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRMVTGWATAGLYIWSLLAPILFPEREF  413



>ref|XP_011073234.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073235.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073236.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHPSV GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST +L LGLLTTVL
Sbjct  234  LHPSVSGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSSLALGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEH EE EKSK VTYSYSFFH+IF
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGSGKPLLPLDKADEHHEEAEKSKPVTYSYSFFHLIF  353

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++T W TAALF+WSLVAPI+FPDR+
Sbjct  354  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITSWATAALFIWSLVAPIIFPDRE  413

Query  169  F  167
            F
Sbjct  414  F  414



>ref|XP_007215456.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16655.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=397

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVL
Sbjct  218  LHPAVNGSILPASVISMYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVL  277

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEHEE EK+K V+YSYSFFHIIFS
Sbjct  278  SVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKADEHEEKEKAKPVSYSYSFFHIIFS  337

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW+TSVGESGKLVDVGW SVWVR+VT W TA LF+WSL+APILFP+R+F
Sbjct  338  LASMYSAMLLTGWTTSVGESGKLVDVGWPSVWVRIVTSWATAGLFIWSLLAPILFPEREF  397



>ref|XP_007215457.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 ref|XP_007215458.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16656.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16657.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=413

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVL
Sbjct  234  LHPAVNGSILPASVISMYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEHEE EK+K V+YSYSFFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKADEHEEKEKAKPVSYSYSFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW+TSVGESGKLVDVGW SVWVR+VT W TA LF+WSL+APILFP+R+F
Sbjct  354  LASMYSAMLLTGWTTSVGESGKLVDVGWPSVWVRIVTSWATAGLFIWSLLAPILFPEREF  413



>ref|XP_008228861.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228862.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228863.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228864.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=413

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVL
Sbjct  234  LHPAVNGSILPASVISMYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEHEE EK+K V+YSYSFFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKADEHEEKEKAKPVSYSYSFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW+TSVGESGKLVDVGW SVWVR+VT W TA LF+WSL+APILFP+R+F
Sbjct  354  LASMYSAMLLTGWTTSVGESGKLVDVGWPSVWVRIVTSWATAGLFIWSLLAPILFPEREF  413



>ref|XP_006493450.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
Length=413

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVL
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  354  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  413



>ref|XP_006427689.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
 gb|ESR40929.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
Length=413

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVISLYC YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVL
Sbjct  234  LHPAVGGSVLPASVISLYCMYLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  354  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  413



>gb|KJB67006.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67007.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67008.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67009.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67010.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67011.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67013.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=412

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 170/180 (94%), Gaps = 1/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V  SI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGT+T+GLLTT+L
Sbjct  234  LHPAVGSSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTVTVGLLTTIL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLPLDKADE EE EK+KAVTYSY+FFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLPLDKADE-EEKEKNKAVTYSYAFFHIIFS  352

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVW+R++T WVTAAL++WSL+APILFPDRDF
Sbjct  353  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWIRILTAWVTAALYMWSLLAPILFPDRDF  412



>gb|KHG09631.1| Serine incorporator 3 [Gossypium arboreum]
Length=413

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVL
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP+DKADEHEE EK+K V+YSY+FFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  354  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYIWSLVAPILFPEREF  413



>ref|XP_008342757.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVL
Sbjct  234  LHPAVSGSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPP SPRAG GKPLLPLDK DEH+E EKSK V+YSYSFFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPGSPRAGAGKPLLPLDKVDEHKEKEKSKPVSYSYSFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L++WSL+APILFP+R+F
Sbjct  354  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRMVTSWATAGLYIWSLLAPILFPEREF  413



>ref|XP_008381162.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHPSV GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVL
Sbjct  234  LHPSVSGSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPR+G GKPLLPLDK DEHEE EKSK V+YSYSFFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRSGAGKPLLPLDKVDEHEEKEKSKPVSYSYSFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWS SVGESGKLVDVGW SVWVR+VT W TA L++WSL+APILFP+R+F
Sbjct  354  LASMYSAMLLTGWSASVGESGKLVDVGWPSVWVRMVTSWATAGLYIWSLLAPILFPEREF  413



>gb|KJB68287.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVL
Sbjct  232  LHPAVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVL  291

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP+DKADEHEE EK+K V+YSY+FFHIIFS
Sbjct  292  SVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFS  351

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  352  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLVAPILFPEREF  411



>gb|KJB68285.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68288.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68289.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=413

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVL
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP+DKADEHEE EK+K V+YSY+FFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  354  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLVAPILFPEREF  413



>ref|XP_004158797.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
 gb|KGN45209.1| hypothetical protein Csa_7G431410 [Cucumis sativus]
Length=411

 Score =   246 bits (629),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 169/180 (94%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGTL+LGLLTTVL
Sbjct  234  LHPAVGGSVLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTLSLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPL+KADEHEE EKSK VTYSYSFFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAG--KPLLPLEKADEHEEKEKSKPVTYSYSFFHIIFS  351

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW+TSVG SG+LVDVGWASVWVRVVTGW TAALF+WSL+AP+LFPDRDF
Sbjct  352  LASMYSAMLLTGWTTSVGGSGRLVDVGWASVWVRVVTGWATAALFIWSLIAPVLFPDRDF  411



>ref|XP_009365247.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009365248.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHPSV GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLT GLLTTVL
Sbjct  234  LHPSVSGSILPASVISMYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTFGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPP+SPR+G GKPLLPLDK DEHEE EKSK V+YSY+FFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPNSPRSGAGKPLLPLDKVDEHEEKEKSKPVSYSYAFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWS SVGESGKLVDVGW SVWVR+VT W TA L++WSL+APILFP+R+F
Sbjct  354  LASMYSAMLLTGWSASVGESGKLVDVGWPSVWVRMVTSWATAGLYIWSLLAPILFPEREF  413



>gb|KDO36650.1| hypothetical protein CISIN_1g028965mg [Citrus sinensis]
Length=201

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  685  SIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaV  506
            +I PASVISLYC YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVLSVVYSAV
Sbjct  29   AILPASVISLYCMYLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAV  88

Query  505  RAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSA  326
            RAGSSTTLLSPPSSPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFSLASMYSA
Sbjct  89   RAGSSTTLLSPPSSPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYSA  148

Query  325  MLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MLLTGWSTSVGESGKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  149  MLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  201



>ref|XP_007024820.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 ref|XP_007024821.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27442.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27443.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
Length=413

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLT GLLTTVL
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTFGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG GK LLPLDKADE EE +K+K VTYSY+FFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGAGKSLLPLDKADEQEEKDKNKPVTYSYAFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L+LWSL+APILFP+R+F
Sbjct  354  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYLWSLIAPILFPEREF  413



>ref|XP_009759114.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009759115.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   241 bits (616),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LHPSV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTV
Sbjct  233  TLHPSVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTV  292

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            LSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IF
Sbjct  293  LSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+
Sbjct  353  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDRE  412

Query  169  F  167
            F
Sbjct  413  F  413



>ref|XP_010318692.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
Length=413

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LHPSV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+GTL LGLLTTV
Sbjct  233  TLHPSVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGTLALGLLTTV  292

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            LSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E+SK V+YSYSFFH+IF
Sbjct  293  LSVVYSAVRAGSSTTLLSPPSSPRAGSGKPLLPLDKVDEEEEKERSKPVSYSYSFFHLIF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+
Sbjct  353  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDRE  412

Query  169  F  167
            F
Sbjct  413  F  413



>ref|XP_009615680.1| PREDICTED: serine incorporator 3 isoform X2 [Nicotiana tomentosiformis]
Length=413

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LHPSV+GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTV
Sbjct  233  TLHPSVRGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTV  292

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            LSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IF
Sbjct  293  LSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+
Sbjct  353  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPERE  412

Query  169  F  167
            F
Sbjct  413  F  413



>ref|XP_011466994.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466995.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466996.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466997.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
Length=414

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YCTYLCYSALASEPRDYECN+LHKHSK+VSTGTLTLGLLTTVL
Sbjct  235  LHPTVGGSILPASVISVYCTYLCYSALASEPRDYECNSLHKHSKAVSTGTLTLGLLTTVL  294

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK +E EE EK+K+V+YSY+FFHIIFS
Sbjct  295  SVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKPEEREENEKAKSVSYSYAFFHIIFS  354

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKL+DVGW SVWVRV+T W TA L++WSL+APILFP+R+F
Sbjct  355  LASMYSAMLLTGWSTSVGESGKLIDVGWPSVWVRVMTSWATAGLYIWSLLAPILFPEREF  414



>ref|XP_009615679.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LHPSV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTV
Sbjct  233  TLHPSVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTV  292

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            LSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IF
Sbjct  293  LSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+
Sbjct  353  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPERE  412

Query  169  F  167
            F
Sbjct  413  F  413



>gb|KJB68286.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 168/180 (93%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGTLTLGLLTTVL
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP+DKADEHEE EK+K V+YSY+FFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAG--KPLLPMDKADEHEEKEKNKPVSYSYAFFHIIFS  351

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFP+R+F
Sbjct  352  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLVAPILFPEREF  411



>ref|XP_006341429.1| PREDICTED: probable serine incorporator-like isoform X1 [Solanum 
tuberosum]
Length=413

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHPSV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+GTL LGLLTTVL
Sbjct  234  LHPSVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGTLALGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK DE EE E+SK V+YSYSFFH+IFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERSKPVSYSYSFFHLIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGE+G LVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  354  LASMYSAMLLTGWSTSVGENGNLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  413



>gb|AFK43836.1| unknown [Medicago truncatula]
Length=190

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 162/180 (90%), Gaps = 3/180 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS YC YLCYSALASEPRDYECN LHKHSK+VSTG+LTLGL+TTVL
Sbjct  14   LHPAVNGSVLPASVISFYCMYLCYSALASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVL  73

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSS T+LSPPSSPRAG  KPLLPLD  DE E  EK+K VTYSY+FFH+IFS
Sbjct  74   SVVYSAVRAGSSATVLSPPSSPRAG--KPLLPLDAKDE-ESNEKAKPVTYSYAFFHLIFS  130

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  131  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  190



>ref|XP_004135884.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
Length=422

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 166/186 (89%), Gaps = 8/186 (4%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltl------g  545
            LHP+V GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGTL+L       
Sbjct  239  LHPAVGGSVLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTLSLGLLTTVL  298

Query  544  llttvlsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSF  365
             LTTVLSVVYSAVRAGSSTTLLSPPSSP AG  KPLLPL+KADEHEE EKSK VTYSYSF
Sbjct  299  SLTTVLSVVYSAVRAGSSTTLLSPPSSPYAG--KPLLPLEKADEHEEKEKSKPVTYSYSF  356

Query  364  FHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            FHIIFSLASMYSAMLLTGW+TSVG SG+LVDVGWASVWVRVVTGW TAALF+WSL+AP+L
Sbjct  357  FHIIFSLASMYSAMLLTGWTTSVGGSGRLVDVGWASVWVRVVTGWATAALFIWSLIAPVL  416

Query  184  FPDRDF  167
            FPDRDF
Sbjct  417  FPDRDF  422



>ref|XP_009759116.1| PREDICTED: probable serine incorporator isoform X2 [Nicotiana 
sylvestris]
Length=411

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 167/181 (92%), Gaps = 2/181 (1%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LHPSV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTV
Sbjct  233  TLHPSVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTV  292

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            LSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPLDK DE EE E++K VTYSYSFFH+IF
Sbjct  293  LSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERAKPVTYSYSFFHLIF  350

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+
Sbjct  351  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDRE  410

Query  169  F  167
            F
Sbjct  411  F  411



>gb|EYU21792.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21793.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21794.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=416

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 167/184 (91%), Gaps = 3/184 (2%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LHPSV GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST +L LGLLTTV
Sbjct  233  TLHPSVSGSLLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSSLGLGLLTTV  292

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFH  359
            LSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADEH E E+    +AVTYSYSFFH
Sbjct  293  LSVVYSAVRAGSSTTLLSPPSSPRAGSGKPLLPLDKADEHHEEEEKSKSRAVTYSYSFFH  352

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR++T W TAALF+WSLVAPILFP
Sbjct  353  LIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRIITSWATAALFIWSLVAPILFP  412

Query  178  DRDF  167
            DR+F
Sbjct  413  DREF  416



>ref|XP_002270610.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 ref|XP_010655133.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 emb|CBI25248.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASV+SLYC YLCYS L+SEPRDYECN LHKHSK+VSTGTLTLGLLTT+L
Sbjct  234  LHPAVGGSILPASVVSLYCMYLCYSGLSSEPRDYECNGLHKHSKAVSTGTLTLGLLTTIL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SV+YSAVRAGSSTTLLSPPSSPRAG GKPLLPL+K D  EE  ++K VTYSY+FFHIIFS
Sbjct  294  SVIYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLEKTDVPEEKHEAKPVTYSYTFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  354  LASMYSAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  413



>ref|XP_011020548.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=415

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 165/182 (91%), Gaps = 2/182 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVISLYC YLCYS LASEPR+YECN LH+HSK+VSTGTL++GLLTTVL
Sbjct  234  LHPAVNGSVLPASVISLYCMYLCYSGLASEPREYECNGLHRHSKAVSTGTLSIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKS-KAVTYSYSFFHII  353
            SVVYSAVRAGSST LLSPPSSPRAG  KPLLPLD KA+E EE EK+ K VTYSYSFFHII
Sbjct  294  SVVYSAVRAGSSTALLSPPSSPRAGADKPLLPLDNKANEQEEKEKARKPVTYSYSFFHII  353

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMYSAMLLTGWSTS+GESGKLVDVGW SVWVR++TGW TA L+ WSLVAPILFPDR
Sbjct  354  FSLASMYSAMLLTGWSTSIGESGKLVDVGWPSVWVRILTGWATAGLYTWSLVAPILFPDR  413

Query  172  DF  167
            +F
Sbjct  414  EF  415



>ref|XP_009615681.1| PREDICTED: probable serine incorporator isoform X3 [Nicotiana 
tomentosiformis]
Length=411

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 167/181 (92%), Gaps = 2/181 (1%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LHPSV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+G+L LGLLTTV
Sbjct  233  TLHPSVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGSLALGLLTTV  292

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            LSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPLDK DE EE E++K VTYSYSFFH+IF
Sbjct  293  LSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERAKPVTYSYSFFHLIF  350

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+
Sbjct  351  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPERE  410

Query  169  F  167
            F
Sbjct  411  F  411



>ref|XP_011082649.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LHPSV GSI P+SVISLYC YLCYS LASEPRDYECN LH+HSK+VST +L +GLLTTV
Sbjct  233  TLHPSVSGSILPSSVISLYCMYLCYSGLASEPRDYECNGLHRHSKAVSTSSLAIGLLTTV  292

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHII  353
            LSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDKADE  E ++    VTYSYSFFH+I
Sbjct  293  LSVVYSAVRAGSSTTLLSPPSSPRAGSGKPLLPLDKADEEHEEKEKSKPVTYSYSFFHLI  352

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WSLVAPI+FPDR
Sbjct  353  FSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSLVAPIIFPDR  412

Query  172  DF  167
            +F
Sbjct  413  EF  414



>gb|EMS53525.1| putative serine incorporator [Triticum urartu]
Length=316

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK++STG+LTLGL TT+L
Sbjct  137  LHPKVNGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAMSTGSLTLGLCTTIL  196

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSS T+LS P SPRAG  KPLLP  KADE E  +  K VTYSYSFFH+IFS
Sbjct  197  SVVYSAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEETKDVPKPVTYSYSFFHLIFS  256

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  257  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPLLFPDREF  316



>ref|XP_006341430.1| PREDICTED: probable serine incorporator-like isoform X2 [Solanum 
tuberosum]
Length=411

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 166/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHPSV GSI PASV+SLYCTYLCYSALASEPRDYECN LHKHSK+VS+GTL LGLLTTVL
Sbjct  234  LHPSVGGSILPASVLSLYCTYLCYSALASEPRDYECNGLHKHSKAVSSGTLALGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPLDK DE EE E+SK V+YSYSFFH+IFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERSKPVSYSYSFFHLIFS  351

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGE+G LVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  352  LASMYSAMLLTGWSTSVGENGNLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  411



>ref|XP_007140603.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
 gb|ESW12597.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
Length=410

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 164/180 (91%), Gaps = 3/180 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGT+T+GL+TTVL
Sbjct  234  LHPAVNGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTVTMGLVTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSS  +LSPPSSPRAG  KPLLPLD A E E+ EK+K VTYSY+FFH+IFS
Sbjct  294  SVVYSAVRAGSSAAVLSPPSSPRAG--KPLLPLD-AREEEDKEKAKPVTYSYAFFHLIFS  350

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  351  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTSWATALLYLWSLVAPIMFPEREF  410



>gb|ABR25551.1| serine incorporator 3 [Oryza sativa Indica Group]
Length=220

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP + GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+L
Sbjct  40   LHPKINGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTIL  99

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IF
Sbjct  100  SVVYSAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIF  159

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+
Sbjct  160  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDRE  219

Query  169  F  167
            F
Sbjct  220  F  220



>ref|XP_008461193.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Cucumis melo]
Length=416

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 136/183 (74%), Gaps = 3/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP++ GS+ PASVISLYC YLCYS LASEPRDYECN LHKHS  +S GT  + + +   
Sbjct  234  LHPAIGGSVLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSVEISCGTSXISISSKEG  293

Query  526  svvysaVRAGssttllsppssPRAG---GGKPLLPLDKADEHEEMEKSKAVTYSYSFFHI  356
                       S                 GKPLLPL+K+DEHEE EKSK VTYSYSFFHI
Sbjct  294  DFFSLHFVCSVSYIEFIRCHILDFSIKWAGKPLLPLEKSDEHEEKEKSKPVTYSYSFFHI  353

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IFSLASMYSAMLLTGW+TSVG SGKLVDVGWASVWVR+VTGW TAALF+WSL+AP+LFPD
Sbjct  354  IFSLASMYSAMLLTGWTTSVGGSGKLVDVGWASVWVRIVTGWATAALFIWSLIAPVLFPD  413

Query  175  RDF  167
            RDF
Sbjct  414  RDF  416



>ref|XP_009399576.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PAS+ISLYCTYLCYS L+SEPRDYECN LH HSK VSTG+LTLGLLTTVL
Sbjct  234  LHPKVNGSLLPASIISLYCTYLCYSGLSSEPRDYECNGLHNHSKVVSTGSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM--EKSKAVTYSYSFFHII  353
            SVVYSAVRAGSST+L SPPSSPRAG  KPLLP DK DE E+   +++K V+YSY+FFH+I
Sbjct  294  SVVYSAVRAGSSTSLFSPPSSPRAGSEKPLLPFDKLDEQEDKKNDEAKPVSYSYTFFHLI  353

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMYSAMLLTGWSTSVGESGKL+DVGW SVWVR+VTGW TAALF+WSLVAP++FPDR
Sbjct  354  FSLASMYSAMLLTGWSTSVGESGKLIDVGWPSVWVRIVTGWATAALFMWSLVAPLIFPDR  413

Query  172  DF  167
            +F
Sbjct  414  EF  415



>gb|KDP41926.1| hypothetical protein JCGZ_26944 [Jatropha curcas]
Length=413

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 164/182 (90%), Gaps = 4/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YC YLCYS LASEPRDYECN LHKHSK+VSTGTLT+GL TTVL
Sbjct  234  LHPAVNGSILPASVISVYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTLTVGLFTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKA--DEHEEMEKSKAVTYSYSFFHII  353
            SVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPL+ +  + HEE +K K VTYSY+FFHII
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAG--KPLLPLENSTGEHHEEKDKVKPVTYSYAFFHII  351

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRV+TGW TA L+LWSLVAPI+FPDR
Sbjct  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVITGWATAGLYLWSLVAPIMFPDR  411

Query  172  DF  167
            +F
Sbjct  412  EF  413



>ref|XP_010268463.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=414

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYCTYLC+S LASEPRDYECN  H+H+K+VSTGTLTLGL TTVL
Sbjct  234  LHPAVGGSILPASVISLYCTYLCFSGLASEPRDYECNGFHRHTKAVSTGTLTLGLFTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDK-ADEHEEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLL  P SPR G  KPLLP++K ADE E+ ++++ VTYSY+FFH+IF
Sbjct  294  SVVYSAVRAGSSTTLLLEPDSPRGGADKPLLPMNKTADEDEKKDEARPVTYSYAFFHVIF  353

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESG LVDVGW SVWVR+VTGWVTAAL++WSLVAP+LFP+R+
Sbjct  354  SLASMYSAMLLTGWSTSVGESGNLVDVGWPSVWVRIVTGWVTAALYIWSLVAPLLFPERE  413

Query  169  F  167
            F
Sbjct  414  F  414



>ref|XP_004492298.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=410

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHPSV GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGL+TTVL
Sbjct  234  LHPSVNGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLVTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSS T+LSPPSSPRAG  KPLLPLD   E E  EK+K VTYSY+FFH+IFS
Sbjct  294  SVVYSAVRAGSSATVLSPPSSPRAG--KPLLPLD-VKEEESNEKAKPVTYSYAFFHLIFS  350

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  351  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  410



>gb|EMT13726.1| Putative serine incorporator [Aegilops tauschii]
Length=414

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK++STG+LTLGL TT+L
Sbjct  235  LHPKVNGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAMSTGSLTLGLCTTIL  294

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSS T+LS P SPRAG  KPLLP  KADE E  +  K VTYSYSFFH+IFS
Sbjct  295  SVVYSAVRAGSSATVLSAPDSPRAGSDKPLLPFSKADEEETKDVPKPVTYSYSFFHLIFS  354

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  355  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPLLFPDREF  414



>gb|KDO36651.1| hypothetical protein CISIN_1g028965mg [Citrus sinensis]
Length=161

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  646  YLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGssttllspps  467
            YLCYS L+SEPRDYECN LH+HSK+VSTG+LTLGL+TTVLSVVYSAVRAGSSTTLLSPPS
Sbjct  2    YLCYSGLSSEPRDYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAVRAGSSTTLLSPPS  61

Query  466  sPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGES  287
            SPRAGGGKPLLP+DKADE EE EK+K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGES
Sbjct  62   SPRAGGGKPLLPMDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGES  121

Query  286  GKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            GKLVDVGW SVWVR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  122  GKLVDVGWPSVWVRILTGWATAALYMWSLVAPILFPDREF  161



>gb|EYU21795.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=414

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 166/184 (90%), Gaps = 5/184 (3%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LHPSV GS+ PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST +L LGLLTTV
Sbjct  233  TLHPSVSGSLLPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSSLGLGLLTTV  292

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFH  359
            LSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPLDKADEH E E+    +AVTYSYSFFH
Sbjct  293  LSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLPLDKADEHHEEEEKSKSRAVTYSYSFFH  350

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR++T W TAALF+WSLVAPILFP
Sbjct  351  LIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRIITSWATAALFIWSLVAPILFP  410

Query  178  DRDF  167
            DR+F
Sbjct  411  DREF  414



>ref|XP_010687311.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687312.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDY+CN LHKHS++VST +LTLGLLTTVL
Sbjct  234  LHPAVNGSILPASVISLYCMYLCYSGLASEPRDYQCNGLHKHSQAVSTTSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG G+PLLPLDK  E EE EK+K V+YSYSFFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGAGRPLLPLDKVAEEEEKEKAKPVSYSYSFFHIIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGW+TSVGESGKLVDVGW+SVWVR+VTGW TAAL++WSLVAP LFPDR+F
Sbjct  354  LASMYSAMLLTGWTTSVGESGKLVDVGWSSVWVRIVTGWATAALYIWSLVAPSLFPDREF  413



>gb|AFK46909.1| unknown [Lotus japonicus]
Length=353

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 161/180 (89%), Gaps = 3/180 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI P+SVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGLLTT L
Sbjct  177  LHPAVNGSILPSSVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLLTTTL  236

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSS T+LSPPSSPRAG  KPLLPLD  +E E+ EK K VTYSYSFFH+IFS
Sbjct  237  SVVYSAVRAGSSATVLSPPSSPRAG--KPLLPLD-GNEEEKNEKGKPVTYSYSFFHLIFS  293

