BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF018I04

Length=819
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002302734.1|  Fumarate hydratase 1 family protein                363   9e-120   Populus trichocarpa [western balsam poplar]
ref|XP_007200983.1|  hypothetical protein PRUPE_ppa004758mg             363   1e-119   Prunus persica
gb|KDP28204.1|  hypothetical protein JCGZ_13975                         363   1e-119   Jatropha curcas
ref|XP_011007799.1|  PREDICTED: fumarate hydratase 1, mitochondrial     360   1e-118   Populus euphratica
ref|XP_010103413.1|  Fumarate hydratase 1                               360   2e-118   Morus notabilis
ref|XP_008359427.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    360   3e-118   
ref|XP_007145184.1|  hypothetical protein PHAVU_007G217600g             359   6e-118   Phaseolus vulgaris [French bean]
ref|XP_008386708.1|  PREDICTED: fumarate hydratase 1, mitochondrial     362   7e-118   
ref|XP_011079617.1|  PREDICTED: fumarate hydratase 1, mitochondrial     358   1e-117   Sesamum indicum [beniseed]
ref|XP_009346608.1|  PREDICTED: fumarate hydratase 1, mitochondrial     358   1e-117   Pyrus x bretschneideri [bai li]
ref|XP_003518952.1|  PREDICTED: fumarate hydratase 1, mitochondrial     358   2e-117   Glycine max [soybeans]
gb|KHN08665.1|  Fumarate hydratase 2, chloroplastic                     356   3e-117   Glycine soja [wild soybean]
ref|XP_009622151.1|  PREDICTED: fumarate hydratase 1, mitochondri...    354   4e-117   Nicotiana tomentosiformis
ref|XP_003536023.1|  PREDICTED: fumarate hydratase 1, mitochondri...    357   4e-117   Glycine max [soybeans]
gb|KHN30668.1|  Fumarate hydratase 1, mitochondrial                     357   4e-117   Glycine soja [wild soybean]
ref|XP_004495932.1|  PREDICTED: fumarate hydratase 1, mitochondri...    357   5e-117   Cicer arietinum [garbanzo]
ref|XP_010321878.1|  PREDICTED: fumarate hydratase 1, mitochondri...    353   1e-116   Solanum lycopersicum
ref|XP_003518957.1|  PREDICTED: fumarate hydratase 1, mitochondri...    354   2e-116   Glycine max [soybeans]
ref|XP_009622148.1|  PREDICTED: fumarate hydratase 1, mitochondri...    355   4e-116   Nicotiana tomentosiformis
ref|XP_009778286.1|  PREDICTED: fumarate hydratase 1, mitochondri...    353   7e-116   Nicotiana sylvestris
ref|XP_004240578.1|  PREDICTED: fumarate hydratase 1, mitochondri...    353   8e-116   Solanum lycopersicum
ref|NP_001119412.1|  fumarate hydratase 2                               350   3e-115   
gb|EYU46762.1|  hypothetical protein MIMGU_mgv1a005258mg                352   4e-115   Erythranthe guttata [common monkey flower]
ref|XP_004247395.1|  PREDICTED: fumarate hydratase 1, mitochondrial     352   4e-115   Solanum lycopersicum
ref|XP_010442613.1|  PREDICTED: fumarate hydratase 2, chloroplast...    351   8e-115   Camelina sativa [gold-of-pleasure]
ref|NP_001275422.1|  fumarate hydratase 1, mitochondrial-like           351   8e-115   Solanum tuberosum [potatoes]
ref|XP_010442599.1|  PREDICTED: fumarate hydratase 2, chloroplastic     351   9e-115   Camelina sativa [gold-of-pleasure]
ref|NP_199908.1|  fumarate hydratase 2                                  351   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442609.1|  PREDICTED: fumarate hydratase 2, chloroplast...    351   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_008345222.1|  PREDICTED: fumarate hydratase 1, mitochondrial     350   1e-114   
ref|XP_006359871.1|  PREDICTED: fumarate hydratase 1, mitochondri...    350   2e-114   
ref|XP_010482421.1|  PREDICTED: fumarate hydratase 2, chloroplast...    350   2e-114   Camelina sativa [gold-of-pleasure]
ref|XP_009802913.1|  PREDICTED: fumarate hydratase 1, mitochondrial     349   2e-114   Nicotiana sylvestris
ref|XP_006280350.1|  hypothetical protein CARUB_v10026277mg             350   2e-114   Capsella rubella
ref|XP_010482423.1|  PREDICTED: fumarate hydratase 2, chloroplast...    350   3e-114   Camelina sativa [gold-of-pleasure]
gb|KHG29130.1|  Fumarate hydratase 1, mitochondrial -like protein       348   4e-114   Gossypium arboreum [tree cotton]