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMY AMLLTGWS SVGESGKLVDVGW SVWVR+VT W TA LFLWSLVAPI+FP+R+F
Sbjct  294  LASMYFAMLLTGWSPSVGESGKLVDVGWPSVWVRIVTCWATAILFLWSLVAPIMFPEREF  353



>gb|KEH22798.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=410

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 162/180 (90%), Gaps = 3/180 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS YC YLCYSALASEPRDYECN LHKHSK+VSTG+LTLGL+TTVL
Sbjct  234  LHPAVNGSVLPASVISFYCMYLCYSALASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSS T+LSPPSSPRAG  KPLLPLD  DE E  EK+K VTYSY+FFH+IFS
Sbjct  294  SVVYSAVRAGSSATVLSPPSSPRAG--KPLLPLDAKDE-ESNEKAKPVTYSYAFFHLIFS  350

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  351  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  410



>gb|KEH22799.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=427

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 162/180 (90%), Gaps = 3/180 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS YC YLCYSALASEPRDYECN LHKHSK+VSTG+LTLGL+TTVL
Sbjct  251  LHPAVNGSVLPASVISFYCMYLCYSALASEPRDYECNGLHKHSKAVSTGSLTLGLVTTVL  310

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSS T+LSPPSSPRAG  KPLLPLD  DE E  EK+K VTYSY+FFH+IFS
Sbjct  311  SVVYSAVRAGSSATVLSPPSSPRAG--KPLLPLDAKDE-ESNEKAKPVTYSYAFFHLIFS  367

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  368  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTCWATALLYLWSLVAPIMFPEREF  427



>ref|XP_010107188.1| putative serine incorporator [Morus notabilis]
 gb|EXC14084.1| putative serine incorporator [Morus notabilis]
Length=413

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PAS+ISLYCTYLCYSALASEPR+YECN LHKHSK+VSTGTLTLGLLTTVL
Sbjct  234  LHPTVSGSILPASIISLYCTYLCYSALASEPREYECNGLHKHSKAVSTGTLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK +EHEE EK+K VTYSYSFFH+IFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKVEEHEEKEKAKPVTYSYSFFHLIFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  354  LASMYSAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  413



>ref|XP_003570284.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=414

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP + GS+ PASVI+LYCTYLCYSAL+SEPRDY+CN LH HSK++STG+LTLGL+TT+L
Sbjct  234  LHPKINGSLLPASVIALYCTYLCYSALSSEPRDYKCNGLHNHSKAMSTGSLTLGLITTIL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHE-EMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSS T+LS P SPRAG  KPLLP  KADE E + +  K VTYSYSFFH+IF
Sbjct  294  SVVYSAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEEAKKDVPKPVTYSYSFFHLIF  353

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAPILFPDR+
Sbjct  354  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRMATQWATAGLFVWSLVAPILFPDRE  413

Query  169  F  167
            F
Sbjct  414  F  414



>emb|CDO98258.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LHPSV GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VST TLT+GLLTTV
Sbjct  233  TLHPSVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTSTLTIGLLTTV  292

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            LSVVYSAVRAGSSTTLLSP        GKPLLPLDKAD+ EE EK+K VTYSYSFFH+IF
Sbjct  293  LSVVYSAVRAGSSTTLLSPSPPSSPRAGKPLLPLDKADKEEEKEKAKPVTYSYSFFHLIF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR+VTGW TAALFLWSLVAPILFPDR+
Sbjct  353  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRIVTGWATAALFLWSLVAPILFPDRE  412

Query  169  F  167
            F
Sbjct  413  F  413



>ref|XP_006649122.1| PREDICTED: probable serine incorporator-like, partial [Oryza 
brachyantha]
Length=384

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP + GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+L
Sbjct  204  LHPKINGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTIL  263

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IF
Sbjct  264  SVVYSAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIF  323

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+
Sbjct  324  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDRE  383

Query  169  F  167
            F
Sbjct  384  F  384



>gb|EAZ24909.1| hypothetical protein OsJ_08689 [Oryza sativa Japonica Group]
Length=414

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP + GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+L
Sbjct  234  LHPKINGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTIL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IF
Sbjct  294  SVVYSAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIF  353

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+
Sbjct  354  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDRE  413

Query  169  F  167
            F
Sbjct  414  F  414



>ref|NP_001048364.1| Os02g0792900 [Oryza sativa Japonica Group]
 dbj|BAD19186.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAD19654.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAF10278.1| Os02g0792900 [Oryza sativa Japonica Group]
 gb|EAY87831.1| hypothetical protein OsI_09251 [Oryza sativa Indica Group]
 dbj|BAG96913.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97616.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP + GS+ PASVI+LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+L+LGLLTT+L
Sbjct  234  LHPKINGSLLPASVIALYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLSLGLLTTIL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEH-EEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSS T+LS P SPRAG  KPLLP  KADE  E+ +  + VTYSYSFFH+IF
Sbjct  294  SVVYSAVRAGSSATVLSAPDSPRAGADKPLLPFSKADEEAEKKDVPRPVTYSYSFFHLIF  353

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA L++WSLVAP+LFPDR+
Sbjct  354  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLYIWSLVAPLLFPDRE  413

Query  169  F  167
            F
Sbjct  414  F  414



>ref|XP_008790112.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
 ref|XP_008778863.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
Length=415

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASV+SLYC YLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVL
Sbjct  234  LHPKVNGSLLPASVLSLYCAYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHII  353
            SVVYSAVRAGSST++LSPPSSPRAG  KPLLP DK ++ E+ +K  +K V+YSYSFF++I
Sbjct  294  SVVYSAVRAGSSTSVLSPPSSPRAGSEKPLLPFDKVEQQEDRKKDEAKPVSYSYSFFYLI  353

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VT W TAAL++WSL+APILFPDR
Sbjct  354  FSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTEWATAALYIWSLIAPILFPDR  413

Query  172  DF  167
            +F
Sbjct  414  EF  415



>ref|XP_008794380.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=415

 Score =   221 bits (563),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 164/182 (90%), Gaps = 2/182 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVISLYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVL
Sbjct  234  LHPKVNGSLLPASVISLYCTYLCYSGLSSEPRDYECNGLHGHSKAVSTGSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHII  353
            SVVYSAVRAGSSTTLLSPPSSPRA   +PLLP DK ++ E+ +K +A  V+YSYSFFH+I
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRASSERPLLPFDKVEQQEDRKKDEAKPVSYSYSFFHLI  353

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+VTGW TAAL++WSL+APILFPDR
Sbjct  354  FSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALYIWSLIAPILFPDR  413

Query  172  DF  167
            +F
Sbjct  414  EF  415



>ref|XP_009383181.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVISLYCTYLCYS ++SEPRDYECN LH HSK+VSTG+LTLGLLTTVL
Sbjct  234  LHPKVNGSLLPASVISLYCTYLCYSGISSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHII  353
            SVVYSAVRAGSSTTL+SPPSSPRAG  KPLLP DK +E E+ +K  +K V+YSY+FFH+I
Sbjct  294  SVVYSAVRAGSSTTLISPPSSPRAGSEKPLLPFDKLEEQEDKKKDEAKPVSYSYAFFHLI  353

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMYSAMLLTGWSTSVG SGKLVDVGW SVWVR++TGW TA+LF+WSL+AP++FP+R
Sbjct  354  FSLASMYSAMLLTGWSTSVGGSGKLVDVGWPSVWVRIITGWATASLFIWSLIAPLIFPER  413

Query  172  DF  167
             F
Sbjct  414  VF  415



>gb|ABK96018.1| unknown [Populus trichocarpa]
Length=414

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 165/183 (90%), Gaps = 1/183 (1%)
 Frame = -1

Query  712  SQLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlglltt  533
            + LHP+V GS+ PASVISLYC YLCYS L+SEPR+YECN LH+HSK+VST TLT+GLLTT
Sbjct  232  AALHPAVNGSVLPASVISLYCMYLCYSGLSSEPREYECNGLHRHSKAVSTSTLTIGLLTT  291

Query  532  vlsvvysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHI  356
            VLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPLD K  E EE EK+K VTYSYSFFHI
Sbjct  292  VLSVVYSAVRAGSSTTLLSPPSSPRAGADKPLLPLDNKPSEKEEKEKAKPVTYSYSFFHI  351

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFPD
Sbjct  352  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAGLYIWSLVAPILFPD  411

Query  175  RDF  167
            R+F
Sbjct  412  REF  414



>ref|XP_010532058.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
 ref|XP_010532059.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
Length=414

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YC YLCYS LASEPRDYECN LHKH+K+VSTGT+T+GLLTTVL
Sbjct  234  LHPTVGGSILPASVISMYCMYLCYSGLASEPRDYECNGLHKHAKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPLD   E +E ++    VTYSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGSEKPLLPLDGKAEEKEDKEKSKPVTYSYAFFHIIF  353

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSLVAPILFPDR+
Sbjct  354  SLASMYSAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLVAPILFPDRE  413

Query  169  F  167
            F
Sbjct  414  F  414



>ref|XP_010914044.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=415

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASV+SLYC YLCYS L+SEPRDYECN LH HS++VSTG+LTLGLLTTVL
Sbjct  234  LHPKVNGSLLPASVLSLYCAYLCYSGLSSEPRDYECNGLHNHSEAVSTGSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM--EKSKAVTYSYSFFHII  353
            SV+YSAVRAGSSTT+LSPPSSPRAG  KPLLP D  ++ E+   +++K V+YSYSFF++I
Sbjct  294  SVIYSAVRAGSSTTVLSPPSSPRAGAEKPLLPFDTVEQQEDRKNDEAKPVSYSYSFFYLI  353

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMY+AMLLTGWSTSVGESGKLVDVGW+SVWVR+VT W TAAL++WSL+APILFPDR
Sbjct  354  FSLASMYAAMLLTGWSTSVGESGKLVDVGWSSVWVRIVTQWATAALYIWSLIAPILFPDR  413

Query  172  DF  167
            +F
Sbjct  414  EF  415



>ref|XP_010929190.1| PREDICTED: probable serine incorporator isoform X1 [Elaeis guineensis]
Length=423

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 164/190 (86%), Gaps = 10/190 (5%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVISLYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVL
Sbjct  234  LHPKVNGSLLPASVISLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRA--------GGGKPLLPLDKADEHEEMEKSKA--VTY  377
            SVVYSAVRAGSST+LLSPPSSPRA        G  KPLLP DK ++ E+ +K +A  ++Y
Sbjct  294  SVVYSAVRAGSSTSLLSPPSSPRAISCVQPGVGSEKPLLPFDKVEQQEDRKKDEAKLISY  353

Query  376  SYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLV  197
            SY FFH+IFSLASMYSAMLLTGWSTS+GESGKLVDVGW SVWVR+VTGW TAAL++WSL+
Sbjct  354  SYPFFHLIFSLASMYSAMLLTGWSTSIGESGKLVDVGWPSVWVRIVTGWATAALYIWSLI  413

Query  196  APILFPDRDF  167
            AP+LFPDR+F
Sbjct  414  APMLFPDREF  423



>ref|XP_010929191.1| PREDICTED: probable serine incorporator isoform X2 [Elaeis guineensis]
Length=415

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVISLYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVL
Sbjct  234  LHPKVNGSLLPASVISLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHII  353
            SVVYSAVRAGSST+LLSPPSSPRA   KPLLP DK ++ E+ +K +A  ++YSY FFH+I
Sbjct  294  SVVYSAVRAGSSTSLLSPPSSPRASSEKPLLPFDKVEQQEDRKKDEAKLISYSYPFFHLI  353

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMYSAMLLTGWSTS+GESGKLVDVGW SVWVR+VTGW TAAL++WSL+AP+LFPDR
Sbjct  354  FSLASMYSAMLLTGWSTSIGESGKLVDVGWPSVWVRIVTGWATAALYIWSLIAPMLFPDR  413

Query  172  DF  167
            +F
Sbjct  414  EF  415



>ref|XP_002454688.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
 gb|EES07664.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
Length=413

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 156/181 (86%), Gaps = 2/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP + GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVL
Sbjct  234  LHPKINGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIF  350
            SVVYSAVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IF
Sbjct  294  SVVYSAVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAPILFPDR+
Sbjct  353  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPILFPDRE  412

Query  169  F  167
            F
Sbjct  413  F  413



>ref|XP_006307669.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
 gb|EOA40567.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
Length=412

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 162/181 (90%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPTVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPP SPRA   KPLLPLD KADE EE E  K V+YSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPDSPRAE--KPLLPLDGKADEKEEKENKKPVSYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+
Sbjct  352  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRE  411

Query  169  F  167
            F
Sbjct  412  F  412



>ref|XP_004954190.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=413

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 156/181 (86%), Gaps = 2/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVI LYCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTT+L
Sbjct  234  LHPKVNGSLLPASVIGLYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTIL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIF  350
            SVVYSAVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IF
Sbjct  294  SVVYSAVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTS+GESGKLVDVGW SVWVR+ T W TA LF+WSLVAPILFPDR+
Sbjct  353  SLASMYSAMLLTGWSTSIGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPILFPDRE  412

Query  169  F  167
            F
Sbjct  413  F  413



>ref|XP_011034606.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034607.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034608.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=414

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVISLYC YLCYS L+SEPR+YECN LH+HSK+VST TLT+GLLTTVL
Sbjct  234  LHPAVNGSVLPASVISLYCMYLCYSGLSSEPREYECNGLHRHSKAVSTSTLTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSS TLLSPPSSPRAG  KPLLPLD K  E EE EK+K VTYSYSFFHIIF
Sbjct  294  SVVYSAVRAGSSNTLLSPPSSPRAGADKPLLPLDNKPSEKEEKEKAKPVTYSYSFFHIIF  353

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWS SVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFPDR+
Sbjct  354  SLASMYSAMLLTGWSASVGESGKLVDVGWPSVWVRILTGWATAGLYIWSLVAPILFPDRE  413

Query  169  F  167
            F
Sbjct  414  F  414



>ref|XP_010459155.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 162/181 (90%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPP SPRA   KPLLPLD KADE EE E  K V+YSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPDSPRAE--KPLLPLDGKADEKEEKECKKPVSYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+
Sbjct  352  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRE  411

Query  169  F  167
            F
Sbjct  412  F  412



>ref|XP_010063622.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
Length=414

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PA+VISLYC YLCYS LASEPRDYECN LH HSK+VSTGTLTLGL+TTVL
Sbjct  234  LHPAVNGSILPAAVISLYCMYLCYSGLASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK-AVTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPPSSPRA  GKPLLPLD   E EE ++    VTYSYSFFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAAAGKPLLPLDNKAEEEEEKEKSKTVTYSYSFFHIIF  353

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAM+LTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+
Sbjct  354  SLASMYSAMILTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPERE  413

Query  169  F  167
            F
Sbjct  414  F  414



>ref|XP_002297693.2| TMS membrane family protein [Populus trichocarpa]
 gb|EEE82498.2| TMS membrane family protein [Populus trichocarpa]
Length=414

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 164/183 (90%), Gaps = 1/183 (1%)
 Frame = -1

Query  712  SQLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlglltt  533
            + LHP+V GS+ PASVISLYC YLCYS L+SEPR+YECN LH+HSK+VST TLT+GLLTT
Sbjct  232  AALHPAVNGSVLPASVISLYCMYLCYSGLSSEPREYECNGLHRHSKAVSTSTLTIGLLTT  291

Query  532  vlsvvysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHI  356
            VLSVVYSAVRAGSSTTLLSPPSSP AG  KPLLPLD K  E EE EK+K VTYSYSFFHI
Sbjct  292  VLSVVYSAVRAGSSTTLLSPPSSPHAGADKPLLPLDNKPSEKEEKEKAKPVTYSYSFFHI  351

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSLVAPILFPD
Sbjct  352  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRILTGWATAGLYIWSLVAPILFPD  411

Query  175  RDF  167
            R+F
Sbjct  412  REF  414



>ref|XP_010497691.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497697.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497701.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497705.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 162/181 (90%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPP SPRA   KPLLPLD KADE EE E  K V+YSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPDSPRAE--KPLLPLDGKADEKEEKECKKPVSYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSL+APILFPDR+
Sbjct  352  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLIAPILFPDRE  411

Query  169  F  167
            F
Sbjct  412  F  412



>ref|NP_001130490.1| hypothetical protein precursor [Zea mays]
 gb|ACF78724.1| unknown [Zea mays]
 gb|ACN28943.1| unknown [Zea mays]
 gb|AFW73836.1| hypothetical protein ZEAMMB73_916907 [Zea mays]
Length=413

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 156/181 (86%), Gaps = 2/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP + GS+ PASVI +YCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVL
Sbjct  234  LHPKINGSLLPASVIGMYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIF  350
            SVVYSAVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IF
Sbjct  294  SVVYSAVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+
Sbjct  353  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPVLFPDRE  412

Query  169  F  167
            F
Sbjct  413  F  413



>gb|ACL54492.1| unknown [Zea mays]
Length=413

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 156/181 (86%), Gaps = 2/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP + GS+ PASVI +YCTYLCYS L+SEPRDYECN LH HSK+VSTG+LTLGLLTTVL
Sbjct  234  LHPKINGSLLPASVIGMYCTYLCYSGLSSEPRDYECNGLHNHSKAVSTGSLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIF  350
            SVVYSAVRAGSS T+LSPP SPR G  KPLLP  KADE E+ +   + VTYSYSFFH+IF
Sbjct  294  SVVYSAVRAGSSATVLSPPDSPR-GTDKPLLPFSKADEQEDKKDVPRPVTYSYSFFHLIF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+
Sbjct  353  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPVLFPDRE  412

Query  169  F  167
            F
Sbjct  413  F  413



>ref|XP_006845424.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
 gb|ERN07099.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
Length=415

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YCTYLCYSAL+SEPRDYECN LH HSK+VSTGTLTLGLLTTVL
Sbjct  234  LHPKVNGSLLPASVISVYCTYLCYSALSSEPRDYECNGLHHHSKAVSTGTLTLGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK--SKAVTYSYSFFHII  353
            SVVYSAVRAGSSTTLLSPPSSPRAG  KPLL  DK ++ E+ +K  +K V+YSYSFFH+I
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGSEKPLLSFDKLEKQEDKKKHEAKPVSYSYSFFHLI  353

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMYSAMLLTGWS+SVGESG+LVDVGW SVWVR++T W TA LF+WSL+AP LFP+R
Sbjct  354  FSLASMYSAMLLTGWSSSVGESGQLVDVGWPSVWVRIITQWATAGLFVWSLIAPHLFPER  413

Query  172  DF  167
            +F
Sbjct  414  EF  415



>gb|KCW70853.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=316

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 161/181 (89%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PA+VISLYC YLCYS LASEPRDYECN LH HSK+VSTGTLTLGL+TTVL
Sbjct  138  LHPAVNGSILPAAVISLYCMYLCYSGLASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVL  197

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK-AVTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPLD   E EE ++    VTYSYSFFHIIF
Sbjct  198  SVVYSAVRAGSSTTLLSPPSSPRAG--KPLLPLDNKAEEEEEKEKSKTVTYSYSFFHIIF  255

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAM+LTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+
Sbjct  256  SLASMYSAMILTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPERE  315

Query  169  F  167
            F
Sbjct  316  F  316



>ref|XP_010476724.1| PREDICTED: serine incorporator 3 [Camelina sativa]
Length=412

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 161/181 (89%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPP SP A   KPLLPLD KADE EE E  K V+YSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPDSPPAE--KPLLPLDGKADEKEEKECKKPVSYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+
Sbjct  352  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRE  411

Query  169  F  167
            F
Sbjct  412  F  412



>emb|CDY52849.1| BnaA09g56410D [Brassica napus]
Length=400

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 160/181 (88%), Gaps = 2/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  221  LHPAVGGSILPASVISVYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  280

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLS P SPRAG  KPLLPLD   E +E ++ K  VTYSY+FFHIIF
Sbjct  281  SVVYSAVRAGSSTTLLSSPDSPRAGE-KPLLPLDGKAEDKEEKEQKKPVTYSYAFFHIIF  339

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+
Sbjct  340  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRE  399

Query  169  F  167
            F
Sbjct  400  F  400



>ref|XP_010246591.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=409

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSIFPAS ISL+CTYLCYS LASEPRDYECN LH+HSK+V TGT+ LGLLTTV+
Sbjct  229  LHPAVGGSIFPASAISLFCTYLCYSGLASEPRDYECNGLHQHSKTVPTGTIILGLLTTVV  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIF  350
            SVVYSAVRAGSST+L S  +  R G  K L+PL+K DE EE E  S+  TYSY+FFH+IF
Sbjct  289  SVVYSAVRAGSSTSLFSESTLSRVGEEKHLIPLNKTDEEEEEEDESRPATYSYAFFHVIF  348

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGE GKLVDVGW SVWVR+VTGW TAA+++WSLVAP+LFPDR+
Sbjct  349  SLASMYSAMLLTGWSTSVGEIGKLVDVGWPSVWVRIVTGWATAAVYIWSLVAPLLFPDRE  408

Query  169  F  167
            F
Sbjct  409  F  409



>ref|XP_009117776.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
 ref|XP_009117777.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
Length=413

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 160/181 (88%), Gaps = 2/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPAVGGSILPASVISVYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLS P SPRAG  KPLLPLD   E +E ++ K  VTYSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSSPDSPRAGE-KPLLPLDGKAEDKEEKEQKKPVTYSYAFFHIIF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+
Sbjct  353  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRE  412

Query  169  F  167
            F
Sbjct  413  F  413



>ref|XP_009110458.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
 ref|XP_009110459.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
Length=412

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 160/181 (88%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPAVGGSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPP SPRAG  KPLLPLD   E +E ++ K  VTYSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPDSPRAG--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WS+VAPILFPDR+
Sbjct  352  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSVVAPILFPDRE  411

Query  169  F  167
            F
Sbjct  412  F  412



>emb|CDY70974.1| BnaAnng35710D [Brassica napus]
Length=412

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 160/181 (88%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPAVGGSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPP SPRAG  KPLLPLD   E +E ++ K  VTYSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPDSPRAG--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WS+VAPILFPDR+
Sbjct  352  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSVVAPILFPDRE  411

Query  169  F  167
            F
Sbjct  412  F  412



>emb|CDX81752.1| BnaC08g38490D [Brassica napus]
Length=412

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 158/181 (87%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPAVGGSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLS P SPRA   KPLLPLD   E +E ++ K  VTYSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSSPDSPRAE--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDRD
Sbjct  352  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRD  411

Query  169  F  167
            F
Sbjct  412  F  412



>ref|XP_010063623.1| PREDICTED: probable serine incorporator isoform X2 [Eucalyptus 
grandis]
 gb|KCW70852.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=412

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 161/181 (89%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PA+VISLYC YLCYS LASEPRDYECN LH HSK+VSTGTLTLGL+TTVL
Sbjct  234  LHPAVNGSILPAAVISLYCMYLCYSGLASEPRDYECNGLHAHSKAVSTGTLTLGLVTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK-AVTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPLD   E EE ++    VTYSYSFFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAG--KPLLPLDNKAEEEEEKEKSKTVTYSYSFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAM+LTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+
Sbjct  352  SLASMYSAMILTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPERE  411

Query  169  F  167
            F
Sbjct  412  F  412



>ref|XP_003532291.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN07179.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGL TTVL
Sbjct  234  LHPAVNGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLATTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSS  +LSPPSSPRAG  KPLLPLD  ++ EE EK+K VTYSY+FFH+IFS
Sbjct  294  SVVYSAVRAGSSAAVLSPPSSPRAG--KPLLPLDAKED-EEKEKAKPVTYSYAFFHLIFS  350

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++T W TA L+LWSLVAPI+FP+R+F
Sbjct  351  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITSWATALLYLWSLVAPIMFPEREF  410



>ref|XP_003552131.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN15373.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 163/180 (91%), Gaps = 3/180 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVISLYCTYLCYSALASEPRDYECN LHKHSK+VSTGT+TLGL TTVL
Sbjct  234  LHPAVNGSVLPASVISLYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTITLGLATTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSS  +LSPPSSPRAG  KPLLPLD  ++ EE EK+K VTYSY+FFH+IFS
Sbjct  294  SVVYSAVRAGSSAAVLSPPSSPRAG--KPLLPLDAKED-EEKEKAKPVTYSYAFFHLIFS  350

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++T W TA L+LWSL+API+FP+R+F
Sbjct  351  LASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITSWATALLYLWSLIAPIMFPEREF  410



>ref|XP_002890152.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66411.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 161/181 (89%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPP SPRA   KPLLP+D   E +E +++K  V+YSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPDSPRAE--KPLLPIDGKAEEKEEKENKKPVSYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+
Sbjct  352  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRE  411

Query  169  F  167
            F
Sbjct  412  F  412



>ref|XP_002512768.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF49271.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=413

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 161/182 (88%), Gaps = 4/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS YC YLCYS LASEPR+YECN LHKHSK+VSTGTL++GLLTTVL
Sbjct  234  LHPAVSGSILPASVISAYCMYLCYSGLASEPREYECNGLHKHSKAVSTGTLSIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHII  353
            SVVYSAVRAGSSTTLLSPPSSPRAG  KPLLPL+     E  EK KA  VTYSY+FFHII
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAG--KPLLPLENKIAEEHEEKEKAKPVTYSYAFFHII  351

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            FSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVR++TGW TA L++WSL+APILFPDR
Sbjct  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIITGWATAGLYVWSLLAPILFPDR  411

Query  172  DF  167
            +F
Sbjct  412  EF  413



>ref|NP_173069.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 ref|NP_001185008.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAF18512.1|AC010924_25 Contains similarity to gb|AF181686 membrane protein TMS1d from 
Drosophila melanogaster. ESTs gb|R64994, gb|AI994832, gb|Z47674 
come from this gene [Arabidopsis thaliana]
 gb|AEE29416.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEE29417.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=412

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 160/181 (88%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVISLYC YLCYS LASEPRDYECN LH HSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPTVGGSILPASVISLYCMYLCYSGLASEPRDYECNGLHNHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPP SPRA   KPLLP+D   E +E +++K  V+YSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPDSPRAE--KPLLPIDGKAEEKEEKENKKPVSYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+
Sbjct  352  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRE  411

Query  169  F  167
            F
Sbjct  412  F  412



>ref|XP_006416842.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 ref|XP_006416843.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35195.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35196.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
Length=412

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 159/181 (88%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPAVGGSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPP SPRA   KPLLPLD   E +E +++K  V+YSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPDSPRAE--KPLLPLDGKAEEKEEKENKKPVSYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESG LVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+
Sbjct  352  SLASMYSAMLLTGWSTSVGESGNLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDRE  411

Query  169  F  167
            F
Sbjct  412  F  412



>gb|ABR17762.1| unknown [Picea sitchensis]
 gb|ABR17907.1| unknown [Picea sitchensis]
Length=417

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 154/183 (84%), Gaps = 3/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YCTYLCYS L+SEPRDYECN LH H K+VST TL LG++TTVL
Sbjct  234  LHPKVNGSLLPASVISVYCTYLCYSGLSSEPRDYECNGLHGHVKAVSTSTLLLGMITTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADE-HEEMEK--SKAVTYSYSFFHI  356
            SVVYSAVRAGSST LLSPPSSPRAG GKPLL  D+ +E H+  +K   + VTYSYSFFH+
Sbjct  294  SVVYSAVRAGSSTALLSPPSSPRAGSGKPLLSFDEIEEGHKNTQKDEERPVTYSYSFFHV  353

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLLTGW++S  +  KL+ VGW +VWVR+ T W+TAAL++WSLVAP+LFPD
Sbjct  354  IFALASMYSAMLLTGWTSSTADGEKLIGVGWHTVWVRICTEWITAALYIWSLVAPLLFPD  413

Query  175  RDF  167
            R+F
Sbjct  414  REF  416



>emb|CDX83957.1| BnaC08g16880D [Brassica napus]
Length=821

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 162/180 (90%), Gaps = 3/180 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS YC YLCYS LASEPRDYECN LHKHSK+VSTGT+T+GLLTTVL
Sbjct  234  LHPAVGGSILPASVISFYCMYLCYSGLASEPRDYECNGLHKHSKAVSTGTMTIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLD-KADEHEEMEKSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSSTTLLSPP SPRAG  KPLLPLD KA+E EE E+ K VTYSY+FFHIIF
Sbjct  294  SVVYSAVRAGSSTTLLSPPDSPRAG--KPLLPLDGKAEEKEEKEQKKPVTYSYAFFHIIF  351

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            SLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSL+APILFPDR+
Sbjct  352  SLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLIAPILFPDRE  411



>ref|XP_006850791.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
 gb|ERN12372.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
Length=339

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 155/182 (85%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+FPASVIS+YC YLCY+ L+SEPRDYECN LHKHSK+VSTGTL +G++TTVL
Sbjct  158  LHPKVNGSLFPASVISMYCAYLCYTGLSSEPRDYECNGLHKHSKAVSTGTLIMGMITTVL  217

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHII  353
            SVVYSAVRAGSSTT LSPPSSP+AG  KPLL  D  DE E+ ++++A  V+YSY+FFH+I
Sbjct  218  SVVYSAVRAGSSTTFLSPPSSPKAGEKKPLLESDNLDEVEKNKQNEARPVSYSYTFFHLI  277

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLLTGW TS+ +S  L+DVGW SVWVR+ T WVTA L++WSLVAP++  DR
Sbjct  278  FALASMYSAMLLTGW-TSLSDSEDLIDVGWTSVWVRMCTEWVTAGLYVWSLVAPLILSDR  336

Query  172  DF  167
            +F
Sbjct  337  EF  338



>ref|XP_008673654.1| PREDICTED: uncharacterized protein LOC100191916 isoform X1 [Zea 
mays]
Length=339

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 150/182 (82%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS   L LG+LTTVL
Sbjct  158  LHPQVHGSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSMSALILGMLTTVL  217

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHII  353
            SVVYSAVRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+I
Sbjct  218  SVVYSAVRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLI  276

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLLTGW+++  ES +L+DVGW +VWVR+ T WVTA L++W+L+AP+LFPDR
Sbjct  277  FALASMYSAMLLTGWTSAASESSELMDVGWTTVWVRICTEWVTAGLYIWTLIAPLLFPDR  336

Query  172  DF  167
            DF
Sbjct  337  DF  338



>tpg|DAA49274.1| TPA: hypothetical protein ZEAMMB73_017777 [Zea mays]
Length=359

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 150/182 (82%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS   L LG+LTTVL
Sbjct  178  LHPQVHGSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSMSALILGMLTTVL  237

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHII  353
            SVVYSAVRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+I
Sbjct  238  SVVYSAVRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLI  296

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLLTGW+++  ES +L+DVGW +VWVR+ T WVTA L++W+L+AP+LFPDR
Sbjct  297  FALASMYSAMLLTGWTSAASESSELMDVGWTTVWVRICTEWVTAGLYIWTLIAPLLFPDR  356

Query  172  DF  167
            DF
Sbjct  357  DF  358



>gb|ABR16232.1| unknown [Picea sitchensis]
Length=407

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 150/183 (82%), Gaps = 3/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCY  L+SEPRDY CN LH H+ +VSTGTL LG+LTTVL
Sbjct  225  LHPQVSGSLLPASVISVYCAYLCYCGLSSEPRDYGCNGLHNHTAAVSTGTLILGMLTTVL  284

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHI  356
            SV+YSAVRAGSSTT LSPP+SPR G  KPLL    +++  + E+ ++ + VTYSY+FFH+
Sbjct  285  SVIYSAVRAGSSTTFLSPPTSPRTGSEKPLLESKDVEEGQKDEKKDEGRPVTYSYTFFHL  344

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLLTGW++S  +S +LVDVGW SVWVR+ T W+TA L++W+L+API FPD
Sbjct  345  IFALASMYSAMLLTGWTSSTKDSEELVDVGWPSVWVRICTEWITAGLYVWTLLAPIFFPD  404

Query  175  RDF  167
            R+F
Sbjct  405  REF  407



>ref|NP_001130812.1| uncharacterized protein LOC100191916 [Zea mays]
 gb|ACF79174.1| unknown [Zea mays]
 gb|ACF82535.1| unknown [Zea mays]
 gb|ACF85768.1| unknown [Zea mays]
 gb|ACG39558.1| serine incorporator 3 [Zea mays]
 tpg|DAA49275.1| TPA: Serine incorporator 3 isoform 1 [Zea mays]
 tpg|DAA49276.1| TPA: Serine incorporator 3 isoform 2 [Zea mays]
Length=415

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 150/182 (82%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS   L LG+LTTVL
Sbjct  234  LHPQVHGSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSMSALILGMLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHII  353
            SVVYSAVRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+I
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLI  352

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLLTGW+++  ES +L+DVGW +VWVR+ T WVTA L++W+L+AP+LFPDR
Sbjct  353  FALASMYSAMLLTGWTSAASESSELMDVGWTTVWVRICTEWVTAGLYIWTLIAPLLFPDR  412

Query  172  DF  167
            DF
Sbjct  413  DF  414



>ref|XP_002466928.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
 gb|EER93926.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
Length=415

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 151/182 (83%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCY++L+SEP DYECN LH+HSK VS G L LG+LTTVL
Sbjct  234  LHPQVNGSVMPASVISVYCAYLCYTSLSSEPDDYECNGLHRHSKQVSLGALILGMLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHII  353
            SVVYSAVRAGSSTT LSPPSSPR+G   PLL  D+ D   + ++S  + V+YSY+FFH+I
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPRSGAKNPLLG-DEEDGKGDGKESEPRPVSYSYTFFHLI  352

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLLTGW+++  E  +L+DVGW +VWVR+ T WVTAAL++W+L+AP+LFPDR
Sbjct  353  FALASMYSAMLLTGWTSAASERSELMDVGWTTVWVRICTEWVTAALYIWTLIAPLLFPDR  412

Query  172  DF  167
            DF
Sbjct  413  DF  414



>ref|NP_001050476.1| Os03g0454100 [Oryza sativa Japonica Group]
 gb|AAO73245.1| putative membrane protein [Oryza sativa Japonica Group]
 gb|ABF97019.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12390.1| Os03g0454100 [Oryza sativa Japonica Group]
 dbj|BAG90227.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75563.1| hypothetical protein OsI_12232 [Oryza sativa Indica Group]
 gb|EEE59340.1| hypothetical protein OsJ_11423 [Oryza sativa Japonica Group]
Length=417

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 147/183 (80%), Gaps = 3/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCY++L+SEP DY CN LH+HSK VS   L LG+LTTVL
Sbjct  234  LHPQVNGSVMPASVISVYCAYLCYTSLSSEPDDYACNGLHRHSKQVSMSALILGMLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK---SKAVTYSYSFFHI  356
            SVVYSAVRAGSSTT LSPPSSPR+G   PLL  D  +  +   K   ++ V+YSY+FFH+
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPRSGIKNPLLGDDNVEAGKSNSKEIDARPVSYSYTFFHV  353

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLLTGW+++  +S +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPD
Sbjct  354  IFALASMYSAMLLTGWTSAASDSSELMDVGWTTVWVRICTEWATAALYIWTLVAPLLFPD  413

Query  175  RDF  167
            RDF
Sbjct  414  RDF  416



>ref|XP_004982576.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=415

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GSI PASVIS+YC YLCYS+L+SEP  YECN LH HSK VS   L LG+LTTVL
Sbjct  234  LHPQVNGSIMPASVISVYCAYLCYSSLSSEPDGYECNGLHMHSKQVSMSALILGMLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME-KSKAVTYSYSFFHIIF  350
            SVVYSAVRAGSSTT LSPPSSPR+G   PLL  ++  +  + + + + V+YSY+FFH+IF
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPRSGAKNPLLGDEETGKGVDKDTEPRPVSYSYTFFHLIF  353

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLLTGW+++  E  +L+DVGW +VWVR+ T WVTAAL++W+L+AP+LFPDRD
Sbjct  354  ALASMYSAMLLTGWTSAASEKSELMDVGWTTVWVRICTEWVTAALYIWTLIAPLLFPDRD  413

Query  169  F  167
            F
Sbjct  414  F  414



>ref|XP_008458551.1| PREDICTED: serine incorporator 3 [Cucumis melo]
Length=411

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+VS GTL LG+LTTVL
Sbjct  229  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLHTKSKAVSVGTLVLGMLTTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHI  356
            SV+YSA+RAGSSTT LSPPSSPRAGG KPLL    L+     +   + + V+YSY+FFH+
Sbjct  289  SVIYSALRAGSSTTFLSPPSSPRAGGSKPLLESEDLEDGKNKKTEGEGQPVSYSYTFFHL  348

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLL+GW TS+ ES  L+DVGW SVWVR+ T WVTA L++WSLVAP+LFPD
Sbjct  349  IFALASMYSAMLLSGW-TSLNESSDLIDVGWTSVWVRICTEWVTAGLYIWSLVAPLLFPD  407

Query  175  RDF  167
            R+F
Sbjct  408  REF  410



>ref|XP_010546829.1| PREDICTED: serine incorporator 3 isoform X1 [Tarenaya hassleriana]
Length=410

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 147/182 (81%), Gaps = 4/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEPRDYECN LH  SK+V+T TL LG+LTTVL
Sbjct  230  LHPAVNGSLLPASVISVYCVYVCYTGLSSEPRDYECNGLHNKSKAVTTSTLILGMLTTVL  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHII  353
            SV+YSAVRAGSSTT LSPPSSPRA G  PLL  P D   +  E E  + V+YSYSFFH+I
Sbjct  290  SVIYSAVRAGSSTTFLSPPSSPRAAGATPLLEDPEDGKKKSNETEP-RPVSYSYSFFHVI  348

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMY+AMLL+GW+ S  ES  L+DVGW SVWVR+ TGWVTA L++W+LVAP + PDR
Sbjct  349  FALASMYAAMLLSGWTDS-SESASLIDVGWTSVWVRICTGWVTAGLYIWTLVAPFVLPDR  407

Query  172  DF  167
            +F
Sbjct  408  EF  409



>ref|XP_010237604.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
 ref|XP_010237605.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=418

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCYS+L+SEP DY CN LH HSK VS G L LG+LTTVL
Sbjct  234  LHPQVNGSVMPASVISVYCAYLCYSSLSSEPDDYACNGLHMHSKQVSVGALILGMLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFH  359
            SVVYSAVRAGSSTT LSPPSSPR+G   PLL     +E +  + +    + V+YSY+FFH
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPRSGTKNPLLGDANVEEGKGEDTTGSEPRPVSYSYTFFH  353

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMYSAMLLTGW+++  ESG+L+DVGW +VWVR+   W TAAL++W+LVAP+LFP
Sbjct  354  LIFALASMYSAMLLTGWTSAGSESGELMDVGWTTVWVRICMEWATAALYIWTLVAPLLFP  413

Query  178  DRDF  167
            DRDF
Sbjct  414  DRDF  417



>ref|XP_006650244.1| PREDICTED: probable serine incorporator-like [Oryza brachyantha]
Length=417

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PAS+IS+YC YLCY++L+SEP DY CN LH+HSK VS   L LG+LTTVL
Sbjct  234  LHPQVNGSVMPASIISVYCAYLCYTSLSSEPDDYACNGLHRHSKQVSMSALILGMLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK---SKAVTYSYSFFHI  356
            SVVYSAVRAGSSTT LSPPSSPR+G   PLL  D  +      K   ++ V+YSY+FFH+
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPRSGTKNPLLGDDNVEAGNGNGKELDARPVSYSYTFFHL  353

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLLTGW+++  +S +L+DVGW +VWVR+ T W TA L++W+LVAP+LFPD
Sbjct  354  IFALASMYSAMLLTGWTSAASDSSELMDVGWTTVWVRICTEWATAGLYIWTLVAPLLFPD  413

Query  175  RDF  167
            RDF
Sbjct  414  RDF  416



>ref|XP_004150322.1| PREDICTED: serine incorporator 3-like [Cucumis sativus]
 gb|KGN47263.1| hypothetical protein Csa_6G238640 [Cucumis sativus]
Length=411

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 148/183 (81%), Gaps = 4/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+VS GTL LG+LTTVL
Sbjct  229  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNDLHTKSKAVSVGTLVLGMLTTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHI  356
            SV+YSA+RAGSSTT LSPPSSPRAGG KPLL    L+     +   + + V+YSY+FFH+
Sbjct  289  SVIYSALRAGSSTTFLSPPSSPRAGGSKPLLESEDLEDGKNKKTEGEGQPVSYSYTFFHL  348

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLL+GW TS+ ES  L+DVGW SVWVR+ T WVT  L++WSLVAP+LFPD
Sbjct  349  IFALASMYSAMLLSGW-TSLNESSDLIDVGWTSVWVRICTEWVTGGLYIWSLVAPLLFPD  407

Query  175  RDF  167
            R+F
Sbjct  408  REF  410



>ref|XP_004169518.1| PREDICTED: LOW QUALITY PROTEIN: serine incorporator 3-like [Cucumis 
sativus]
Length=411

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 148/183 (81%), Gaps = 4/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+VS GTL LG+LTTVL
Sbjct  229  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNDLHTKSKAVSVGTLVLGMLTTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHI  356
            SV+YSA+RAGSSTT LSPPSSPRAGG KPLL    L+     +   + + V+YSY+FFH+
Sbjct  289  SVIYSALRAGSSTTFLSPPSSPRAGGSKPLLESEDLEDGKNKKTEGEGQPVSYSYTFFHL  348

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLL+GW TS+ ES  L+DVGW SVWVR+ T WVT  L++WSLVAP+LFPD
Sbjct  349  IFALASMYSAMLLSGW-TSLNESSDLIDVGWTSVWVRICTEWVTGGLYIWSLVAPLLFPD  407

Query  175  RDF  167
            R+F
Sbjct  408  REF  410



>ref|XP_011090806.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=411

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 149/182 (82%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCY+ L+SEPRDY CN LH  SK+VST TL LG+LTTVL
Sbjct  230  LHPKVNGSLLPASVISVYCAYLCYTGLSSEPRDYVCNGLHNKSKAVSTSTLVLGMLTTVL  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHII  353
            SV+YSA+RAGSSTT LSPPSSPRAG  KPLL  D+ +  +    ++A  V+YSY+FFH+I
Sbjct  290  SVLYSALRAGSSTTFLSPPSSPRAGDKKPLLESDELESGKGKNDAEARPVSYSYTFFHLI  349

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW TS  E+ +L+D+GW SVWVR+ T WVTA L++WSL+AP+LFPDR
Sbjct  350  FALASMYSAMLLSGW-TSSSENPELIDIGWTSVWVRICTEWVTAGLYIWSLIAPLLFPDR  408

Query  172  DF  167
            +F
Sbjct  409  EF  410



>gb|EYU43840.1| hypothetical protein MIMGU_mgv1a006662mg [Erythranthe guttata]
Length=436

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 148/182 (81%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK VST TL LG+LTTVL
Sbjct  255  LHPKVNGSLLPASVISMYCAYVCYTGLSSEPRDYVCNGLHNKSKVVSTSTLILGMLTTVL  314

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKAD--EHEEMEKSKAVTYSYSFFHII  353
            SV+YSA+RAGSSTT LSPPSSPRAGG KPLL  D+ +  + +   ++K VTYSY FFH+I
Sbjct  315  SVLYSALRAGSSTTFLSPPSSPRAGGKKPLLEGDELESGKGKNETENKPVTYSYMFFHLI  374

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW TS  E+ +L+DVGW SVWVR+ T WVTA L++WSL+AP++ PDR
Sbjct  375  FALASMYSAMLLSGW-TSDSENPQLIDVGWTSVWVRICTEWVTAGLYVWSLIAPLILPDR  433

Query  172  DF  167
            +F
Sbjct  434  EF  435



>dbj|BAK02293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=186

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 142/179 (79%), Gaps = 3/179 (2%)
 Frame = -1

Query  694  VKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvy  515
            V GS+ PASVIS+YC YLCY++L+SEP DY CN LH HSK VS   L LG+LTTVLSVVY
Sbjct  7    VNGSVMPASVISVYCAYLCYTSLSSEPYDYACNGLHMHSKQVSMSALVLGMLTTVLSVVY  66

Query  514  saVRAGssttllsppssPRAGGGKPLLPLDKADEHE---EMEKSKAVTYSYSFFHIIFSL  344
            SAVRAGSSTT LSPPSSPR+G   PLL     +E +   E  ++  V+YSY+FFH+IF+L
Sbjct  67   SAVRAGSSTTFLSPPSSPRSGARNPLLGDANVEEGKGSSEGSEAHPVSYSYTFFHLIFAL  126

Query  343  ASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            ASMYSAMLLTGW+++  +  +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  127  ASMYSAMLLTGWTSATSDRSELMDVGWTTVWVRICTEWSTAALYIWTLVAPLLFPDRDF  185



>dbj|BAJ86142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCY++L+SEP DY CN LH HSK VS   L LG+LTTVL
Sbjct  234  LHPQVNGSVMPASVISVYCAYLCYTSLSSEPYDYACNGLHMHSKQVSMSALVLGMLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHE---EMEKSKAVTYSYSFFHI  356
            SVVYSAVRAGSSTT LSPPSSPR+G   PLL     +E +   E  ++  V+YSY+FFH+
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPRSGARNPLLGDANVEEGKGSSEGSEAHPVSYSYTFFHL  353

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLLTGW+++  +  +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPD
Sbjct  354  IFALASMYSAMLLTGWTSATSDRSELMDVGWTTVWVRICTEWSTAALYIWTLVAPLLFPD  413

Query  175  RDF  167
            RDF
Sbjct  414  RDF  416



>ref|XP_008799134.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=416

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 151/183 (83%), Gaps = 3/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCYS L+SEPRDY CN LHKHSK VSTGTL LGLLTTV+
Sbjct  234  LHPQVNGSLLPASVISVYCAYLCYSGLSSEPRDYACNGLHKHSKQVSTGTLVLGLLTTVI  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHI  356
            SVVYSAVR GSST+ LSPPSSP++G  KPLL    L+   + ++  +++ V+YSY+FFH+
Sbjct  294  SVVYSAVRTGSSTSFLSPPSSPKSGSTKPLLEDGELESGKDDKKEGEARPVSYSYTFFHL  353

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAM+LTGW++S  +S +L+DVGW SVWVR+ T W TAAL++W+LVAP++ PD
Sbjct  354  IFALASMYSAMVLTGWTSSTSDSSELIDVGWTSVWVRICTEWATAALYIWTLVAPLILPD  413

Query  175  RDF  167
            R+F
Sbjct  414  REF  416



>ref|XP_010546830.1| PREDICTED: serine incorporator 3 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 147/182 (81%), Gaps = 5/182 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEPRDYECN LH  SK+V+T TL LG+LTTVL
Sbjct  230  LHPAVNGSLLPASVISVYCVYVCYTGLSSEPRDYECNGLHNKSKAVTTSTLILGMLTTVL  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHII  353
            SV+YSAVRAGSSTT LSPPSSPRAG   PLL  P D   +  E E  + V+YSYSFFH+I
Sbjct  290  SVIYSAVRAGSSTTFLSPPSSPRAGA-TPLLEDPEDGKKKSNETEP-RPVSYSYSFFHVI  347

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMY+AMLL+GW+ S  ES  L+DVGW SVWVR+ TGWVTA L++W+LVAP + PDR
Sbjct  348  FALASMYAAMLLSGWTDS-SESASLIDVGWTSVWVRICTGWVTAGLYIWTLVAPFVLPDR  406

Query  172  DF  167
            +F
Sbjct  407  EF  408



>ref|XP_004296950.1| PREDICTED: probable serine incorporator [Fragaria vesca subsp. 
vesca]
Length=409

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 149/183 (81%), Gaps = 6/183 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+Y  Y+CY+AL+SEPRDY CN LH HS +VS GTL LG+ TT+L
Sbjct  230  LHPTVNGSLLPASVISVYSAYVCYTALSSEPRDYACNGLH-HSSAVSVGTLLLGMATTIL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHI  356
            SV+YSA+RAGSSTT LSPPSSPRA   KPLL    L++  +  E E +K V+YSY+FFH+
Sbjct  289  SVLYSALRAGSSTTFLSPPSSPRAAEKKPLLEGKELEEGKDKNEKE-AKPVSYSYTFFHL  347