gb|KJB09427.1|  hypothetical protein B456_001G141300                    348   2e-113   Gossypium raimondii
ref|XP_007051016.1|  Fumarase 1 isoform 2                               347   4e-113   
ref|XP_007051015.1|  Fumarase 1 isoform 1                               347   5e-113   
ref|XP_010442577.1|  PREDICTED: fumarate hydratase 2, chloroplast...    346   6e-113   
ref|XP_008795801.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    345   6e-113   Phoenix dactylifera
gb|KDO87119.1|  hypothetical protein CISIN_1g010908mg                   343   7e-113   Citrus sinensis [apfelsine]
ref|XP_010442576.1|  PREDICTED: fumarate hydratase 2, chloroplast...    346   1e-112   Camelina sativa [gold-of-pleasure]
gb|KDO87117.1|  hypothetical protein CISIN_1g010908mg                   343   2e-112   Citrus sinensis [apfelsine]
ref|XP_011458750.1|  PREDICTED: fumarate hydratase 1, mitochondri...    344   4e-112   Fragaria vesca subsp. vesca
ref|XP_011458749.1|  PREDICTED: fumarate hydratase 1, mitochondri...    344   4e-112   Fragaria vesca subsp. vesca
ref|XP_006444417.1|  hypothetical protein CICLE_v10019838mg             343   7e-112   
ref|XP_006444418.1|  hypothetical protein CICLE_v10019838mg             343   8e-112   Citrus clementina [clementine]
ref|XP_009378742.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    345   2e-111   
ref|XP_010523964.1|  PREDICTED: fumarate hydratase 1, mitochondrial     342   2e-111   Tarenaya hassleriana [spider flower]
ref|XP_006480011.1|  PREDICTED: fumarate hydratase 1, mitochondri...    343   3e-111   
ref|XP_004152237.1|  PREDICTED: fumarate hydratase 1, mitochondri...    342   3e-111   Cucumis sativus [cucumbers]
emb|CDP17101.1|  unnamed protein product                                341   4e-111   Coffea canephora [robusta coffee]
ref|XP_011082445.1|  PREDICTED: fumarate hydratase 1, mitochondri...    339   4e-111   Sesamum indicum [beniseed]
emb|CDY51427.1|  BnaA04g27040D                                          337   5e-111   Brassica napus [oilseed rape]
ref|NP_182273.1|  fumarate hydratase 1                                  340   2e-110   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19491.1|  AT2G47510                                              338   6e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880309.1|  hypothetical protein ARALYDRAFT_483931             338   1e-109   
emb|CDY27481.1|  BnaC04g51220D                                          337   1e-109   Brassica napus [oilseed rape]
ref|XP_002273033.1|  PREDICTED: fumarate hydratase 1, mitochondrial     338   1e-109   Vitis vinifera
ref|XP_006397946.1|  hypothetical protein EUTSA_v10001422mg             338   1e-109   Eutrema salsugineum [saltwater cress]
ref|XP_008454312.1|  PREDICTED: fumarate hydratase 1, mitochondrial     338   1e-109   Cucumis melo [Oriental melon]
ref|XP_010069886.1|  PREDICTED: fumarate hydratase 1, mitochondrial     337   3e-109   Eucalyptus grandis [rose gum]
ref|XP_006296086.1|  hypothetical protein CARUB_v10025236mg             336   4e-109   Capsella rubella
ref|XP_004290822.2|  PREDICTED: fumarate hydratase 1, mitochondri...    335   6e-109   Fragaria vesca subsp. vesca
ref|XP_010506787.1|  PREDICTED: fumarate hydratase 1, mitochondri...    336   6e-109   Camelina sativa [gold-of-pleasure]
gb|KJB22510.1|  hypothetical protein B456_004G051500                    334   7e-109   Gossypium raimondii
ref|XP_010518455.1|  PREDICTED: fumarate hydratase 1, mitochondri...    335   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_010507882.1|  PREDICTED: fumarate hydratase 1, mitochondri...    335   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_010507880.1|  PREDICTED: fumarate hydratase 1, mitochondri...    335   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_006840369.1|  hypothetical protein AMTR_s00045p00124970          335   2e-108   
ref|XP_009142525.1|  PREDICTED: fumarate hydratase 1, mitochondrial     335   2e-108   Brassica rapa
ref|XP_003591472.1|  Fumarate hydratase                                 334   3e-108   Medicago truncatula