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTAAL++WSLVAP+LFPD
Sbjct  348  IFALASMYSAMLLSGWTNS-AESSDLIDVGWTSVWVRICTEWVTAALYVWSLVAPLLFPD  406

Query  175  RDF  167
            R+F
Sbjct  407  REF  409



>ref|XP_009391591.1| PREDICTED: serine incorporator 3 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 149/184 (81%), Gaps = 5/184 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ P+SVIS+YC YLCYS L+SEPRDY CN LH H K VSTGTL LG+LTTVL
Sbjct  234  LHPQVNGSLLPSSVISIYCAYLCYSGLSSEPRDYACNGLHNHVKQVSTGTLVLGMLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKAD----EHEEMEKSKAVTYSYSFFH  359
            SVVYSAVRAGSSTT LSPPSSP++G   PLL    A+    E +E E ++ V+YSY+FFH
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPKSGSRSPLLEAGDAESGKPEKKENE-ARPVSYSYTFFH  352

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMYSAMLLTGWS S+ ES +L+DVGW SVWVR+ T W TAAL++W+LVAP++ P
Sbjct  353  LIFALASMYSAMLLTGWSGSISESSELIDVGWTSVWVRICTEWATAALYIWTLVAPLILP  412

Query  178  DRDF  167
            DR+F
Sbjct  413  DREF  416



>ref|XP_010938752.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=416

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 151/183 (83%), Gaps = 3/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCYS L+SEPRDY CN LHKHSK VSTGTL LGLLTTV+
Sbjct  234  LHPQVNGSLLPASVISVYCAYLCYSGLSSEPRDYACNGLHKHSKQVSTGTLVLGLLTTVI  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLP---LDKADEHEEMEKSKAVTYSYSFFHI  356
            SVVYSAVR GSST+ LSPPSSP++G  KPLL    ++   + ++  +++ VTYSY+FFH+
Sbjct  294  SVVYSAVRTGSSTSFLSPPSSPKSGSSKPLLEEGEVESGKDDKKESEARPVTYSYTFFHL  353

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLLTGW++S  +S +L+DVGW SVWVR+ T W TAAL++W+L+AP++ PD
Sbjct  354  IFALASMYSAMLLTGWTSSTSDSSELIDVGWTSVWVRICTEWATAALYIWTLIAPLVLPD  413

Query  175  RDF  167
            R+F
Sbjct  414  REF  416



>ref|XP_002280143.1| PREDICTED: serine incorporator 3 [Vitis vinifera]
 emb|CBI26177.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 150/182 (82%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVISLYC Y+CY+ L+SEPRDY CN LH  SK+VST TL LG+LTTVL
Sbjct  230  LHPRVNGSLLPASVISLYCAYVCYTGLSSEPRDYACNGLHNKSKAVSTSTLILGMLTTVL  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHII  353
            SV+YSAVRAGSSTT LSPPSSP++GG KPLL  +  +  +E ++ +A  V+YSY+FFH+I
Sbjct  290  SVLYSAVRAGSSTTFLSPPSSPKSGGKKPLLESEDTESGKEKKEEEAKPVSYSYTFFHLI  349

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW TS  +S  ++DVGW SVWVR+ T WVTA L++WSL+APILFPDR
Sbjct  350  FALASMYSAMLLSGW-TSSNDSSDMIDVGWTSVWVRICTEWVTALLYVWSLLAPILFPDR  408

Query  172  DF  167
            +F
Sbjct  409  EF  410



>ref|XP_006419802.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
 ref|XP_006489289.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
 gb|ESR33042.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
Length=414

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 148/183 (81%), Gaps = 4/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            L+PSV GS+ PASVIS+YC Y+CY+AL+SEP DY CN LH  SK+V+  TL LG+LTTVL
Sbjct  232  LNPSVNGSLLPASVISVYCAYVCYTALSSEPHDYVCNGLHNKSKAVTISTLVLGMLTTVL  291

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHI  356
            SV+YSA+RAGSSTT LSPPSSP++ G KPLL  +  +E  E +K    + V+YSYSFFH+
Sbjct  292  SVLYSALRAGSSTTFLSPPSSPKSAGKKPLLEGEDVEEGTENKKDIEGRPVSYSYSFFHL  351

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ + WVTA L++W+LVAP+LFPD
Sbjct  352  IFALASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICSQWVTAGLYIWTLVAPLLFPD  410

Query  175  RDF  167
            R+F
Sbjct  411  REF  413



>ref|XP_010693925.1| PREDICTED: serine incorporator 3 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  SK+V+T TL LG++TTVL
Sbjct  229  LHPKVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLHNKSKAVTTSTLVLGMITTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHII  353
            SV+YSA+RAGSS   LSPPSSPRAG  K LL  +  +   + + S  + V+YSY FFH+I
Sbjct  289  SVLYSALRAGSSKAFLSPPSSPRAGATKSLLSSEDTEAGRDKKDSEPRPVSYSYMFFHLI  348

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW++S   S  L+D+GWASVWV++ T WVTA L++WSLVAP+L PDR
Sbjct  349  FALASMYSAMLLSGWTSSTDNS-DLIDIGWASVWVKICTEWVTAGLYVWSLVAPLLLPDR  407

Query  172  DF  167
            +F
Sbjct  408  EF  409



>emb|CDO98987.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 151/182 (83%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEPR+Y CN LHK S++VST TL LGLLTT++
Sbjct  230  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPRNYVCNGLHKASRAVSTSTLILGLLTTII  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS--KAVTYSYSFFHII  353
            SV+YSA+RAGSSTT LSPPSSPR+GG KPLL  D+ +  ++ + +  + V+YSYSFF +I
Sbjct  290  SVLYSALRAGSSTTFLSPPSSPRSGGQKPLLESDELEAGKDKKDAEPRPVSYSYSFFLLI  349

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSLVAP++FPDR
Sbjct  350  FALASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRMCTEWVTAGLYVWSLVAPLIFPDR  408

Query  172  DF  167
            +F
Sbjct  409  EF  410



>emb|CDY05246.1| BnaC05g45570D [Brassica napus]
Length=408

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++      L T + 
Sbjct  230  LHPAVNGSLLPASVISVYCAYICYTGLSSEPHDYVCNGLNRSKAVTASTLTLGMLTTVLS  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             +  +  RAGSSTT LSPPSSPRAGG + LL   +  +     +++ V+YSYSFFHIIF+
Sbjct  290  VLYSAL-RAGSSTTFLSPPSSPRAGGKEALLEDPEDGKKNGEAEARPVSYSYSFFHIIFA  348

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMY+AMLL+GW+ S  ES  L+DVGW SVWVR+ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  349  LASMYAAMLLSGWTDS-SESASLIDVGWTSVWVRICTGWVTAALYIWTLIAPLILPDREF  407



>ref|XP_009365800.1| PREDICTED: probable serine incorporator isoform X2 [Pyrus x bretschneideri]
Length=409

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 147/183 (80%), Gaps = 6/183 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            L+P V GS+ PASVIS+Y  Y+CY+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVL
Sbjct  230  LYPKVNGSLLPASVISVYSAYVCYTALSSEPRGYACNGLH-HSKAVSLSTLLLGMATTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLL---PLDKADEHEEMEKSKAVTYSYSFFHI  356
            SV+YSA+RAGSST  LSPPSSPR     PLL    L++A E  + E +K V+YSY+FFH+
Sbjct  289  SVLYSALRAGSSTNFLSPPSSPRGAEKTPLLDGKELEEAKEKNDKE-AKPVSYSYTFFHL  347

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLL+GW++S+ ES  L+DVGW SVWVR+ T WVTAAL++WSL+APILFPD
Sbjct  348  IFALASMYSAMLLSGWTSSL-ESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILFPD  406

Query  175  RDF  167
            R+F
Sbjct  407  REF  409



>ref|XP_009365799.1| PREDICTED: probable serine incorporator isoform X1 [Pyrus x bretschneideri]
Length=411

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 145/184 (79%), Gaps = 6/184 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            L+P V GS+ PASVIS+Y  Y+CY+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVL
Sbjct  230  LYPKVNGSLLPASVISVYSAYVCYTALSSEPRGYACNGLH-HSKAVSLSTLLLGMATTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFH  359
            SV+YSA+RAGSST  LSPPSSPR G  +    LD  +  E  EK+    K V+YSY+FFH
Sbjct  289  SVLYSALRAGSSTNFLSPPSSPRGGAAEKTPLLDGKELEEAKEKNDKEAKPVSYSYTFFH  348

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMYSAMLL+GW++S+ ES  L+DVGW SVWVR+ T WVTAAL++WSL+APILFP
Sbjct  349  LIFALASMYSAMLLSGWTSSL-ESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILFP  407

Query  178  DRDF  167
            DR+F
Sbjct  408  DREF  411



>ref|XP_006356686.1| PREDICTED: serine incorporator 3-like [Solanum tuberosum]
Length=409

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 147/180 (82%), Gaps = 1/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC Y+CYS L+SEPRDY CN LH  SK+V+T TL LG+LTTVL
Sbjct  230  LHPKVNGSLLPASVISVYCAYVCYSGLSSEPRDYVCNGLHNKSKAVTTSTLVLGMLTTVL  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SV+YSA+RAGS+TT +SPPSSPR+G  K LL  ++ +  +   +++ V+YSY+FFH+IF+
Sbjct  290  SVLYSALRAGSATTFMSPPSSPRSGEKKSLLASEELESGKGSPEARPVSYSYTFFHLIFA  349

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW TS  ES +L+DVGW S+WVR+ T WVTA L++WSLVAP+ FPDR+F
Sbjct  350  LASMYSAMLLSGW-TSSSESSELIDVGWTSLWVRICTEWVTAGLYVWSLVAPLFFPDREF  408



>emb|CDY24707.1| BnaA05g31060D [Brassica napus]
Length=408

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++  +   L T + 
Sbjct  230  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNRSKAVTASTLILGMLTTVLS  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             +  +  RAGSSTT LSPPSSPRAGG + LL   +  +     +++ V+YSYSFFHIIF+
Sbjct  290  VLYSAL-RAGSSTTFLSPPSSPRAGGKEALLEDPEDGKKNGEAEARPVSYSYSFFHIIFA  348

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  349  LASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAALYIWTLIAPLILPDREF  407



>ref|XP_009342179.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=411

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 145/184 (79%), Gaps = 6/184 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            L+P V GS+ PASVIS+Y  Y+CY+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVL
Sbjct  230  LYPKVNGSLLPASVISVYSAYVCYTALSSEPRGYACNGLH-HSKAVSLSTLLLGMATTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFH  359
            SV+YSA+RAGSST  LSPPSSPR G  +    LD  +  E  EK+    K V+YSY+FFH
Sbjct  289  SVLYSALRAGSSTNFLSPPSSPRGGAAERTPLLDGKELEEAKEKNDKEAKPVSYSYTFFH  348

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMYSAMLL+GW++S+ ES  L+DVGW SVWVR+ T WVTAAL++WSL+APILFP
Sbjct  349  LIFALASMYSAMLLSGWTSSL-ESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILFP  407

Query  178  DRDF  167
            DR+F
Sbjct  408  DREF  411



>gb|KHN37564.1| Putative serine incorporator [Glycine soja]
Length=407

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 133/181 (73%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PA+V+SLYC Y+CY+ L+SEP DYECN L+K     +   +   L T + 
Sbjct  228  LHPQVNGSLLPAAVVSLYCAYVCYTGLSSEPHDYECNGLNKSRAVSTGTLVLGMLTTVLS  287

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS-KAVTYSYSFFHIIF  350
             +  +  RAGSSTT LSPPSSPR GG KPLL   +  + ++ EK  + V+YSYSFFH+IF
Sbjct  288  VLYSAL-RAGSSTTFLSPPSSPRLGGSKPLLEEAEEGKAKKEEKEARPVSYSYSFFHLIF  346

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSL+AP+LFPDR+
Sbjct  347  ALASMYSAMLLSGW-TSTSESSDLIDVGWTSVWVRIGTEWVTAGLYIWSLLAPLLFPDRE  405

Query  169  F  167
            F
Sbjct  406  F  406



>ref|XP_010464184.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=409

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T + 
Sbjct  231  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLS  290

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             +  +  RAGSSTT LSPPSSPR+GG + LL   +  +     +++ V+YSYSFFHIIF+
Sbjct  291  VLYSAL-RAGSSTTFLSPPSSPRSGGKEALLEDPEDGKKGSEAEARPVSYSYSFFHIIFA  349

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  350  LASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAALYIWTLIAPLILPDREF  408



>gb|ACJ84561.1| unknown [Medicago truncatula]
 gb|AFK35204.1| unknown [Medicago truncatula]
 gb|KEH36756.1| TMS membrane protein/tumor differentially protein [Medicago truncatula]
Length=409

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVISLYC Y+CY+ L+SEPR YECN L+K     +   +   L T + 
Sbjct  230  LHPKVNGSLLPASVISLYCAYVCYTGLSSEPRGYECNGLNKSRAVSTGTLVLGMLTTVLS  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIF  350
             +  +  RAGSSTT LSPPSSP+AG  KPLL   +  + ++ EK ++ V+YSYSFFH+IF
Sbjct  290  VLYSAL-RAGSSTTFLSPPSSPKAGESKPLLEEVEEGKSKKEEKEARPVSYSYSFFHLIF  348

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L+LWSL+AP+LFPDR+
Sbjct  349  ALASMYSAMLLSGW-TSTSESSDLIDVGWTSVWVRIGTEWVTAGLYLWSLLAPLLFPDRE  407

Query  169  F  167
            F
Sbjct  408  F  408



>ref|XP_010486107.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 134/182 (74%), Gaps = 5/182 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T + 
Sbjct  231  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLS  290

Query  526  svvysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHII  353
             +  +  RAGSSTT LSPPSSPRAGG + LL  P D   +  E E ++ V+YSYSFFHII
Sbjct  291  VLYSAL-RAGSSTTFLSPPSSPRAGGREALLEDPEDGKKKGGEAE-ARPVSYSYSFFHII  348

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR
Sbjct  349  FALASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAVLYIWTLIAPLILPDR  407

Query  172  DF  167
            +F
Sbjct  408  EF  409



>gb|KDO74827.1| hypothetical protein CISIN_1g039061mg [Citrus sinensis]
Length=399

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 147/183 (80%), Gaps = 4/183 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            L+PSV GS+ PASVIS+YC Y+CY+AL+SEP DY CN LH  SK+V+  TL LG+LTTVL
Sbjct  217  LNPSVNGSLLPASVISVYCAYVCYTALSSEPHDYVCNGLHNKSKAVTISTLVLGMLTTVL  276

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS---KAVTYSYSFFHI  356
            SV+YSA+RAGSSTT LSPPSSP++ G K LL  +  +E  E +K    + V+YSYSFFH+
Sbjct  277  SVLYSALRAGSSTTFLSPPSSPKSAGKKLLLEGEDVEEGTENKKDIEGRPVSYSYSFFHL  336

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ + WVTA L++W+LVAP+LFPD
Sbjct  337  IFALASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICSQWVTAGLYIWTLVAPLLFPD  395

Query  175  RDF  167
            R+F
Sbjct  396  REF  398



>gb|KJB28193.1| hypothetical protein B456_005G040500 [Gossypium raimondii]
Length=410

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 149/182 (82%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN LH  + +VS  TL LG+LTTVL
Sbjct  229  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLHNKASAVSLSTLILGMLTTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHII  353
            SV+YSA+RAGSSTT LSPPSSP+AG  KPLL  D  +E +E ++ +A  V+YSYSFFH+I
Sbjct  289  SVIYSALRAGSSTTFLSPPSSPKAGTKKPLLEGDDVEEGKETKEKEARPVSYSYSFFHLI  348

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW TS  +S  LVDVGW SVWVR+ T WVTAAL++W+LVAP++ PDR
Sbjct  349  FALASMYSAMLLSGW-TSSSDSSDLVDVGWTSVWVRICTEWVTAALYVWTLVAPLIIPDR  407

Query  172  DF  167
            +F
Sbjct  408  EF  409



>ref|XP_009129653.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=408

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 131/180 (73%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++      L T + 
Sbjct  230  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNRSKAVTASTLTLGMLTTVLS  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             +  +  RAGSSTT LSPPSSPRAGG + LL   +  +     +++ V+YSYSFFHIIF+
Sbjct  290  VLYSAL-RAGSSTTFLSPPSSPRAGGKEALLEDPEDGKKNGEAEARPVSYSYSFFHIIFA  348

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGW TAAL++W+L+AP++ PDR+F
Sbjct  349  LASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWATAALYIWTLIAPLILPDREF  407



>ref|XP_006297798.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
 gb|EOA30696.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
Length=410

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 134/182 (74%), Gaps = 5/182 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T + 
Sbjct  231  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLS  290

Query  526  svvysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHII  353
             +  +  RAGSSTT LSPPSSPR+GG + LL  P D   +  E E ++ V+YSYSFFHII
Sbjct  291  VLYSAL-RAGSSTTFLSPPSSPRSGGREALLEDPEDGKKKGGEAE-ARPVSYSYSFFHII  348

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR
Sbjct  349  FALASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAGLYIWTLIAPLILPDR  407

Query  172  DF  167
            +F
Sbjct  408  EF  409



>ref|XP_010436570.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 134/182 (74%), Gaps = 5/182 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T + 
Sbjct  231  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLS  290

Query  526  svvysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHII  353
             +  +  RAGSSTT LSPPSSPR+GG + LL  P D   +  E E ++ V+YSYSFFHII
Sbjct  291  VLYSAL-RAGSSTTFLSPPSSPRSGGREALLEDPEDGKKKGGEAE-ARPVSYSYSFFHII  348

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR
Sbjct  349  FALASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKICTGWVTAVLYIWTLIAPLILPDR  407

Query  172  DF  167
            +F
Sbjct  408  EF  409



>ref|XP_009799680.1| PREDICTED: probable serine incorporator [Nicotiana sylvestris]
Length=408

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN L+K     ++  +   L T + 
Sbjct  230  LHPKVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLNKSKAVTTSTLVLGMLTTVLS  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             +  +  RAGSSTT LSPPSSPR+G  K LL  ++ +  +   +++ V+YSYSFFH+IF+
Sbjct  290  VLYSAL-RAGSSTTFLSPPSSPRSGEKKSLLASEELESGKGSAEARPVSYSYSFFHLIFA  348

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW TS  ES  L+DVGW S+WVR+ T WVTA L++WSLVAP+LFPDR+F
Sbjct  349  LASMYSAMLLSGW-TSSSESSDLIDVGWTSLWVRICTEWVTAGLYIWSLVAPLLFPDREF  407



>gb|AAF30310.1|AC018907_10 hypothetical protein [Arabidopsis thaliana]
Length=315

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 130/180 (72%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T + 
Sbjct  137  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLS  196

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             +  +  RAGSSTT LSPPSSPR+G    LL   +  +     +++ V+YSYSFFHIIF+
Sbjct  197  VLYSAL-RAGSSTTFLSPPSSPRSGVKDALLGDPEDGKKSGEAEARPVSYSYSFFHIIFA  255

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  256  LASMYAAMLLSGWTDS-SESATLIDVGWTSVWVKICTGWVTAGLYIWTLIAPLILPDREF  314



>ref|XP_007147778.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
 gb|ESW19772.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
Length=409

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 132/181 (73%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASV+SLYC Y+CY+ L+SEPRDYECN L+K     ++  +   L T + 
Sbjct  230  LHPTVNGSLLPASVMSLYCAYVCYTGLSSEPRDYECNGLNKSRAVSTSTLVLGMLTTVLS  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS-KAVTYSYSFFHIIF  350
             +  +  RAGSS T LSPPSSP+ G  KPLL   +  + ++ EK  + V+YSYSFFH+IF
Sbjct  290  VLYSAL-RAGSSKTFLSPPSSPKLGESKPLLEEAEEGKAKKEEKEARPVSYSYSFFHLIF  348

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSL AP+ FPDR+
Sbjct  349  ALASMYSAMLLSGW-TSTYESSDLIDVGWTSVWVRIGTEWVTAVLYIWSLTAPLFFPDRE  407

Query  169  F  167
            F
Sbjct  408  F  408



>ref|XP_010322266.1| PREDICTED: serine incorporator 3 [Solanum lycopersicum]
Length=411

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 147/182 (81%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC Y+CYS L+SEPRDY CN LH  SK+V+T TL LG+LTTVL
Sbjct  230  LHPKVNGSLLPASVISVYCAYVCYSGLSSEPRDYVCNGLHNKSKAVTTSTLVLGMLTTVL  289

Query  526  svvysaVRAGssttllsppssPRA--GGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHII  353
            SV+YSA+RAGS+TT +SPPSSPR+  G  K LL  ++ +  +   +++ V+YSY+FFH+I
Sbjct  290  SVLYSALRAGSATTFMSPPSSPRSVVGEKKSLLASEELESGKGSPEARPVSYSYTFFHLI  349

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW TS  ES +L+DVGW S+WVR+ T WVTA L++WSLVAP+L PDR
Sbjct  350  FALASMYSAMLLSGW-TSSSESSELIDVGWTSLWVRICTEWVTAGLYVWSLVAPLLLPDR  408

Query  172  DF  167
            +F
Sbjct  409  EF  410



>ref|XP_002882452.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58711.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 132/182 (73%), Gaps = 5/182 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T + 
Sbjct  231  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLS  290

Query  526  svvysaVRAGssttllsppssPRAGGGKPLL--PLDKADEHEEMEKSKAVTYSYSFFHII  353
             +  +  RAGSSTT LSPPSSPR+G    LL  P D   +  E E ++ V+YSYSFFHII
Sbjct  291  VLYSAL-RAGSSTTFLSPPSSPRSGVKDSLLEDPEDGKKKSGEAE-ARPVSYSYSFFHII  348

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR
Sbjct  349  FALASMYAAMLLSGWTDS-SESATLIDVGWTSVWVKICTGWVTAVLYIWTLIAPLILPDR  407

Query  172  DF  167
            +F
Sbjct  408  EF  409



>ref|XP_001765634.1| predicted protein [Physcomitrella patens]
 gb|EDQ69473.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 136/183 (74%), Gaps = 5/183 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PA VI+ YCTYLCYSAL+SEPR+YECN LHKH  +VS GTL LG+LTT+L
Sbjct  234  LHPQVNGSLLPAGVIAAYCTYLCYSALSSEPRNYECNGLHKHVNAVSKGTLGLGMLTTLL  293

Query  526  svvysaVRAGssttllsppssPRAGG---GKPLLPLDKADEHEEMEKSKAVTYSYSFFHI  356
            SVVYSAVRAGSSTT LSPP+SPR G         P+ +   H +  + + VTY YSFFH+
Sbjct  294  SVVYSAVRAGSSTTFLSPPNSPREGNLLFDDDDKPIRRGGRHSK--EPRPVTYVYSFFHL  351

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            IF+LASMYSAMLLTGW  +      ++DVGW S WVR  T  +TA L++WSLVAP LFPD
Sbjct  352  IFALASMYSAMLLTGWGNANMAEKDIIDVGWPSFWVRFSTEMITAGLYIWSLVAPQLFPD  411

Query  175  RDF  167
            RDF
Sbjct  412  RDF  414



>ref|XP_006595390.1| PREDICTED: probable serine incorporator-like [Glycine max]
Length=375

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            +   V GS+ PA+V+SLYC Y+CY+ L+SEP DYECN L+K     +   +   L T + 
Sbjct  196  VQKQVNGSLLPAAVVSLYCAYVCYTGLSSEPHDYECNGLNKSRAVSTGTLVLGMLTTVLS  255

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS-KAVTYSYSFFHIIF  350
             +  +  RAGSSTT LSPPSSPR GG KPLL   +  + ++ EK  + V+YSYSFFH+IF
Sbjct  256  VLYSAL-RAGSSTTFLSPPSSPRLGGSKPLLEEAEEGKAKKEEKEARPVSYSYSFFHLIF  314

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++WSL+AP+LFPDR+
Sbjct  315  ALASMYSAMLLSGW-TSTSESSDLIDVGWTSVWVRIGTEWVTAGLYIWSLLAPLLFPDRE  373

Query  169  F  167
            F
Sbjct  374  F  374



>ref|NP_187268.2| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAZ23918.1| At3g06170 [Arabidopsis thaliana]
 gb|AEE74356.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 130/180 (72%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L+K     ++  +   L T + 
Sbjct  231  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLS  290

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             +  +  RAGSSTT LSPPSSPR+G    LL   +  +     +++ V+YSYSFFHIIF+
Sbjct  291  VLYSAL-RAGSSTTFLSPPSSPRSGVKDALLGDPEDGKKSGEAEARPVSYSYSFFHIIFA  349

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  350  LASMYAAMLLSGWTDS-SESATLIDVGWTSVWVKICTGWVTAGLYIWTLIAPLILPDREF  408



>ref|XP_009623079.1| PREDICTED: probable serine incorporator [Nicotiana tomentosiformis]
Length=408

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 131/180 (73%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC Y+CY+ L+SEPRDY CN L+K     ++  +   L T + 
Sbjct  230  LHPKVNGSLLPASVISVYCAYVCYTGLSSEPRDYVCNGLNKSKAVTTSTLVLGMLTTVLS  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             +  +  RAGSSTT LSPPSSPR+G  K LL  ++ +  +   + + V+YSYSFFH+IF+
Sbjct  290  VLYSAL-RAGSSTTFLSPPSSPRSGEKKSLLASEELESGKGSTEPRPVSYSYSFFHLIFA  348

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW TS  ES  L+DVGW S+WVR+ T  VTA L++WSLVAP+LFPDR+F
Sbjct  349  LASMYSAMLLSGW-TSSSESSDLIDVGWTSLWVRICTELVTAGLYIWSLVAPLLFPDREF  407



>ref|XP_007034589.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
 gb|EOY05515.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
Length=410

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 149/182 (82%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+C++ L+SEPRDY CN LH  S +VST TL LG+LTTVL
Sbjct  229  LHPAVNGSLLPASVISIYCAYVCFTGLSSEPRDYVCNGLHNKSSAVSTSTLILGMLTTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHII  353
            SV+YSA+RAGSSTT LSPPSSP++GG KPLL  +  +E +E ++ +A  V+YSYSFFH+I
Sbjct  289  SVLYSALRAGSSTTFLSPPSSPKSGGKKPLLEGEDVEEGKEKKEKEARPVSYSYSFFHLI  348

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW TS  ES  LVDVGW SVWVR+ T WVTAAL++W+LVAP +  DR
Sbjct  349  FALASMYSAMLLSGW-TSSSESSVLVDVGWTSVWVRICTEWVTAALYVWTLVAPTILHDR  407

Query  172  DF  167
            +F
Sbjct  408  EF  409



>emb|CAN71158.1| hypothetical protein VITISV_036762 [Vitis vinifera]
Length=309

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 140/185 (76%), Gaps = 18/185 (10%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVISLYC Y+CY+ L+SEPRDY CN LH  SK+VST TL LG+LTTVL
Sbjct  137  LHPRVNGSLLPASVISLYCAYVCYTGLSSEPRDYACNGLHNKSKAVSTSTLILGMLTTVL  196

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEE-----MEKSKAVTYSYSFF  362
            SV+YSAVRAGSSTT L            P  P  K+++ E       E++K V+YSY+FF
Sbjct  197  SVLYSAVRAGSSTTFL----------SPPSSP--KSEDTESGKEKKEEEAKPVSYSYTFF  244

Query  361  HIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILF  182
            H+IF+LASMYSAMLL+GW++S  +S  ++DVGW SVWVR+ T WVTA L++WSL+APILF
Sbjct  245  HLIFALASMYSAMLLSGWTSS-NDSSDMIDVGWTSVWVRICTEWVTALLYVWSLLAPILF  303

Query  181  PDRDF  167
            PDR+F
Sbjct  304  PDREF  308



>gb|AFK47365.1| unknown [Lotus japonicus]
Length=234

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 143/180 (79%), Gaps = 2/180 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PA+VISLYC YLCY+ L+SEPR+YECN L+K  K+V+T TL LG++TTVL
Sbjct  56   LHPRVNGSLLPAAVISLYCAYLCYTGLSSEPRNYECNGLNKS-KAVTTSTLVLGMVTTVL  114

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SV+YSA+RAGSSTT LSPPS PR+G    L  +++    +E +++K V+YSYSFFH IF+
Sbjct  115  SVLYSALRAGSSTTFLSPPSLPRSGSKPLLEEVEEGKTKKEEKEAKPVSYSYSFFHQIFA  174

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMYSAMLL+GW TS  +S  L+DVGW SVWVR+ T WVTA L+ W+L+AP+  PDR+F
Sbjct  175  LASMYSAMLLSGW-TSTSDSSDLIDVGWTSVWVRIGTEWVTAGLYAWTLLAPVFLPDREF  233



>ref|XP_010255869.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=416

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 154/185 (83%), Gaps = 5/185 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCY+ L+SEPRDY CN LHK+SK+VSTGTL LG+LTTVL
Sbjct  231  LHPKVNGSLLPASVISVYCAYLCYTGLSSEPRDYICNGLHKNSKAVSTGTLILGMLTTVL  290

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-----SKAVTYSYSFF  362
            SV+YSAVRAGSSTT LSPPSSP++GG +PLL  D+ +  +E ++     ++ V+Y+Y+FF
Sbjct  291  SVLYSAVRAGSSTTFLSPPSSPKSGGKQPLLESDELEAGKEKKEKKETEAQPVSYNYTFF  350

Query  361  HIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILF  182
            H+IF+LASMYSAMLLTGW++S   S  L+DVGW SVWVR+ T WVTAAL++W+LVA ++F
Sbjct  351  HLIFALASMYSAMLLTGWTSSTSGSSDLIDVGWTSVWVRICTEWVTAALYVWTLVASLIF  410

Query  181  PDRDF  167
            PDR+F
Sbjct  411  PDREF  415



>ref|XP_004486156.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=409

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVISLYC Y+CY+ L+SEPR YECN L+K     +   +   L T + 
Sbjct  230  LHPKVNGSLLPASVISLYCAYVCYTGLSSEPRGYECNGLNKSRAVNTGTLILGMLTTVLS  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME-KSKAVTYSYSFFHIIF  350
             +  +  RAGSSTT LSPPSSP+AG  KPLL   +  + ++ E +++ V+YSYSFFH+IF
Sbjct  290  VLYSAL-RAGSSTTFLSPPSSPKAGESKPLLEEMEEGKTKKEEKQARPVSYSYSFFHLIF  348

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LA+MYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L+LW+L+AP++FPDR+
Sbjct  349  ALATMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRIGTEWVTAGLYLWTLLAPLMFPDRE  407

Query  169  F  167
            F
Sbjct  408  F  408



>ref|XP_008340909.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=409

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+Y  Y+C++AL+SEPRDY CN LH HSK+VS  TL LG+ TTVL
Sbjct  230  LHPKVNGSLLPASVISVYSAYVCFTALSSEPRDYACNGLH-HSKAVSVSTLLLGMATTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLP--LDKADEHEEMEKSKAVTYSYSFFHII  353
            SV+YSA+RAGSSTT LSPP+SPR     PLL     +  + +E +++K V+YSY+FFH+I
Sbjct  289  SVLYSALRAGSSTTFLSPPTSPRGAEKTPLLDGKKLEEGKEKEDKEAKPVSYSYTFFHLI  348

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTAAL++WSL+AP+LFPDR
Sbjct  349  FALASMYSAMLLSGWTDS-SESSDLIDVGWTSVWVRICTEWVTAALYVWSLLAPLLFPDR  407

Query  172  DF  167
            +F
Sbjct  408  EF  409



>ref|XP_010103434.1| putative serine incorporator [Morus notabilis]
 gb|EXB95837.1| putative serine incorporator [Morus notabilis]
Length=409

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVISLYC Y+CY+ L+SEP DY+CN L+K      +  +   L T + 
Sbjct  230  LHPAVNGSLLPASVISLYCAYVCYTGLSSEPHDYKCNGLNKSKAVSLSTLILGMLTTVLS  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK-SKAVTYSYSFFHIIF  350
             +  +  RAGSSTT LSPPSSP++G  KPLL  +  +  E+ EK ++ V+YSYSFFH+IF
Sbjct  290  VLYSAL-RAGSSTTFLSPPSSPKSGAKKPLLEEELEEGKEKKEKETRPVSYSYSFFHLIF  348

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LASMY+AMLL+GW+ S  ES  L+D+GW +VWVR+ TGWVTAALF+WS+VAP+ FPDR+
Sbjct  349  ALASMYAAMLLSGWTNS-SESSDLIDIGWTTVWVRICTGWVTAALFVWSIVAPLFFPDRE  407

Query  169  F  167
            F
Sbjct  408  F  408



>gb|EPS68630.1| hypothetical protein M569_06136 [Genlisea aurea]
Length=410

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 137/181 (76%), Gaps = 4/181 (2%)
 Frame = -1

Query  703  HPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvls  524
            HP V GS+ PASV+S+YC Y+CY+ L+SEPRDY CN L+K SK+V+  TL +G+LTTV S
Sbjct  231  HPQVNGSLLPASVVSIYCAYVCYTGLSSEPRDYVCNGLNK-SKAVTISTLVVGMLTTVFS  289

Query  523  vvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIF  350
            V+YSA RAGSSTT LSPPSSPRA G   LL     D      +S+   V YSYSFFH+IF
Sbjct  290  VLYSAFRAGSSTTFLSPPSSPRAAGKLSLLLGGDGDVESGKGESEGEPVRYSYSFFHLIF  349

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +LA+MYSAMLL+GW TS  E+  L+DVGW SVWVR+ T W TA L++WSLVAP+L PDRD
Sbjct  350  ALATMYSAMLLSGW-TSNSENPDLIDVGWTSVWVRIGTEWATAGLYVWSLVAPVLLPDRD  408

Query  169  F  167
            F
Sbjct  409  F  409



>ref|XP_008223013.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=411

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 146/184 (79%), Gaps = 6/184 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+Y  Y+ Y+AL+SEPRDY CN LH HSK+VS  TL LG++TTVL
Sbjct  230  LHPKVNGSLLPASVISVYSAYVLYTALSSEPRDYACNGLH-HSKAVSVSTLLLGMVTTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGG--KPLLP--LDKADEHEEMEKSKAVTYSYSFFH  359
            SV+YSA+RAGSSTT LSPPSSPRAG    KPLL     +  +  + +++K V+YSY+FFH
Sbjct  289  SVLYSALRAGSSTTFLSPPSSPRAGAAEKKPLLDGKELEEGKETKEKEAKPVSYSYTFFH  348

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTA L++WSLVAP LFP
Sbjct  349  LIFALASMYSAMLLSGWTNS-SESSDLIDVGWTSVWVRICTEWVTAGLYVWSLVAPFLFP  407

Query  178  DRDF  167
            DR+F
Sbjct  408  DREF  411



>ref|XP_008390818.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=411

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 138/184 (75%), Gaps = 6/184 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+Y  Y+CY+AL+SEP  Y CN LH HSK+VS  TL LG+  TVL
Sbjct  230  LHPKVNGSLLPASVISVYSAYVCYTALSSEPHGYACNGLH-HSKAVSLSTLLLGMAMTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKS----KAVTYSYSFFH  359
            SV+YSA+RAGSST  LSPPSSPR G  +     D  +  E  EK+    K V YSY+FFH
Sbjct  289  SVLYSALRAGSSTNFLSPPSSPRGGAAEKTPLFDGKELEEGKEKNDKEVKPVXYSYTFFH  348

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTAAL++WSL+APIL P
Sbjct  349  LIFALASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICTEWVTAALYVWSLIAPILIP  407

Query  178  DRDF  167
            DR+F
Sbjct  408  DREF  411



>ref|XP_011010290.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=417

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 143/184 (78%), Gaps = 5/184 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN LH  SK+VST TL LG+LTTVL
Sbjct  234  LHPAVNGSLLPASVISIYCAYVCYTGLSSEPHDYACNGLHNKSKAVSTSTLVLGMLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKP----LLPLDKADEHEEMEKSKAVTYSYSFFH  359
            SV+YSAVRAGSSTT LSPPSSP+A  GK        L++  E ++  + + V+YSY+FFH
Sbjct  294  SVLYSAVRAGSSTTFLSPPSSPKASAGKKPLLEAEELEEGKEKKKEAEGQPVSYSYTFFH  353

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMYSAMLL+GW T   ES  L+DVGW SVWVR+ T W+T  L++W+L+AP+ FP
Sbjct  354  LIFALASMYSAMLLSGW-TDTSESSSLIDVGWTSVWVRICTEWITGLLYIWTLLAPLFFP  412

Query  178  DRDF  167
            DR+F
Sbjct  413  DREF  416



>ref|XP_006407969.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49422.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=313

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 147/182 (81%), Gaps = 8/182 (4%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++ SK+V+  TL LG+LTTVL
Sbjct  137  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNR-SKAVTASTLILGMLTTVL  195

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME--KSKAVTYSYSFFHII  353
            SV+YSA+RAGSSTT LSPPSSPR+   + LL  D  D  ++    +++ V+YSYSFFHII
Sbjct  196  SVLYSALRAGSSTTFLSPPSSPRS---EALLE-DPEDGKKKSGGGEARPVSYSYSFFHII  251

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR
Sbjct  252  FALASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKLCTGWVTAALYIWTLIAPLILPDR  310

Query  172  DF  167
            +F
Sbjct  311  EF  312



>gb|KDP40096.1| hypothetical protein JCGZ_02094 [Jatropha curcas]
Length=401

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 148/182 (81%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN LHK +K+VST TL LG+LTTVL
Sbjct  220  LHPTVNGSLLPASVISVYCAYVCYTGLSSEPLDYACNGLHKSTKAVSTSTLVLGVLTTVL  279

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHII  353
            SV+YSAVRAGSSTT LSPPSSP+A   K  L  ++ +E +E ++ +A  V+YSY+FFH+I
Sbjct  280  SVLYSAVRAGSSTTFLSPPSSPKASDAKKPLLEEQLEEGKEKKEKEAKPVSYSYTFFHLI  339

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW+ S  E+  L+DVGW SVWVR+ T WVTA L++W+LVAP++ PDR
Sbjct  340  FALASMYSAMLLSGWTNS-SENSDLIDVGWISVWVRICTEWVTAGLYVWTLVAPVILPDR  398

Query  172  DF  167
            +F
Sbjct  399  EF  400



>ref|XP_002312742.1| TMS membrane family protein [Populus trichocarpa]
 gb|EEE90109.1| TMS membrane family protein [Populus trichocarpa]
Length=417

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 142/184 (77%), Gaps = 5/184 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN LH  SK+VST TL LG+LTT+L
Sbjct  234  LHPAVNGSLLPASVISIYCAYVCYTGLSSEPHDYACNGLHNKSKAVSTSTLVLGMLTTIL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKP----LLPLDKADEHEEMEKSKAVTYSYSFFH  359
            SV+YSAVRAGSSTT LSPPSSP+A  GK        L++  E ++  + + V+YSY+FFH
Sbjct  294  SVLYSAVRAGSSTTFLSPPSSPKASAGKKPLLEAEELEEGKEKKKEAEGQPVSYSYTFFH  353

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMYSAMLL+GW T   ES  L+DVGW SVWVR+ T W+T  L+ W+L+AP+ FP
Sbjct  354  LIFALASMYSAMLLSGW-TDTSESSSLIDVGWTSVWVRICTEWITGLLYTWTLLAPLFFP  412

Query  178  DRDF  167
            DR+F
Sbjct  413  DREF  416



>ref|XP_006407970.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49423.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=406

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN L++     ++  +   L T + 
Sbjct  230  LHPAVNGSLLPASVISVYCAYVCYTGLSSEPHDYVCNGLNRSKAVTASTLILGMLTTVLS  289

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEME--KSKAVTYSYSFFHII  353
             +  +  RAGSSTT LSPPSSPR+   + LL  D  D  ++    +++ V+YSYSFFHII
Sbjct  290  VLYSAL-RAGSSTTFLSPPSSPRS---EALLE-DPEDGKKKSGGGEARPVSYSYSFFHII  344

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMY+AMLL+GW+ S  ES  L+DVGW SVWV++ TGWVTAAL++W+L+AP++ PDR
Sbjct  345  FALASMYAAMLLSGWTDS-SESASLIDVGWTSVWVKLCTGWVTAALYIWTLIAPLILPDR  403

Query  172  DF  167
            +F
Sbjct  404  EF  405



>ref|XP_002516786.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF45400.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=414

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 145/182 (80%), Gaps = 3/182 (2%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVIS+YC Y+CY+ L+SEP DY CN LH  +K+VST TL LG+LTT+L
Sbjct  233  LHPTVNGSLLPASVISIYCAYVCYTGLSSEPHDYVCNGLHNKTKAVSTSTLILGMLTTIL  292

Query  526  svvysaVRAGssttllsppssPRAGGGKP--LLPLDKADEHEEMEKSKAVTYSYSFFHII  353
            SV+YSAVRAGSSTT LSPPSSP+A   K   L    +  + ++  +++ V+YSY+FFH+I
Sbjct  293  SVLYSAVRAGSSTTFLSPPSSPKASDAKKPLLEEQLEEGKEKKETEARPVSYSYTFFHLI  352

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+LASMYSAMLL+GW TS  ES  L+DVGW SVWVR+ T WVTA L++W+L+AP+LFPDR
Sbjct  353  FALASMYSAMLLSGW-TSSSESSDLIDVGWTSVWVRICTEWVTAGLYVWTLLAPLLFPDR  411

Query  172  DF  167
            +F
Sbjct  412  EF  413



>ref|XP_007222705.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
 gb|EMJ23904.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
Length=411

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 143/184 (78%), Gaps = 6/184 (3%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+Y  Y+ Y+AL+SEPR Y CN LH HSK+VS  TL LG+ TTVL
Sbjct  230  LHPQVNGSLLPASVISVYSAYVLYTALSSEPRGYACNGLH-HSKAVSVSTLLLGMATTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGG--KPLLP--LDKADEHEEMEKSKAVTYSYSFFH  359
            SV+YSA+RAGSSTT LSPPSSPRAG    KPLL     +  +  + +++K V+YSY+FFH
Sbjct  289  SVLYSALRAGSSTTFLSPPSSPRAGAAEKKPLLDGKELEEGKETKEKEAKPVSYSYTFFH  348

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LASMYSAMLL+GW+ S  ES  L+DVGW SVWVR+ T WVTA L++WSLVAP L P
Sbjct  349  LIFALASMYSAMLLSGWTDS-SESSDLIDVGWTSVWVRICTEWVTAGLYVWSLVAPFLLP  407

Query  178  DRDF  167
            DR+F
Sbjct  408  DREF  411



>ref|XP_010024424.1| PREDICTED: serine incorporator 3 [Eucalyptus grandis]
 gb|KCW60868.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=416

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 144/188 (77%), Gaps = 9/188 (5%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASV+S+Y  Y+CY+AL+ EPR+Y CN LH  S +VST TL LG+LTTVL
Sbjct  229  LHPAVNGSLLPASVVSVYGAYVCYTALSCEPRNYVCNGLHNKSHAVSTSTLILGMLTTVL  288

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEM--------EKSKAVTYSY  371
            SV+YSA RAGSSTT LSPPSSP++G  KPLL  D  +E ++          + + VTYSY
Sbjct  289  SVLYSACRAGSSTTFLSPPSSPKSGAKKPLLDGDDVEEGKDKKDKKDKKEAEPQPVTYSY  348

Query  370  SFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAP  191
            SFFH+IF+LASMYSAMLL+   TS  +S  LVDVGW SVWVR+ T WVT+AL++W+LVAP
Sbjct  349  SFFHLIFALASMYSAMLLSD-WTSSSDSSDLVDVGWTSVWVRIATEWVTSALYIWTLVAP  407

Query  190  ILFPDRDF  167
            ++ PDR+F
Sbjct  408  LILPDREF  415



>gb|KJB67012.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=374

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V  SI PASVISLYC YLCYS LASEPRDYECN LHKHSK++STGT+T+GLLTT+L
Sbjct  234  LHPAVGSSILPASVISLYCMYLCYSGLASEPRDYECNGLHKHSKAISTGTVTVGLLTTIL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLPLDKADE EE EK+KAVTYSY+FFHIIFS
Sbjct  294  SVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLPLDKADE-EEKEKNKAVTYSYAFFHIIFS  352

Query  346  LASMYSAMLLTGWSTSVGESGKL  278
            L S+    LL  +S+  G S  L
Sbjct  353  LLSICGLSLLL-FSSQTGTSKSL  374



>ref|XP_009117775.1| PREDICTED: wall-associated receptor kinase-like 5 isoform X1 
[Brassica rapa]
Length=796

 Score =   147 bits (372),  Expect = 8e-37, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -1

Query  385  VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLW  206
            VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+W
Sbjct  724  VTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIW  783

Query  205  SLVAPILFPDRDF  167
            SLVAPILFPDR+F
Sbjct  784  SLVAPILFPDREF  796



>ref|XP_002956760.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
 gb|EFJ42217.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
Length=415

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 115/180 (64%), Gaps = 21/180 (12%)
 Frame = -1

Query  688  GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysa  509
            GSIFP+S+I+LY  YLC+SAL SEPR+Y CN L     + S GTL LG++ T+ SVVY+A
Sbjct  250  GSIFPSSMIALYAAYLCFSALQSEPREYACNGLGHRLTAASGGTLALGMVVTLASVVYAA  309

Query  508  VRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA------VTYSYSFFHIIFS  347
             RAGS                  L  L+ ++E E +  + A      VTY+YSFFH+IF+
Sbjct  310  FRAGS---------------NTALFTLEGSEEGEPLPSTAAATSLTPVTYNYSFFHLIFA  354

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            LASMY AML+TGW T        +DVGWASVWV+    WVT  L++W+LVAP LFP+RDF
Sbjct  355  LASMYIAMLMTGWGTVAQVRKDRIDVGWASVWVKPAAEWVTGLLYMWTLVAPALFPERDF  414



>ref|XP_005651318.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
 gb|EIE26774.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
Length=429

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 124/206 (60%), Gaps = 32/206 (16%)
 Frame = -1

Query  691  KGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvys  512
             GS+FP+++ + YCTYLCYSAL SEP DY+CN L +   + S  TL  G+L T++SVVYS
Sbjct  224  NGSLFPSAIFTFYCTYLCYSALVSEPHDYQCNGLGQRLNAASATTLATGMLLTLVSVVYS  283

Query  511  aVRAGssttllsppssPRAGG-GKPLLPLDK--------------------------ADE  413
            A+RAGS+T L    S   +    +PLL  DK                          ADE
Sbjct  284  ALRAGSNTALFRLNSEEDSDPVEQPLLDDDKGRAYIAEEGTSAGLDGEVGMSRTARTADE  343

Query  412  HEEMEKS----KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  245
             E  +++      VTY+Y+FFH IF++ASMY AML+TGW T   E   L+DVGW SVWV+
Sbjct  344  AERAKQTADEFTPVTYNYAFFHFIFAVASMYLAMLMTGWGTG-AEERDLIDVGWFSVWVK  402

Query  244  VVTGWVTAALFLWSLVAPILFPDRDF  167
             VT W TAA + W LVAP LFPDR+F
Sbjct  403  FVTQWATAATYCWMLVAPTLFPDREF  428



>ref|XP_002979274.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
 gb|EFJ19682.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
Length=376

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 121/180 (67%), Gaps = 38/180 (21%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVI++YCTY+CYSAL+SEPR+YECN LHKH   VSTGTL LG+LTT+L
Sbjct  234  LHPQVNGSLLPASVIAVYCTYICYSALSSEPRNYECNGLHKHENVVSTGTLVLGMLTTLL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTT LSPPSSPRAG                                   
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPRAG-----------------------------------  318

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
               MYSAMLLTGW  S  E    +DVGW SVWVR+ T W+TA L++WSLVAP+LFPDRDF
Sbjct  319  --LMYSAMLLTGWGNS-AEGKDTIDVGWPSVWVRICTQWLTAILYVWSLVAPLLFPDRDF  375



>gb|ABF97020.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=372

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 118/180 (66%), Gaps = 42/180 (23%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVIS+YC YLCY++L+SEP DY CN LH+HSK VS   L LG+LTTVL
Sbjct  234  LHPQVNGSVMPASVISVYCAYLCYTSLSSEPDDYACNGLHRHSKQVSMSALILGMLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTT LSPPSSPR                                     
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPR-------------------------------------  316

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
                 SAMLLTGW+++  +S +L+DVGW +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  317  -----SAMLLTGWTSAASDSSELMDVGWTTVWVRICTEWATAALYIWTLVAPLLFPDRDF  371



>ref|XP_002506090.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67348.1| predicted protein [Micromonas sp. RCC299]
Length=433

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 108/195 (55%), Gaps = 17/195 (9%)
 Frame = -1

Query  703  HPSVK-GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            HP  K GS+ P++V++ YC YLCYSALASEP +Y CN    ++       +   +LT   
Sbjct  239  HPIAKEGSLLPSAVVTSYCVYLCYSALASEPTEYRCNPRGAYAGDGKASEVASTVLTLAS  298

Query  526  svvysaVRAGssttllsppssPRAG----------GGKPLLPLDKADEHEEMEK-----S  392
                +  RAGSS            G          GG        AD  +++       S
Sbjct  299  VAYSAV-RAGSSDFFGGVNLGDGDGDYAALSGAEMGGGTDADAGDADSEDDVGGAASYPS  357

Query  391  KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALF  212
              V+YSYSFFH IF+LASM+ AML+TGW     +  + VDVGWASVWV++ + WVTA L+
Sbjct  358  GPVSYSYSFFHFIFALASMFLAMLMTGWGRDDYKGAERVDVGWASVWVKMCSVWVTAGLY  417

Query  211  LWSLVAPILFPDRDF  167
             WSL+AP LFPDR+F
Sbjct  418  TWSLIAPALFPDREF  432



>gb|KIZ05916.1| putative serine incorporator [Monoraphidium neglectum]
Length=447

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 122/204 (60%), Gaps = 25/204 (12%)
 Frame = -1

Query  712  SQLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlglltt  533
            S L  S  GS+FP+++ SLY  YLCYSAL SEP+DY CN L     + S  TL +G+L T
Sbjct  243  SVLPCSRGGSLFPSAITSLYVMYLCYSALQSEPKDYACNGLAHRINAASGSTLVIGMLVT  302

Query  532  vlsvvysaVRAGssttllspps----sPRAGGGKPLLPLDK-------------------  422
            +LSVVYSA+RAGS++ L +             G+PLL  +                    
Sbjct  303  LLSVVYSALRAGSNSQLFTLADDNDDIAATSAGRPLLDAEAVGDSADGAAPAAVSASRAP  362

Query  421  -ADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  245
             AD    ++    V+Y+YSFFH+IF+LASMY AML+TGW  +V +    VDVGW SVWV+
Sbjct  363  GADATAALDDYTPVSYNYSFFHLIFALASMYIAMLMTGWG-AVEQEKDRVDVGWTSVWVK  421

Query  244  VVTGWVTAALFLWSLVAPILFPDR  173
                WVTA L+ W+LVAP+LFP+R
Sbjct  422  TGAEWVTALLYSWTLVAPVLFPER  445



>ref|XP_002988580.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
 gb|EFJ10376.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
Length=371

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 117/180 (65%), Gaps = 43/180 (24%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V GS+ PASVI++YCTY+CYSAL+SEPR+YECN LHKH   VSTGTL LG+LTT+L
Sbjct  234  LHPQVNGSLLPASVIAVYCTYICYSALSSEPRNYECNGLHKHENVVSTGTLVLGMLTTLL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            SVVYSAVRAGSSTT LSPPSSPRA                                    
Sbjct  294  SVVYSAVRAGSSTTFLSPPSSPRA------------------------------------  317

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
                  AMLLTGW  S  E    +DVGW SVWVR+ T W+TA L++WSLVAP+LFPDRDF
Sbjct  318  ------AMLLTGWGNS-AEGKDTIDVGWPSVWVRICTQWLTAILYVWSLVAPLLFPDRDF  370



>ref|XP_001416509.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94802.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=393

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 110/183 (60%), Gaps = 3/183 (2%)
 Frame = -1

Query  706  LHPSVK-GSIFPASVISLYCTYLCYSALASEPRDYECN--ALHKHsksvstgtltlgllt  536
            LHP+ + G + P++ ++LYCTYLCYSAL SEP  Y C   +    ++ +      +    
Sbjct  211  LHPAAREGCLLPSAAVTLYCTYLCYSALTSEPSTYACRPRSFIDANEELKKPANLVTTAF  270

Query  535  tvlsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHI  356
            T++SVVY+A+RAG S               +  L     +E  E + S  V Y+YSFFH+
Sbjct  271  TLVSVVYAAMRAGESNFWDMEVDESFQSELREALNDGDEEEASEGDASGPVKYNYSFFHL  330

Query  355  IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            +F+LA+MY++MLLTGW T   +  + +  GWASVWV+  + W T A++LW L+AP LFPD
Sbjct  331  MFALAAMYTSMLLTGWGTRHEDDTEAIGSGWASVWVKFFSVWATGAIYLWCLIAPALFPD  390

Query  175  RDF  167
            R+F
Sbjct  391  REF  393



>ref|XP_011397622.1| putative serine incorporator [Auxenochlorella protothecoides]
 gb|KFM24734.1| putative serine incorporator [Auxenochlorella protothecoides]
Length=435

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 118/193 (61%), Gaps = 11/193 (6%)
 Frame = -1

Query  712  SQLHPSVK-GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllt  536
            +  HP+V+ GS+FPA+ + LY +Y+ YSAL SEPRDY CN L     + S  TL  G+L 
Sbjct  242  TSFHPAVEAGSLFPAAAVGLYVSYMGYSALQSEPRDYACNGLGARLGAASGATLAGGMLL  301

Query  535  tvlsvvysaVRAGssttl-lsppssPRAGGGKPLLPLDKADEHEEMEKSKA-VTYSYSFF  362
            T+LSVVYSA RAGS+T       +     G +PLL  D       ++   A V Y Y+ F
Sbjct  302  TLLSVVYSAFRAGSNTQTFAGAWAGGNGAGAEPLLAGDAELTSAGLDGEDAPVPYCYAQF  361

Query  361  HIIFSLASMYSAMLLTGW--------STSVGESGKLVDVGWASVWVRVVTGWVTAALFLW  206
            + +F+LASMY AML+TGW        S +       VDVGW SVWV++VT WV AAL+ W
Sbjct  362  YAVFALASMYIAMLMTGWGATGQPKASDAAAGCSDAVDVGWTSVWVKIVTQWVAAALYCW  421

Query  205  SLVAPILFPDRDF  167
            +L+AP LFPDR F
Sbjct  422  TLLAPSLFPDRVF  434



>gb|AEW08633.1| hypothetical protein CL976Contig1_02, partial [Pinus radiata]
 gb|AFG57497.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57498.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57499.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57500.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57501.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57502.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57503.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57504.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57505.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57506.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57507.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57508.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57509.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57510.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57511.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57512.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57513.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
Length=84

 Score =   112 bits (280),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  430  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  251
            +++  ++ + ++ + VTYSY+FFH+IF+LASMYSAMLLTGW++S  +  KL+ VGW +VW
Sbjct  1    IEEGQKNAQKDEERPVTYSYTFFHVIFALASMYSAMLLTGWTSSTPDGEKLIGVGWHTVW  60

Query  250  VRVVTGWVTAALFLWSLVAPILFP  179
            VR+ T W+TAAL++WSLVAP+LFP
Sbjct  61   VRICTEWITAALYIWSLVAPLLFP  84



>ref|XP_004302121.1| PREDICTED: serine incorporator 3-like [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GSI PASVIS+YCTYLCYSALASEPRDYECN LHKHSK+VSTGTLTLGLLTTVL
Sbjct  138  LHPTVGGSILPASVISVYCTYLCYSALASEPRDYECNGLHKHSKAVSTGTLTLGLLTTVL  197

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA  386
            SVVYSAVRAGSSTTLLSPPSSPRAG GKPLLPLDK +E EE EK+K+
Sbjct  198  SVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLPLDKPEEREENEKAKS  244



>ref|XP_003075128.1| OJ1249_F12.26 gene product (ISS), partial [Ostreococcus tauri]
Length=423

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 109/184 (59%), Gaps = 4/184 (2%)
 Frame = -1

Query  706  LHP-SVKGSIFPASVISLYCTYLCYSALASEPRDYEC--NALHKHsksvstgtltlgllt  536
             HP S +G + P S ++LYC YLCYSAL+SEP  Y C   +    ++++      +  + 
Sbjct  240  FHPISREGCLLPTSAVTLYCAYLCYSALSSEPSTYACRPQSFIDANEALRKPATLVQTVF  299

Query  535  tvlsvvysaVRAGssttllsppssPRAGG-GKPLLPLDKADEHEEMEKSKAVTYSYSFFH  359
            T++SVVY+A+RAG S            G  G  L   +  +  +E   S  V Y+YSFFH
Sbjct  300  TLVSVVYAAMRAGESNFWHMDVDEEFIGELGDVLNDEEDEEAEDESSPSGPVRYNYSFFH  359

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LA+MY++MLLTGW T   +  + +  GWASVWV+  + W T  ++ W LVAP LFP
Sbjct  360  LIFALAAMYTSMLLTGWGTRRPDDSEAIGSGWASVWVKYFSVWATGTIYAWCLVAPALFP  419

Query  178  DRDF  167
            +R+F
Sbjct  420  EREF  423



>emb|CEG01070.1| TMS membrane protein/tumour differentially expressed protein 
[Ostreococcus tauri]
Length=422

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 109/184 (59%), Gaps = 4/184 (2%)
 Frame = -1

Query  706  LHP-SVKGSIFPASVISLYCTYLCYSALASEPRDYEC--NALHKHsksvstgtltlgllt  536
             HP S +G + P S ++LYC YLCYSAL+SEP  Y C   +    ++++      +  + 
Sbjct  239  FHPISREGCLLPTSAVTLYCAYLCYSALSSEPSTYACRPQSFIDANEALRKPATLVQTVF  298

Query  535  tvlsvvysaVRAGssttllsppssPRAGG-GKPLLPLDKADEHEEMEKSKAVTYSYSFFH  359
            T++SVVY+A+RAG S            G  G  L   +  +  +E   S  V Y+YSFFH
Sbjct  299  TLVSVVYAAMRAGESNFWHMDVDEEFIGELGDVLNDEEDEEAEDESSPSGPVRYNYSFFH  358

Query  358  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  179
            +IF+LA+MY++MLLTGW T   +  + +  GWASVWV+  + W T  ++ W LVAP LFP
Sbjct  359  LIFALAAMYTSMLLTGWGTRRPDDSEAIGSGWASVWVKYFSVWATGTIYAWCLVAPALFP  418

Query  178  DRDF  167
            +R+F
Sbjct  419  EREF  422



>dbj|BAD94992.1| hypothetical protein [Arabidopsis thaliana]
Length=57

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -1

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  1    MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  57



>emb|CAN80334.1| hypothetical protein VITISV_009413 [Vitis vinifera]
Length=57

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -1

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  1    MYSAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  57



>gb|ACG35592.1| hypothetical protein [Zea mays]
Length=57

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -1

Query  337  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  1    MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPVLFPDREF  57



>gb|EFA77480.1| TMS membrane protein [Polysphondylium pallidum PN500]
Length=419

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 101/190 (53%), Gaps = 21/190 (11%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEP-RDYECNALHKHsksvstgtltlglltt  533
            +  PS    +F + V+ LY  YL +SA+ SEP  D   N+  + + ++  G++   +   
Sbjct  239  EFRPS--SGLFQSGVVMLYSAYLVFSAIMSEPSMDNNSNSGKQKTWTIIIGSMFTIISVC  296

Query  532  vlsvvysaVRAGssttllsppssPRAGGGKPLLPL-----DKADEHEEMEKSKAVTYSYS  368
                      +    +  +      +GGG   LP      + AD+  E ++S  V Y+Y+
Sbjct  297  ---------YSAFRASDSNEILGSSSGGGFDKLPTVASDDEAADDKMEDDESGGVAYNYT  347

Query  367  FFHIIFSLASMYSAMLLTGWSTSVGESGK----LVDVGWASVWVRVVTGWVTAALFLWSL  200
            FFHI F+L +MY  MLLT W+T  G SG      VD G  SVWV++V+GW+   L+LW+L
Sbjct  348  FFHITFALGAMYIGMLLTNWATISGTSGSNGDLNVDSGMVSVWVKIVSGWLVHLLYLWTL  407

Query  199  VAPILFPDRD  170
            VAP+L P+R+
Sbjct  408  VAPVLMPNRE  417



>emb|CEG74958.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=320

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -1

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  128  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  186

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  187  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  246

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  247  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  306

Query  190  ILFPDR  173
            +L PDR
Sbjct  307  VLMPDR  312



>emb|CEG74957.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=317

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -1

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  128  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  186

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  187  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  246

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  247  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  306

Query  190  ILFPDR  173
            +L PDR
Sbjct  307  VLMPDR  312



>ref|XP_002982341.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
 gb|EFJ16586.1| hypothetical protein SELMODRAFT_179397 [Selaginella moellendorffii]
Length=382

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 87/180 (48%), Gaps = 16/180 (9%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V   +  + +ISLY  +LC+SA+ SEPR   CN   + +      T+    +  V 
Sbjct  218  LHPKVSAGLMTSGLISLYIVFLCWSAIMSEPRSEVCNTRPRQTGKADLLTVLSFFMGLVA  277

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V  +                       P +P +   + E  E  K V YSY FFH +F+
Sbjct  278  IVFATFSTGA---------------DSNPFVPANPTPDPENQEI-KRVPYSYGFFHFVFA  321

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            + SMY AML  GW+         +DVGWASVWV++   W+ A +++W++V+ ++   R F
Sbjct  322  VGSMYFAMLFVGWNLHQTMLKWSIDVGWASVWVKITNEWLAAGVYIWTMVSSVVSNIRQF  381



>emb|CEG74955.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=393

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 107/186 (58%), Gaps = 20/186 (11%)
 Frame = -1

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K S+   T ++ LG L T L++ YS  RA +
Sbjct  204  SSIVVIYCTYLVLSAVANEPNDKECNPLRK-SQGPQTTSIVLGALFTFLAIAYSTSRAAT  262

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  263  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  322

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  323  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  382

Query  190  ILFPDR  173
            +L PDR
Sbjct  383  VLMPDR  388



>emb|CEG74956.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=396

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 107/186 (58%), Gaps = 20/186 (11%)
 Frame = -1

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K S+   T ++ LG L T L++ YS  RA +
Sbjct  204  SSIVVIYCTYLVLSAVANEPNDKECNPLRK-SQGPQTTSIVLGALFTFLAIAYSTSRAAT  262

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  263  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  322

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  323  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  382

Query  190  ILFPDR  173
            +L PDR
Sbjct  383  VLMPDR  388



>emb|CEG67769.1| hypothetical protein RMATCC62417_04149 [Rhizopus microsporus]
Length=393

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 108/186 (58%), Gaps = 20/186 (11%)
 Frame = -1

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K S+   T ++ LG L T L++ YS  RA +
Sbjct  204  SSIVVIYCTYLVLSAVANEPNDKECNPLRK-SQGPQTTSIVLGALFTFLAIAYSTSRAAT  262

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                 +  SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  263  QGVEGATESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  322

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSL+AP
Sbjct  323  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYIWSLIAP  382

Query  190  ILFPDR  173
            +L PDR
Sbjct  383  VLMPDR  388



>emb|CEG74954.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=457

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -1

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  265  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  323

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  324  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  383

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  384  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  443

Query  190  ILFPDR  173
            +L PDR
Sbjct  444  VLMPDR  449



>emb|CEJ03265.1| hypothetical protein RMCBS344292_17253 [Rhizopus microsporus]
Length=316

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 97/181 (54%), Gaps = 14/181 (8%)
 Frame = -1

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRA--  500
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++  A  
Sbjct  128  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  187

Query  499  ---GssttllsppssPRAGGGKPLLPLDKADEHEEMEKSK--AVTYSYSFFHIIFSLASM  335
               G++ +            G  L   D  D+ ++    +     Y+YSFFH  F++A+M
Sbjct  188  GVEGATESSSREHLIAAVENGSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTFAIAAM  247

Query  334  YSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAPILFPD  176
            Y AMLLT W+T + E        L+ +G  + +VWV+ V+GW+   L++WSL+AP+L PD
Sbjct  248  YVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKAVSGWICYGLYIWSLIAPVLMPD  307

Query  175  R  173
            R
Sbjct  308  R  308



>emb|CEJ00743.1| hypothetical protein RMCBS344292_14792 [Rhizopus microsporus]
Length=453

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 100/182 (55%), Gaps = 16/182 (9%)
 Frame = -1

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRA--  500
            +S++ +YCTYL  SA+A+EP D ECN L +     +T  +   L T +     ++  A  
Sbjct  265  SSIVVIYCTYLVLSAVANEPNDKECNPLRRSQGPQTTSIVLGALFTFLAIAYSTSRAATQ  324

Query  499  ---GssttllsppssPRAGGGKPLLPLDKADEHEEM---EKSKAVTYSYSFFHIIFSLAS  338
               G + +            G  L   D  D+ ++    E+  AV Y+YSFFH  F++A+
Sbjct  325  GVEGVTESSSREHLIAAVENGSALYKDDDQDDDDDEHDDERYGAV-YNYSFFHFTFAIAA  383

Query  337  MYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAPILFP  179
            MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSL+AP+L P
Sbjct  384  MYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYIWSLIAPVLMP  443

Query  178  DR  173
            DR
Sbjct  444  DR  445



>emb|CEG74953.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=454

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 101/186 (54%), Gaps = 20/186 (11%)
 Frame = -1

Query  673  ASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVRAGs  494
            +S++ +YCTYL  SA+A+EP D ECN L K     +T  +   L T +     ++ RA +
Sbjct  265  SSIVVIYCTYLVLSAVANEPNDKECNPLRKSQGPQTTSIVLGALFTFLAIAYSTS-RAAT  323

Query  493  sttllsppssPRA-------GGGKPLLPLDKADEHEEMEKSK-----AVTYSYSFFHIIF  350
                    SS R         G  P   L K D+ ++ +  +        Y+YSFFH  F
Sbjct  324  QGVEGVTESSSREHLIAAVENGTLPRSALYKDDDQDDDDDERDDERYGAVYNYSFFHFTF  383

Query  349  SLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTAALFLWSLVAP  191
            ++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+   L++WSLVAP
Sbjct  384  AIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICYGLYVWSLVAP  443

Query  190  ILFPDR  173
            +L PDR
Sbjct  444  VLMPDR  449



>ref|XP_001770496.1| predicted protein [Physcomitrella patens]
 gb|EDQ64665.1| predicted protein [Physcomitrella patens]
Length=387

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 85/180 (47%), Gaps = 19/180 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH  V   +  + V+SLY  +LC+SA+ SEP    CN   + +      T+         
Sbjct  225  LHAKVNAGLLTSGVMSLYLIFLCWSAIMSEPLSASCNTRERQTGKADWLTII--------  276

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    +     L    ++   G         K DE ++     ++ YSY FFH +F+
Sbjct  277  --------SFLIAFLAIVFATYTTGIDSEAFSFKKKDESKD---DGSLPYSYGFFHFVFA  325

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            L +MY AML  GW+         +D+GWASVWV++V  W+ A ++ W+++ P +  +RDF
Sbjct  326  LGAMYLAMLFVGWNLHQTMHKWSIDIGWASVWVKIVNQWLAAIIYGWTMIGPFVLKNRDF  385



>ref|XP_002304839.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
 gb|EEE79818.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
Length=364

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V GS+ PASVISLYC YLCYS LASEPR+YECN LH+HSK+VSTGTL++GLLTTVL
Sbjct  234  LHPAVNGSVLPASVISLYCMYLCYSGLASEPREYECNGLHRHSKAVSTGTLSIGLLTTVL  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEK  395
            SVVYSAVRAGSST LLSPPSSPRAG  KPLLPL     +++  +
Sbjct  294  SVVYSAVRAGSSTALLSPPSSPRAGADKPLLPLTTRQTNKKKRR  337



>ref|XP_007202140.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
 gb|EMJ03339.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
Length=389

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 79/179 (44%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V   I    ++ LY  ++C+ A+ SEP    CN   + S      T+         
Sbjct  226  LHPKVNAGILTPGLMGLYIVFICWFAIRSEPSGESCNKKAEASNKTDWLTII--------  277

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    +     L    ++   G         K    +E E    V Y Y FFH +F+
Sbjct  278  --------SFVIAVLAMVIATFSTGIDSKCFQFRK----DETESEDDVPYGYGFFHFVFA  325

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+T        +DVGWAS WVR+V  W+   ++LW LVAPI++  R 
Sbjct  326  TGAMYFAMLLIGWNTHQSMKKFTIDVGWASTWVRIVNEWIAVCVYLWMLVAPIIWKSRQ  384



>ref|XP_008242601.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=389

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 79/179 (44%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V   I    ++ LY  ++C+ A+ SEP    CN   + S      T+         
Sbjct  226  LHPKVNAGILTPGLMGLYIVFICWFAIRSEPTGESCNRKAEASNKTDWLTII--------  277

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    +     L    ++   G         K    +E E    V Y Y FFH +F+
Sbjct  278  --------SFVIAVLAMVIATFSTGIDSKCFQFRK----DETESEDDVPYGYGFFHFVFA  325

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+T        +DVGWAS WVR+V  W+   ++LW LVAPI++  R 
Sbjct  326  TGAMYFAMLLIGWNTHQSMKKFTIDVGWASTWVRIVNEWIAVCVYLWMLVAPIIWKSRQ  384



>ref|XP_009336915.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009336916.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 79/179 (44%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V   I    ++ LY  ++C+ A+ SEP    CN     S      T+   ++  + 
Sbjct  235  LHPNVNAGILTPGLMGLYIVFICWFAIRSEPAGTSCNKKADDSTKTDWLTIISFVIAVLA  294

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K    +E E    V Y Y FFH +F+
Sbjct  295  MVIATFS----------------TGIDSKCFQFRK----DETESEDDVPYGYGFFHFVFA  334

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY  MLL GW+T        +DVGWAS WVR+V  W+   ++LW LVAPI+   R 
Sbjct  335  TGAMYFGMLLIGWNTHQSMRRFTIDVGWASTWVRIVNEWIAVCVYLWMLVAPIILESRQ  393



>ref|XP_010049913.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049914.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049915.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049916.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049917.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049918.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049919.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 ref|XP_010049921.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
 gb|KCW82744.1| hypothetical protein EUGRSUZ_C04122 [Eucalyptus grandis]
Length=402

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 79/180 (44%), Gaps = 20/180 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V G      ++ LY  ++C+ A+ SEP    CN                       
Sbjct  239  LHPKVNGGFLTPGLMGLYIVFICWCAIRSEPAGDRCNR----------------KAEASN  282

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
               +  + +     L    ++   G         K D   E +    V Y Y FFH++F+
Sbjct  283  HTDWLTIISFVIALLAMVIATFSTGIDSQCFQFRKNDSKSEDD----VPYGYGFFHLVFA  338

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
              +MY AMLL GW+T        +DVGW S WVRVV  W+   ++LW LVAP+L+  R+F
Sbjct  339  TGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAVCVYLWMLVAPMLWKCREF  398



>ref|NP_189089.3| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAL36053.1| AT3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AAQ89613.1| At3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AEE76900.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 76/178 (43%), Gaps = 16/178 (9%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V       +++ LY  ++C+ A+ SEP    CN                       
Sbjct  241  LHPKVNAGYLTPALMGLYVVFICWCAIRSEPVGESCN----------------RKAAASN  284

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
               +  + +     L    ++   G         K +  +E E    V Y Y FFH +F+
Sbjct  285  RTDWLTIISFVVALLAMVIATFSTGIDSQCFQFKKDENDQEEEAEDDVPYGYGFFHFVFA  344

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
              +MY AMLL GW+T        +DVGW S WVRVV  W+   +++W LVAP++   R
Sbjct  345  TGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAVCVYIWMLVAPLILKSR  402



>gb|KDP32305.1| hypothetical protein JCGZ_13230 [Jatropha curcas]
Length=400

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 83/179 (46%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V G I    ++ LY  +LC+ A+ SEP    CN   + SK     T+   ++  + 
Sbjct  237  LHPKVNGGILTPGLMGLYVVFLCWCAIRSEPAGESCNRKAEASKRTDWLTIISFVVALLA  296

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K+++  E +    V Y Y FFH +F+
Sbjct  297  IVIATFS----------------TGIDSQCFQFRKSEKEAEDD----VPYGYGFFHFVFA  336

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+T        +DVGW S WVRVV  W+   ++LW LVAPI+   R 
Sbjct  337  TGAMYFAMLLIGWNTHHAMQKWTIDVGWTSAWVRVVNEWLAVCVYLWMLVAPIILKWRQ  395



>ref|XP_002965853.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
 ref|XP_002983103.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ15912.1| hypothetical protein SELMODRAFT_117651 [Selaginella moellendorffii]
 gb|EFJ33273.1| hypothetical protein SELMODRAFT_83891 [Selaginella moellendorffii]
Length=365

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 83/180 (46%), Gaps = 19/180 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH  V   +  + +ISLY  +LC+SA+ SEP    CN   + +      T+         
Sbjct  204  LHSKVNAGLLTSGLISLYLVFLCWSAIMSEPASELCNTRSRQTGKADWLTVL--------  255

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    +          ++   G     L L  +   EE      + YSY FFH +F+
Sbjct  256  --------SFLIAFFAIILATFSTGIDSKSLALPHS---EEETSENDIPYSYGFFHFVFA  304

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
            + +MY AML  GW+         +DVGWASVWV+V+  W+ AA+++W++V   +   RDF
Sbjct  305  MGAMYFAMLFVGWNLHQTMHRWSIDVGWASVWVKVINEWLAAAVYIWTMVCVFVLKGRDF  364



>ref|XP_008337449.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=398

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 83/179 (46%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP+V   I    ++ LY  ++C+ A+ SEP    CN   + S      T+   ++  + 
Sbjct  235  LHPNVNAGILTPGLMGLYIVFICWFAIRSEPAGTSCNKKAEDSTKTDWLTIISFVIAVLA  294

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K +   E +    V Y Y FFH +F+
Sbjct  295  MVIATF----------------STGIDSKCFQFRKDEPVSEDD----VPYGYGFFHFVFA  334

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+T        +DVGWAS WVR+V  W+   ++LW LVAPI++ +R 
Sbjct  335  TGAMYFAMLLIGWNTHQSMKKFTLDVGWASTWVRIVNEWIAVCVYLWILVAPIIWKNRQ  393



>ref|XP_003620496.1| Serine incorporator [Medicago truncatula]
 gb|AES76714.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=402

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 82/179 (46%), Gaps = 19/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V G I    ++ LY  +LC+ A+ SEP   +C                +    TV 
Sbjct  239  LHPKVNGGILSPGLMGLYVVFLCWCAIRSEPEGDQC----------------IRTSGTVT  282

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
               +  + +     L    ++   G       L K D+  E +    V Y Y FFH +F+
Sbjct  283  KTDWQNIISFVIGILAIVIATFSTGIDSKCFQLRKGDKPAEEDD---VPYGYGFFHFVFA  339

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+T        +DVGW S WVR+V  W+   ++LW L+API++  R 
Sbjct  340  TGAMYFAMLLIGWNTHHSMRKWSLDVGWTSAWVRIVNEWLAVCVYLWMLIAPIIWKARQ  398



>ref|XP_010656350.1| PREDICTED: probable serine incorporator isoform X2 [Vitis vinifera]
Length=353

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 80/179 (45%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V  S     ++ LY  +LC+ A+ SEP +  CN                  + +  
Sbjct  190  LHPKVDESFLTPGLMGLYVVFLCWCAIRSEPPEDRCNQ----------------KVESAT  233

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
               +  + +     L    ++   G         K D   E +    V Y Y FFH +F+
Sbjct  234  KADWLTIISFIVALLAMVIATFSTGIDSKCFQFRKDDTQAEDD----VPYGYGFFHFVFA  289

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY +MLL GW+T        +DVGW S WVR+V  W+ A ++LW LVAPI++  R 
Sbjct  290  TGAMYFSMLLIGWNTHHSIRKWTIDVGWTSTWVRIVNEWLAACVYLWMLVAPIIWKSRQ  348



>ref|XP_010656344.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656345.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656346.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656347.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656348.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 ref|XP_010656349.1| PREDICTED: probable serine incorporator isoform X1 [Vitis vinifera]
 emb|CBI28099.3| unnamed protein product [Vitis vinifera]
Length=397

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 80/179 (45%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V  S     ++ LY  +LC+ A+ SEP +  CN                  + +  
Sbjct  234  LHPKVDESFLTPGLMGLYVVFLCWCAIRSEPPEDRCNQ----------------KVESAT  277

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
               +  + +     L    ++   G         K D   E +    V Y Y FFH +F+
Sbjct  278  KADWLTIISFIVALLAMVIATFSTGIDSKCFQFRKDDTQAEDD----VPYGYGFFHFVFA  333

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY +MLL GW+T        +DVGW S WVR+V  W+ A ++LW LVAPI++  R 
Sbjct  334  TGAMYFSMLLIGWNTHHSIRKWTIDVGWTSTWVRIVNEWLAACVYLWMLVAPIIWKSRQ  392



>ref|XP_010435285.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=394

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 82/178 (46%), Gaps = 20/178 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V   +   +++ LY  ++C+ A+ SEP    CN   + S      T+   ++  + 
Sbjct  234  LHPKVNAGLLTPALMGLYVVFICWCAIRSEPVGEICNRKAEGSSKTDWLTIISFVVALLA  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K + HEE     A++Y Y FFH +F+
Sbjct  294  MVIATF----------------STGVDSQCFQFRKDENHEE----DAISYGYGFFHFVFA  333

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
              +MY AMLL GW+         +DVGW S WVR+V  W+   +++W LVAP++   R
Sbjct  334  TGAMYFAMLLVGWNIHHSMKKWTIDVGWTSTWVRIVNEWLAVGVYIWMLVAPMVLKSR  391



>ref|XP_010049722.1| PREDICTED: probable serine incorporator [Eucalyptus grandis]
 gb|KCW82479.1| hypothetical protein EUGRSUZ_C03867 [Eucalyptus grandis]
Length=402

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 79/180 (44%), Gaps = 20/180 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V        ++ LY  ++C+ A+ SEP    CN                       
Sbjct  239  LHPKVNAGFLTPGLMGLYIVFICWCAIRSEPAGDRCNR----------------KAEASN  282

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
               +  + +     L    ++   G       L K D   E +    V Y Y FFH++F+
Sbjct  283  HTDWLTIISFVIALLAMVIATFSTGIDSQCFQLRKNDLKSEDD----VPYGYGFFHLVFA  338

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
              +MY AMLL GW+T        +DVGW S WVRVV  W+   ++LW LVAP+L+  R+F
Sbjct  339  TGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAVCVYLWMLVAPMLWKCREF  398



>ref|XP_006285723.1| hypothetical protein CARUB_v10007195mg [Capsella rubella]
 gb|EOA18621.1| hypothetical protein CARUB_v10007195mg [Capsella rubella]
Length=395

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 80/179 (45%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V       +++ LY  ++C+ A+ SEP    CN   + S      T+   ++  + 
Sbjct  235  LHPKVNAGFLTPALMGLYVVFICWCAIRSEPLGETCNRKAEGSSKTDWLTIISFVVALLA  294

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K + HEE     A+ Y Y FFH +F+
Sbjct  295  MVIATFS----------------TGVDSQCFQFRKDENHEE----DAIPYGYGFFHFVFA  334

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+         +DVGW S WVR+V  W+   +++W LVAP++   R 
Sbjct  335  TGAMYFAMLLVGWNIHHSMKKWTIDVGWTSTWVRIVNEWLAVGVYIWMLVAPMVLKSRQ  393



>ref|XP_010450223.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010450225.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=394

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 81/179 (45%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V   +   +++ LY  ++C+ A+ SEP    CN   + S      T+   ++  + 
Sbjct  234  LHPKVNAGLLTPALMGLYVVFICWCAIRSEPLGEICNRKAEGSSKTDWLTIISFVVALLA  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K + HEE     A+ Y Y FFH +F+
Sbjct  294  MVIATF----------------STGVDSQCFQFRKDENHEE----DAIPYGYGFFHFVFA  333

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+         +DVGW S WVR+V  W+   +++W LVAP++   R 
Sbjct  334  TGAMYFAMLLVGWNIHHSMKKWTIDVGWTSTWVRIVNEWLAVGVYIWMLVAPMVLKSRQ  392



>ref|XP_010440600.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010440601.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=394

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 81/178 (46%), Gaps = 20/178 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V   +   +++ LY  ++C+ A+ SEP    CN   + S      T+   ++  + 
Sbjct  234  LHPKVNAGLLTPALMGLYVVFICWCAIRSEPVGEICNRKAEGSSKTDWLTIISFVVALLA  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K + HEE     A+ Y Y FFH +F+
Sbjct  294  MVIATF----------------STGVDSQCFQFRKEENHEE----DAIPYGYGFFHFVFA  333

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
              +MY AMLL GW+         +DVGW S WVR+V  W+   +++W LVAP++   R
Sbjct  334  TGAMYFAMLLVGWNIHHSMKKWTIDVGWTSTWVRIVNEWLAVGVYIWMLVAPMVLKSR  391



>ref|XP_002863245.1| hypothetical protein ARALYDRAFT_497050 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39504.1| hypothetical protein ARALYDRAFT_497050 [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 80/179 (45%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP +       +++ LY  ++C+ A+ SEP    CN   + S      T+   ++  V 
Sbjct  234  LHPKINAGFLTPALMGLYVVFICWCAIRSEPVGETCNRKAEGSSRTDWLTIISFVVALVA  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K + HEE     A+ Y Y FFH +F+
Sbjct  294  MVIATF----------------STGVDSQCFQFRKDENHEE----DAIPYGYGFFHFVFA  333

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+         +DVGW S WVR+V  W+   +++W LVAP++   R 
Sbjct  334  TGAMYFAMLLVGWNIHHSMKKWTIDVGWTSTWVRIVNEWLAVGVYIWMLVAPMVLKSRQ  392



>ref|XP_002324973.1| TMS membrane family protein [Populus trichocarpa]
 gb|EEF03538.1| TMS membrane family protein [Populus trichocarpa]
Length=398

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 80/178 (45%), Gaps = 20/178 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V        ++ LY  +LC+ A+ SEP    CN   + S+     T+   ++  + 
Sbjct  235  LHPKVNAGFLTPGLMGLYVVFLCWCAIRSEPAGESCNRKAEASRRTDWLTIISFIVALLA  294

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K D  +E +    V Y Y FFH +F+
Sbjct  295  IVIATFS----------------TGIDSQCFQFRKGDTQDEDD----VPYGYGFFHFVFA  334

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
              +MY AMLL GW+T        +DVGW S WVR+V  W+   ++LW LVAPIL   R
Sbjct  335  TGAMYFAMLLIGWNTHHIIQKWTIDVGWTSAWVRIVNEWLAVCVYLWMLVAPILLKIR  392



>ref|NP_567403.1| protein MATERNAL EFFECT EMBRYO ARREST 55 [Arabidopsis thaliana]
 gb|AAL24131.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51345.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83266.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=394

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 80/179 (45%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP +       +++ LY  ++C+ A+ SEP    CN   + S      T+   ++  + 
Sbjct  234  LHPKINAGFLTPALMGLYVVFICWCAIRSEPVGETCNRKAEGSSRTDWLTIISFVVALLA  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K + HEE     A+ Y Y FFH +F+
Sbjct  294  MVIATFS----------------TGVDSQCFQFRKDENHEE----DAIPYGYGFFHFVFA  333

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+         +DVGW S WVR+V  W+   +++W LVAP++   R 
Sbjct  334  TGAMYFAMLLVGWNIHHSMKKWTIDVGWTSTWVRIVNEWLAVGVYIWMLVAPMVLKSRQ  392



>ref|XP_008362934.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=392

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 77/174 (44%), Gaps = 20/174 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V   I    ++ LY  ++C+ A+ SEP    CN     S      T+   ++  + 
Sbjct  235  LHPKVNAGILTPGLMGLYIVFICWFAIRSEPAGTSCNKKADDSTKTDWLTIISFVIAVLA  294

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K    +E E    V Y Y FFH +F+
Sbjct  295  MVIATFS----------------TGIDSKCFQFRK----DETESEDDVPYGYGFFHFVFA  334

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
              +MY  MLL GW+T        +DVGWAS WVR+V  W+   ++LW LVAPI+
Sbjct  335  TGAMYFGMLLIGWNTHQSMRRFTIDVGWASTWVRIVNEWIAVCVYLWMLVAPII  388



>gb|EXX70672.1| Tms1p [Rhizophagus irregularis DAOM 197198w]
Length=240

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = -1

Query  445  KPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWST-SVGESGKL  278
            K +LP   LD+  ++   ++   V Y+Y+FFH IF++A+MY AMLLT W+T ++  + KL
Sbjct  138  KEILPPSALDEEADYPMDDEDYDVNYNYTFFHFIFAIAAMYVAMLLTDWNTFTMTGNEKL  197

Query  277  VDVGWAS--VWVRVVTGWVTAALFLWSLVAPILFPDR  173
            V +G +   VWV+V++GWV   L+ WSLVAP LFP+R
Sbjct  198  VVIGRSHTIVWVKVISGWVCFLLYYWSLVAPALFPER  234



>ref|XP_004336528.1| serine incorporator 3, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14515.1| serine incorporator 3, putative [Acanthamoeba castellanii str. 
Neff]
Length=429

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 99/209 (47%), Gaps = 30/209 (14%)
 Frame = -1

Query  712  SQLHPSVKGSIFPASVISLYCTYLCYSALASEPRD--YECNALHKHsksvstgtltlgll  539
             + HP+    +  + V++LYCTYL YSA++SEP    ++CN       SVS+        
Sbjct  221  QEAHPNRGTGLLQSGVVTLYCTYLVYSAVSSEPNSGSFQCNPFDNMGGSVSSVLTGAAFT  280

Query  538  ttvlsvvysaVRAGss------ttllsppssPRAGGGKPLLPLDKADEH-----------  410
               +      +    +      +   +  S   A  G  LLP +  DE+           
Sbjct  281  IVAVCWSTIRMSTKGNDLLEGGSGATTDSSIQAAEEGDKLLP-ELNDENIPGSDSHHDDD  339

Query  409  ------EEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGK---LVDVGWAS  257
                  E+ EK + V Y+YSFFHI F L  MY  M++T W    G S      VD G+ +
Sbjct  340  HHEGKVEDDEKDE-VAYNYSFFHITFMLGVMYVYMIMTDWQIVSGASHSDDFKVDHGFTA  398

Query  256  VWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            VWV++ T W+ A L++W+L+API+ P RD
Sbjct  399  VWVKLSTSWLAALLYIWTLIAPIVLPGRD  427



>ref|XP_008224089.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=428

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 86/174 (49%), Gaps = 20/174 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH +V   +  + +++ Y  +LC+SA+ SEP + ECN   K        +  LG L  + 
Sbjct  254  LHSTVNRGLLSSGIMASYIVFLCWSAIRSEPANEECNR-QKQGNVNGDWSTILGFLIAIC  312

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            S+V +    G  +                        + +E+++   + Y Y FFH+ FS
Sbjct  313  SIVMATFSTGIDSESFQF-------------------QKDEVQEDDDIPYKYGFFHLTFS  353

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            L +MY AML   W+ +       +DVGW S WV++V  W  A++FLW+L++P+L
Sbjct  354  LGAMYFAMLFISWNLNNSAKKWSIDVGWTSTWVKIVNEWFAASIFLWTLISPVL  407



>emb|CDX93013.1| BnaA03g37350D [Brassica napus]
Length=411

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 79/178 (44%), Gaps = 14/178 (8%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V       +++ LY  ++C+ A+ SEP    CN     S      T+   ++  + 
Sbjct  241  LHPKVNAGYLTPALMGLYIVFICWCAIRSEPVGESCNRKSAESNRTDWLTIISFVVALLA  300

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +      S                     D   + E  EK   V Y Y FFH +F+
Sbjct  301  MVIATFSTGIDSQCFQ--------------FKKDANSQGEVEEKEDDVPYGYGFFHFVFA  346

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
              +MY AMLL GW+T        +DVGW S WVR+V  W+   +++W LVAPI+   R
Sbjct  347  TGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWVRIVNEWLAVCVYIWMLVAPIILKSR  404



>ref|XP_004366977.1| TMS membrane protein [Dictyostelium fasciculatum]
 gb|EGG19994.1| TMS membrane protein [Dictyostelium fasciculatum]
Length=420

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 89/174 (51%), Gaps = 8/174 (5%)
 Frame = -1

Query  682  IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvlsvvysaVR  503
            +  + V+ LY TYL YSA+ SEP    C+ +        T  +        +       R
Sbjct  248  LLQSGVVMLYSTYLVYSAIMSEPAS-TCSTMANQDPKNYTVIMGAIFTIISVCYSAF--R  304

Query  502  AGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLASMYS  329
            A  ST LL    SP+          D  D  ++ME  +   V YSY+FFHI F+  +MY 
Sbjct  305  ASDSTELLGKSDSPQYSSLNAFSD-DDDDVPQQMEDDEKHEVAYSYTFFHITFAFGAMYI  363

Query  328  AMLLTGWSTSVGESGKLVDV--GWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
             MLLT WST  G S   ++V  G  SVWV++V+GW+   L+LW+LV P LFP+R
Sbjct  364  GMLLTNWSTIGGLSSASINVDSGLVSVWVKIVSGWLVHLLYLWTLVGPALFPNR  417



>ref|XP_002157067.2| PREDICTED: probable serine incorporator-like, partial [Hydra 
vulgaris]
Length=423

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 93/207 (45%), Gaps = 39/207 (19%)
 Frame = -1

Query  715  YSQLHPSVK-----GSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtlt  551
            +  +HP+++       +  A+ IS Y  YL +S L++EP D  CN               
Sbjct  231  FMSVHPTIQEAQSTSGLLQAACISAYTAYLTWSGLSNEP-DAICNP--------------  275

Query  550  lgllttvlsvvysaVRAGssttllsppssPRAGGGKPL----------LPLDKADEHEEM  401
               +  V +       A          S  R   G  L          + +   DE+EE 
Sbjct  276  GSSINFVQNFGGQTAFAAVVLFCTVVYSCLRTSNGNNLSAKSDDAMGDILIASGDENEES  335

Query  400  EK---------SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWV  248
            EK            V Y+YS+FH  F LAS+Y  M+LT W +      K +   W++VW+
Sbjct  336  EKIGQNVYDNEKVQVAYNYSYFHFTFMLASLYIMMMLTNWYSPENSDSKTLISSWSTVWI  395

Query  247  RVVTGWVTAALFLWSLVAPILFPDRDF  167
            +VV+ W   A+F+W+L+AP+L+PDR+F
Sbjct  396  KVVSCWACFAIFMWTLLAPVLWPDRNF  422



>ref|XP_004230114.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
 ref|XP_010312059.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
 ref|XP_010312061.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
Length=406

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 80/179 (45%), Gaps = 19/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V         + LY  +LC+SA+ SEP + +C    +           +  +  VL
Sbjct  241  LHPKVNAGFLTPGFMGLYVVFLCWSAIRSEPAEEKCIRKAESPTGKGDWFTIISFVVAVL  300

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            ++V +    G                        K D  EE +    V Y Y FFH +F+
Sbjct  301  TIVIATFSTGI---------------DSKCFQFKKDDAPEEDD----VPYGYGFFHFVFA  341

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+ +       +DVGW S WVRVV  W+   +++W LVAPI++  R 
Sbjct  342  TGAMYFAMLLIGWNPNHAMKKFTIDVGWTSTWVRVVNEWLAVCVYIWMLVAPIIWKSRQ  400



>ref|XP_010469509.1| PREDICTED: probable serine incorporator isoform X4 [Camelina 
sativa]
Length=311

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 89/179 (50%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGS-IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
            LH  VK   +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +    
Sbjct  138  LHSKVKNKGLLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI----  193

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
                     A  +  + +  +   +   +     D+A E E+      + YSY FFH++F
Sbjct  194  ---------AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVF  238

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            SL +MY AML   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  239  SLGAMYFAMLFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  297



>ref|XP_010542976.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
Length=420

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 88/174 (51%), Gaps = 19/174 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH  V   +  + +++LY  +LC+SA+ SEP D +CNA  ++  +  T  L+  +     
Sbjct  243  LHSKVNRGLLSSGIMALYVVFLCWSAIRSEPPDVKCNAHTQNGHTDWTTVLSFLI-----  297

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    A  +    +  +   +   +     D+A E ++      + Y+Y FFH++FS
Sbjct  298  --------AIGTIVYATFSTGIDSESFQFQFRKDEAKEEDD------IPYNYGFFHLVFS  343

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            L +MY AML   W+         +DVGW S WV++V  W  +A+++W L+API+
Sbjct  344  LGAMYFAMLFVSWNLEHSARKWSLDVGWTSTWVKIVNEWFASAIYIWKLIAPIV  397



>ref|NP_001240143.1| uncharacterized protein LOC100788574 [Glycine max]
 gb|ACU17946.1| unknown [Glycine max]
 gb|KHN32006.1| Serine incorporator 1 [Glycine soja]
Length=402

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 81/178 (46%), Gaps = 20/178 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V   I    ++ LY  +LC+ A+ SEP   EC  + K   +  T   ++      +
Sbjct  240  LHPKVNAGILSPGLMGLYVVFLCWCAIRSEPEGAEC--IRKSESANKTDWQSIISFVVAI  297

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
              +  A  +               G         K+D   E +    V Y Y FFH +F+
Sbjct  298  LALVVATFS--------------TGIDSKCFQFRKSDPPAEDD----VPYGYGFFHFVFA  339

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
              +MY AMLL GW++        +DVGW S WVR+V  W+   ++LW LVAPI++  R
Sbjct  340  TGAMYFAMLLIGWNSHHSMRKWTIDVGWTSAWVRIVNEWLAVCVYLWMLVAPIIWKSR  397



>ref|XP_003062471.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53290.1| predicted protein [Micromonas pusilla CCMP1545]
Length=442

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = -1

Query  394  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL-VDVGWASVWVRVVTGWVTAA  218
            S  V+Y+Y+FFH IF+LAS Y AML+TGW     E G   VDVGWASV+V+  + WVT  
Sbjct  365  SGPVSYNYAFFHFIFALASAYLAMLMTGWGDRAFEDGGAPVDVGWASVYVKYASLWVTGL  424

Query  217  LFLWSLVAPILFPDRDF  167
            L+ WSLVAP + PDRD+
Sbjct  425  LYTWSLVAPAVMPDRDW  441


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 9/46 (20%)
 Frame = -1

Query  706  LHPSVK---------GSIFPASVISLYCTYLCYSALASEPRDYECN  596
            +HP VK         GS+ P++V++ YCTYL YSALASEP +YECN
Sbjct  227  VHPGVKARSRVVTLDGSLLPSAVVTSYCTYLLYSALASEPSEYECN  272



>ref|XP_009107689.1| PREDICTED: probable serine incorporator [Brassica rapa]
 ref|XP_009107690.1| PREDICTED: probable serine incorporator [Brassica rapa]
 ref|XP_009107691.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=394

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 78/179 (44%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP +       S++ LY  ++C+ A+ SEP    CN   + S      T+         
Sbjct  234  LHPKINAGFLTPSLMGLYVVFICWCAIRSEPVGEICNRNAESSSRTDWLTII--------  285

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    +     L    ++   G         K +  EE     A+ Y Y FFH +F+
Sbjct  286  --------SFVVALLAMVIATFSTGVDSQCFQFRKDENQEE----DAIPYGYGFFHFVFA  333

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+         +DVGW S WVR+V  W+   +++W LVAP++  +R 
Sbjct  334  TGAMYFAMLLIGWNIHHSMKRWTIDVGWTSTWVRIVNEWLAVCIYIWMLVAPMVLKNRQ  392



>ref|XP_011043440.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011043441.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011043442.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=398

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 80/178 (45%), Gaps = 20/178 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V        ++ LY  +LC+ A+ SEP    CN   + S+     T+   ++  + 
Sbjct  235  LHPKVNAGFLTPGLMGLYVVFLCWCAIRSEPAGESCNRKAEASRRTDWLTIISFIVALLA  294

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K D  +E +    V Y Y FFH +F+
Sbjct  295  IVIATFS----------------TGIDSQCFQFRKGDTKDEDD----VPYGYGFFHFVFA  334

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
              +MY AMLL GW+T        +DVGW S WVR+V  W+   ++LW LVAPIL   R
Sbjct  335  TGAMYFAMLLIGWNTHHIIPKWTIDVGWTSAWVRIVNEWLAVCVYLWMLVAPILLKIR  392



>ref|XP_003528920.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN20700.1| Serine incorporator 1 [Glycine soja]
Length=401

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 81/178 (46%), Gaps = 20/178 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V   I    ++ LY  +LC+ A+ SEP   EC  + K   +  T   ++      +
Sbjct  239  LHPKVNAGILSPGLMGLYVVFLCWCAIRSEPAGAEC--IRKSESANKTDWQSIISFVVAI  296

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
              +  A  +               G         K+D   E +    V Y Y FFH +F+
Sbjct  297  LALVVATFS--------------TGIDSECFQFRKSDSPAEDD----VPYGYGFFHFVFA  338

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
              +MY AMLL GW++        +DVGW S WVR+V  W+   ++LW LVAPI++  R
Sbjct  339  TGAMYFAMLLIGWNSHHSMRKWTIDVGWTSAWVRIVNEWLAVCVYLWMLVAPIIWKSR  396



>ref|XP_006347785.1| PREDICTED: probable serine incorporator-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006347786.1| PREDICTED: probable serine incorporator-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006347787.1| PREDICTED: probable serine incorporator-like isoform X3 [Solanum 
tuberosum]
Length=406

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 79/179 (44%), Gaps = 19/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V         + LY  +LC+SA+ SEP +  C    +           +  +  VL
Sbjct  241  LHPKVNAGFLTPGFMGLYVVFLCWSAIRSEPAEERCIRKAESPTGKGDWFTIISFVVAVL  300

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            ++V +    G                        K D  EE +    V Y Y FFH +F+
Sbjct  301  TIVIATFSTGI---------------DSKCFQFKKDDAPEEDD----VPYGYGFFHFVFA  341

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+ +       +DVGW S WVRVV  W+   +++W LVAPI++  R 
Sbjct  342  TGAMYFAMLLIGWNPNHAMKKFTIDVGWTSTWVRVVNEWLAVCVYIWMLVAPIIWKSRQ  400



>ref|XP_004301051.1| PREDICTED: probable serine incorporator [Fragaria vesca subsp. 
vesca]
Length=419

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 83/174 (48%), Gaps = 20/174 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH  V   +  + +++ Y  +LC+SA+ SEP + ECN   K        T  LG L  + 
Sbjct  245  LHSKVNRGLLSSGIMASYIVFLCWSAIRSEPANEECNP-QKQENVNGDWTTILGFLIAIC  303

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            ++V +    G  +                         H E++    + Y Y FFH++FS
Sbjct  304  AIVMATFSTGVDSQSFQF-------------------RHSEVQHEDDIPYKYGFFHLVFS  344

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            L  MY AML   W+ +       +DVGWAS WV++V  W  A++++W+L +P+L
Sbjct  345  LGGMYFAMLFISWNLNNSAKKWSIDVGWASTWVKIVNEWFAASIYIWTLFSPVL  398



>ref|XP_002515588.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47037.1| conserved hypothetical protein [Ricinus communis]
Length=398

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 80/179 (45%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V        ++ LY  +LC+ A+ SEP    CN   + SK     T+   ++  + 
Sbjct  235  LHPKVNAGFLTPGLMGLYVVFLCWCAIRSEPAGESCNRKAEASKRTDWLTIISFVVALLA  294

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K ++  E +    V Y Y FFH +F+
Sbjct  295  IVIATFS----------------TGIDSQCFQFRKGEKEAEDD----VPYGYGFFHFVFA  334

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+T        +DVGW S WVRVV  W+   ++LW LVAPI+   R 
Sbjct  335  TGAMYFAMLLIGWNTHHAIKKWTIDVGWTSTWVRVVNEWLAVCVYLWMLVAPIILKCRQ  393



>ref|XP_010532841.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010532842.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010532843.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010532844.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
Length=402

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 81/179 (45%), Gaps = 19/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V       +++ LY  ++C+ A+ SEP    CN                       
Sbjct  238  LHPKVNAGYLTPAIMGLYVVFICWCAIRSEPAGESCN----------------RKAEASE  281

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
               + ++ +     L    ++   G         + +++++ E   A+ Y Y FFH++F+
Sbjct  282  RTDWLSIISFVVALLAMVIATFSTGIDSQCFQFCRKEDNQDEE---ALPYGYGFFHLVFA  338

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+T        +DVGW S WVRVV  W+   +++W LVAP++   R 
Sbjct  339  TGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAVCIYIWMLVAPLVLKSRQ  397



>ref|XP_006414928.1| hypothetical protein EUTSA_v10025402mg [Eutrema salsugineum]
 gb|ESQ56381.1| hypothetical protein EUTSA_v10025402mg [Eutrema salsugineum]
Length=394

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 77/179 (43%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V       +++ LY  ++C+ A+ SEP    CN   + S      T+         
Sbjct  234  LHPKVNAGFLTPALMGLYVVFICWCAIRSEPVGETCNRKTESSSRTDWLTII--------  285

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    +     L    ++   G         K +  EE     A+ Y Y FFH +F+
Sbjct  286  --------SFVVALLAMVIATFSTGVDSQCFQFRKDETQEE----DAIPYGYGFFHFVFA  333

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+         +DVGW S WVR+V  W+   +++W LVAP++   R 
Sbjct  334  TGAMYFAMLLIGWNIHHSMEKWTIDVGWTSTWVRIVNEWIAVCVYIWMLVAPMVLKSRQ  392



>ref|XP_007226418.1| hypothetical protein PRUPE_ppa023345mg [Prunus persica]
 gb|EMJ27617.1| hypothetical protein PRUPE_ppa023345mg [Prunus persica]
Length=417

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 85/174 (49%), Gaps = 20/174 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH  V   +  + +++ Y  +LC+SA+ SEP + ECN   K        +  LG L  + 
Sbjct  243  LHSKVNRGLLSSGIMASYIVFLCWSAIRSEPANEECNR-QKQGNGNGDWSTILGFLIAIC  301

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            S+V +    G  +                        + +E+++   + Y Y FFH+ FS
Sbjct  302  SIVMATFSTGIDSQSFQF-------------------QKDEVKEDDDIPYKYGFFHLTFS  342

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            L +MY AML   W+ +       +DVGW S WV++V  W  A++FLW+L++P+L
Sbjct  343  LGAMYFAMLFISWNLNNSAKKWSIDVGWTSTWVKIVNEWFAASIFLWTLISPVL  396



>emb|CDY66714.1| BnaCnng52050D [Brassica napus]
Length=419

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 87/178 (49%), Gaps = 19/178 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH  VK S+  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +     
Sbjct  247  LHSKVKSSLMSSGIMASYIVFLCWSAIRSEPSHTKCNAHTQNGHTDWITVLSFLI-----  301

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    A  +  + +  +   +         D+A E ++      + YSY FFH++FS
Sbjct  302  --------AIGAIVMATFSTGIDSESFSFQFRKDEAKEEDD------IPYSYGFFHLVFS  347

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            L +MY AML   W+         +DVGW S WV++V  W  A ++LW L+API+   R
Sbjct  348  LGAMYFAMLFISWNLEHSARKWSMDVGWTSTWVKIVNEWFAAGIYLWKLIAPIVRQPR  405



>ref|NP_850202.4| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEC08798.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=422

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 85/179 (47%), Gaps = 22/179 (12%)
 Frame = -1

Query  706  LHPSVKGS-IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
            LH  VK   +  + +++ Y  +LC+SA+ SEP   +CNA  ++S +  T  L        
Sbjct  251  LHSKVKNRGLLSSGIMASYIVFLCWSAIRSEPSHTKCNAHTQNSHTDWTTIL--------  302

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
                     +          ++   G         K +  EE +    + YSY FFH++F
Sbjct  303  ---------SFLIAIGAIVMATFSTGIDSESFRFRKDEAKEEDD----IPYSYGFFHLVF  349

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            SL +MY AML   W+ S       +DVGW S WV++V  W  AA++LW L+API+   R
Sbjct  350  SLGAMYFAMLFISWNLSHSTEKWSIDVGWTSTWVKIVNEWFAAAIYLWKLIAPIVRQHR  408



>gb|AGG19193.1| maternal effect embryo arrest 55-1, partial [Dimocarpus longan]
 gb|AGG38114.1| maternal effect embryo arrest 55-1 protein [Dimocarpus longan]
Length=398

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 80/178 (45%), Gaps = 20/178 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP V        ++ LY  ++C+ A+ SEP    CN   + S      T+   ++  + 
Sbjct  234  LHPKVNAGFLTPGLMGLYVVFICWCAIRSEPVGENCNRKAEASNRTDWLTIISFIVALLA  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G       L K D   E +    V Y Y FFH++F+
Sbjct  294  MVIATFS----------------TGIDSKCFQLRKDDSPAEDD----VPYGYGFFHLVFA  333

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
              +MY AMLL GW+T        +DVGW S WVR+V  W+   +++W LVAP++   R
Sbjct  334  TGAMYFAMLLIGWNTHHAMKKWTIDVGWTSTWVRIVNEWLAVCVYIWMLVAPVILKHR  391



>ref|XP_001625531.1| predicted protein [Nematostella vectensis]
 gb|EDO33431.1| predicted protein [Nematostella vectensis]
Length=446

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -1

Query  415  EHEEM--EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRV  242
            +H+++  ++S +V+Y+YSFFH  F LAS+Y  M LT W +  G     +   WA+VWV++
Sbjct  359  KHQKVYDDESTSVSYNYSFFHFTFFLASLYIMMTLTNWYSPQGSDFSKLTSNWATVWVKI  418

Query  241  VTGWVTAALFLWSLVAPILFPDRDF  167
             T WV  AL+ W+L+AP+L PDRDF
Sbjct  419  STSWVCLALYAWTLLAPVLMPDRDF  443



>ref|XP_009408948.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408949.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=406

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 79/180 (44%), Gaps = 20/180 (11%)
 Frame = -1

Query  712  SQLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlglltt  533
            + +H  VK       ++ +Y  YLC+SA+ SEP+   CN                     
Sbjct  241  TSMHAKVKVGFLAPGLMGMYVVYLCWSAIRSEPQTEICNK----------------KTEV  284

Query  532  vlsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHII  353
            V S  +  + +     L    ++   G         K     E E    V Y Y FFH +
Sbjct  285  VTSADWLTIVSFVIAVLAIVIATFSTGIDSKCFQFKKT----EAESEDDVPYGYGFFHFV  340

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F++ +MY AML  GW+         +DVGWAS WVR+V  WV   +++W LVAP+++  R
Sbjct  341  FAMGAMYFAMLFVGWNAQNTMQKWTIDVGWASTWVRIVNEWVATLVYIWMLVAPLVWKSR  400



>ref|XP_009141295.1| PREDICTED: probable serine incorporator isoform X1 [Brassica 
rapa]
Length=444

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 87/178 (49%), Gaps = 19/178 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH  VK S+  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +     
Sbjct  272  LHSKVKSSLMSSGIMASYIVFLCWSAIRSEPSHTKCNAHTQNGHTDWITVLSFLI-----  326

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    A  +  + +  +   +         D+A E ++      + YSY FFH++FS
Sbjct  327  --------AIGAIVMATFSTGIDSESFSFQFRKDEAKEEDD------IPYSYGFFHLVFS  372

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            L +MY AML   W+         +DVGW S WV++V  W  A ++LW L+API+   R
Sbjct  373  LGAMYFAMLFISWNLEHSARKWSMDVGWTSTWVKIVNEWFAAGIYLWKLIAPIVRQPR  430



>ref|XP_002994401.1| hypothetical protein SELMODRAFT_449363 [Selaginella moellendorffii]
 gb|EFJ04535.1| hypothetical protein SELMODRAFT_449363 [Selaginella moellendorffii]
Length=386

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 83/181 (46%), Gaps = 20/181 (11%)
 Frame = -1

Query  709  QLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
             LH  V   +  + ++S+Y  +LC+SA+ SEP    CN   + +      TL   ++   
Sbjct  225  SLHSKVNAGLMTSGLMSVYLCFLCWSAIMSEPLSEACNTRPRQTGKSDWLTLLSFVIALA  284

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
              V+ +                   G       L K    +  E    V Y Y FFH++F
Sbjct  285  AIVMAAY----------------STGTDSQTFCLPK----KSFELDDEVPYGYGFFHLVF  324

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
            +L SMY AML  GW+         +DVGWASVWV++   W  AA+++W+++   +  +R+
Sbjct  325  ALGSMYFAMLFIGWNLHQTMHKYSIDVGWASVWVKIANEWAAAAIYIWTMIGRFVLRNRE  384

Query  169  F  167
            F
Sbjct  385  F  385



>ref|XP_010469504.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
 ref|XP_010469505.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
 ref|XP_010469506.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
Length=425

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 89/179 (50%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGS-IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
            LH  VK   +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +    
Sbjct  252  LHSKVKNKGLLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI----  307

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
                     A  +  + +  +   +   +     D+A E E+      + YSY FFH++F
Sbjct  308  ---------AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVF  352

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            SL +MY AML   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  353  SLGAMYFAMLFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  411



>ref|XP_009493459.1| hypothetical protein H696_01290 [Fonticula alba]
 gb|KCV71881.1| hypothetical protein H696_01290 [Fonticula alba]
Length=116

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -1

Query  427  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVG--WASV  254
            D AD     +++++  YSYS FH IF+LA++Y +MLL+ W  ++  SG  + +G  W  +
Sbjct  27   DDADAEHTGDEAESCQYSYSTFHFIFALAALYMSMLLSDWG-AINLSGAPIFIGHEWLGI  85

Query  253  WVRVVTGWVTAALFLWSLVAPILFPDR  173
            W+R+VT W+   LF W+LVAPI  PDR
Sbjct  86   WIRIVTSWIGYGLFSWTLVAPIFLPDR  112



>ref|XP_010469507.1| PREDICTED: probable serine incorporator isoform X2 [Camelina 
sativa]
Length=423

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 89/179 (50%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGS-IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
            LH  VK   +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +    
Sbjct  250  LHSKVKNKGLLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI----  305

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
                     A  +  + +  +   +   +     D+A E E+      + YSY FFH++F
Sbjct  306  ---------AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVF  350

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            SL +MY AML   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  351  SLGAMYFAMLFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  409



>ref|XP_009336936.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Pyrus x bretschneideri]
Length=272

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  236
              +E E    V Y Y FFH +F++ +MY AMLL GW+T        +DVGWA+ WVR+V 
Sbjct  186  RKDETESKDDVPYGYGFFHFVFAMGAMYFAMLLIGWNTHQSMRRFTIDVGWANTWVRIVN  245

Query  235  GWVTAALFLWSLVAPILFPDRD  170
             W+   ++LW LVAPI++  R 
Sbjct  246  EWIAVCVYLWMLVAPIVWESRQ  267



>ref|NP_849373.1| protein MATERNAL EFFECT EMBRYO ARREST 55 [Arabidopsis thaliana]
 gb|AEE83267.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=394

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 79/179 (44%), Gaps = 20/179 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LHP +       +++ LY  ++C+ A+  +P    CN   + S      T+   ++  + 
Sbjct  234  LHPKINAGFLTPALMGLYVVFICWCAIRRQPVGETCNRKAEGSSRTDWLTIISFVVALLA  293

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
             V+ +                   G         K + HEE     A+ Y Y FFH +F+
Sbjct  294  MVIATFS----------------TGVDSQCFQFRKDENHEE----DAIPYGYGFFHFVFA  333

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  170
              +MY AMLL GW+         +DVGW S WVR+V  W+   +++W LVAP++   R 
Sbjct  334  TGAMYFAMLLVGWNIHHSMKKWTIDVGWTSTWVRIVNEWLAVGVYIWMLVAPMVLKSRQ  392



>gb|KDD71727.1| hypothetical protein H632_c4498p0 [Helicosporidium sp. ATCC 50920]
Length=169

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 59/103 (57%), Gaps = 8/103 (8%)
 Frame = -1

Query  454  GGGKPLLPLDKADEHEEMEKSKA-------VTYSYSFFHIIFSLASMYSAMLLTGWSTSV  296
            G  +PL  + +A+  E      A       + YSY+ F+ + +LAS Y +ML+TGW   +
Sbjct  67   GAPRPLRAMSRAEAAEPGSYGAASAAPRAPIPYSYAQFYAVLALASAYVSMLMTGWGAGM  126

Query  295  GESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  167
               G LVDVGW SV+V+  T W    L+LW L AP LFPDRDF
Sbjct  127  MAPG-LVDVGWTSVYVKCATQWGAGVLYLWMLFAPALFPDRDF  168



>ref|XP_010469508.1| PREDICTED: probable serine incorporator isoform X3 [Camelina 
sativa]
Length=423

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 89/178 (50%), Gaps = 20/178 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH   KG +  + +++ Y  +LC+SA+ SEP   +CNA  ++  +     L+  +     
Sbjct  252  LHSKNKG-LLSSGIMASYIVFLCWSAIRSEPLHTKCNAQTQNGHTDWVTILSFLI-----  305

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
                    A  +  + +  +   +   +     D+A E E+      + YSY FFH++FS
Sbjct  306  --------AIGAIVMATFSTGIDSESFRFEFRKDEAKEEED------IPYSYGFFHLVFS  351

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            L +MY AML   W+ S       +DVGW S WV++V  W  AA++LW L++PI+   R
Sbjct  352  LGAMYFAMLFISWNLSHSSREWSIDVGWTSTWVKIVNEWFAAAIYLWKLISPIVRQPR  409



>ref|XP_006295917.1| hypothetical protein CARUB_v10025054mg [Capsella rubella]
 gb|EOA28815.1| hypothetical protein CARUB_v10025054mg [Capsella rubella]
Length=423

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 88/179 (49%), Gaps = 22/179 (12%)
 Frame = -1

Query  706  LHPSVKGS-IFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttv  530
            LH  VK   +  + +++ Y  +LC+SA+ SEP   +CNA  ++S +     L+  +    
Sbjct  252  LHSKVKNRGLLSSGIMASYIVFLCWSAVRSEPSHTKCNAHTQNSHTDWITILSFLIAIGA  311

Query  529  lsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIF  350
            + +   +    S +                     + DE +E E    + YSY FFH++F
Sbjct  312  IVMATFSTGIDSESFKF------------------RRDEGKEEED---IPYSYGFFHLVF  350

Query  349  SLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            SL +MY AML   W+ S       +DVGW S WV++V  W  AA++LW L+API+   R
Sbjct  351  SLGAMYFAMLFISWNLSDSARKWSIDVGWTSTWVKIVNEWFAAAIYLWKLIAPIVRQPR  409



>emb|CBI33332.3| unnamed protein product [Vitis vinifera]
Length=402

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 83/174 (48%), Gaps = 20/174 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH  V   +  + +++ Y  +LC+SA+ SEP    CNA  K  KS +     L  L  + 
Sbjct  228  LHSKVNRGLLSSGIMASYIVFLCWSAIRSEPATENCNA-QKQEKSNADWITVLSFLIAIC  286

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            ++V +    G  +                          +E+++   + Y Y FFH+IFS
Sbjct  287  AIVMATFSTGIDSQSFQF-------------------RKDEVQEEDDIPYKYGFFHMIFS  327

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            L +MY AML   W+         +D+GWAS WV++V  W+ A ++LW L+ P++
Sbjct  328  LGAMYFAMLFISWNLDSSARKWSIDIGWASTWVKIVNEWLAATIYLWKLIFPVV  381



>ref|XP_010650214.1| PREDICTED: probable serine incorporator [Vitis vinifera]
Length=423

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 83/174 (48%), Gaps = 20/174 (11%)
 Frame = -1

Query  706  LHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlgllttvl  527
            LH  V   +  + +++ Y  +LC+SA+ SEP    CNA  K  KS +     L  L  + 
Sbjct  249  LHSKVNRGLLSSGIMASYIVFLCWSAIRSEPATENCNA-QKQEKSNADWITVLSFLIAIC  307

Query  526  svvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFS  347
            ++V +    G  +                          +E+++   + Y Y FFH+IFS
Sbjct  308  AIVMATFSTGIDSQSFQF-------------------RKDEVQEEDDIPYKYGFFHMIFS  348

Query  346  LASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPIL  185
            L +MY AML   W+         +D+GWAS WV++V  W+ A ++LW L+ P++
Sbjct  349  LGAMYFAMLFISWNLDSSARKWSIDIGWASTWVKIVNEWLAATIYLWKLIFPVV  402



>gb|ESA19644.1| hypothetical protein GLOINDRAFT_19362 [Rhizophagus irregularis 
DAOM 181602]
Length=485

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = -1

Query  445  KPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWST-SVGESGKL  278
            K +LP   LD+  ++   ++   V Y+Y+FFH IF++A+MY AMLLT W+T ++  + KL
Sbjct  383  KEILPPSALDEEADYPMDDEDYDVNYNYTFFHFIFAIAAMYVAMLLTDWNTFTMTGNEKL  442

Query  277  VDVGWAS--VWVRVVTGWVTAALFLWSLVAPILFPDR  173
            V +G +   VWV+V++GWV   L+ WSLVAP LFP+R
Sbjct  443  VVIGRSHTIVWVKVISGWVCFLLYYWSLVAPALFPER  479



>ref|XP_009352478.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  415  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  236
             ++E E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  312  RNDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTLDVGWASTWVRIVN  371

Query  235  GWVTAALFLWSLVAPILFPDRD  170
             W+   ++LW LVAPI++  R 
Sbjct  372  EWIAVCVYLWMLVAPIIWKSRQ  393



>gb|KHG16194.1| Serine incorporator 3 [Gossypium arboreum]
Length=400

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 80/181 (44%), Gaps = 18/181 (10%)
 Frame = -1

Query  712  SQLHPSVKGSIFPASVISLYCTYLCYSALASEPRDYECNALHKHsksvstgtltlglltt  533
            + LHP +        ++ LY  ++C+ A+ SEP    CN   + S      T+   ++  
Sbjct  233  ASLHPKINSGFLTPGLMGLYVVFICWCAIRSEPAGESCNRKAEASNKTDWLTIISFIVAL  292

Query  532  vlsvvysaVRAGssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHII  353
            +  V+ +                   G       L  + +    E   AV Y Y FFH +
Sbjct  293  LAMVIATFS----------------TGIDSQCFQLQFSKKEARTED--AVPYCYGFFHFV  334

Query  352  FSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  173
            F+  +MY AMLL GW+T        +DVGW S WVR+V  W+   ++LW LVAP++   R
Sbjct  335  FATGAMYFAMLLIGWNTHHTIKRWTIDVGWTSTWVRIVNEWLAVCVYLWMLVAPVILKWR  394

Query  172  D  170
             
Sbjct  395  Q  395



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395