gb|KFK37522.1|  hypothetical protein AALP_AA4G268000                    333   1e-107   Arabis alpina [alpine rockcress]
ref|XP_007145185.1|  hypothetical protein PHAVU_007G217700g             332   1e-107   Phaseolus vulgaris [French bean]
ref|XP_010680310.1|  PREDICTED: fumarate hydratase 1, mitochondrial     331   5e-107   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB39989.1|  fumarase                                                328   4e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010026118.1|  PREDICTED: fumarate hydratase 1, mitochondri...    325   7e-105   
gb|KCW58396.1|  hypothetical protein EUGRSUZ_H01083                     325   8e-105   Eucalyptus grandis [rose gum]
ref|XP_002864085.1|  hypothetical protein ARALYDRAFT_495160             325   9e-105   Arabidopsis lyrata subsp. lyrata
gb|ABK24782.1|  unknown                                                 323   9e-104   Picea sitchensis
ref|XP_002523133.1|  aspartate ammonia lyase, putative                  322   1e-103   
ref|XP_009384520.1|  PREDICTED: fumarate hydratase 1, mitochondrial     322   3e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007445160.1|  PREDICTED: fumarate hydratase, mitochondrial...    310   1e-102   
gb|KDO87114.1|  hypothetical protein CISIN_1g010908mg                   318   4e-102   Citrus sinensis [apfelsine]
ref|XP_010259454.1|  PREDICTED: fumarate hydratase 1, mitochondrial     318   5e-102   Nelumbo nucifera [Indian lotus]
ref|XP_008111212.1|  PREDICTED: fumarate hydratase, mitochondrial...    316   6e-102   Anolis carolinensis [Carolina anole]
ref|XP_010938348.1|  PREDICTED: fumarate hydratase 1, mitochondrial     317   1e-101   Elaeis guineensis
ref|XP_008111211.1|  PREDICTED: fumarate hydratase, mitochondrial...    315   1e-100   Anolis carolinensis [Carolina anole]
ref|NP_001146296.1|  uncharacterized protein LOC100279871               314   2e-100   Zea mays [maize]
ref|XP_008235134.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    314   2e-100   
ref|XP_004984441.1|  PREDICTED: fumarate hydratase 1, mitochondri...    314   3e-100   Setaria italica
ref|XP_008790868.1|  PREDICTED: fumarate hydratase 1, mitochondri...    314   3e-100   Phoenix dactylifera
gb|EEE59021.1|  hypothetical protein OsJ_10766                          313   3e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006134175.1|  PREDICTED: fumarate hydratase, mitochondrial...    312   4e-100   
gb|ABF95833.1|  Fumarate hydratase 1, mitochondrial precursor, pu...    313   4e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006281482.1|  hypothetical protein CARUB_v10027566mg             313   5e-100   
gb|EEC75213.1|  hypothetical protein OsI_11478                          313   5e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_008167561.1|  PREDICTED: fumarate hydratase, mitochondrial...    311   5e-100   
ref|XP_002283168.2|  PREDICTED: fumarate hydratase 1, mitochondrial     313   6e-100   
dbj|BAN21048.1|  aspartate ammonia lyase                                313   6e-100   Riptortus pedestris
gb|ACL53645.1|  unknown                                                 313   7e-100   Zea mays [maize]
gb|KJB81339.1|  hypothetical protein B456_013G139800                    301   7e-100   Gossypium raimondii
ref|XP_009490201.1|  PREDICTED: fumarate hydratase, mitochondrial       301   2e-99    Pelecanus crispus
gb|EMS52788.1|  Fumarate hydratase 2, chloroplastic                     311   2e-99    Triticum urartu
ref|XP_006651566.1|  PREDICTED: fumarate hydratase 1, mitochondri...    311   3e-99    Oryza brachyantha
ref|XP_006134174.1|  PREDICTED: fumarate hydratase, mitochondrial...    311   3e-99    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010245463.1|  PREDICTED: fumarate hydratase 1, mitochondri...    313   3e-99    
ref|XP_008573483.1|  PREDICTED: fumarate hydratase, mitochondrial       310   4e-99    Galeopterus variegatus [Malayan flying lemur]
ref|XP_008167560.1|  PREDICTED: fumarate hydratase, mitochondrial...    311   4e-99    
gb|EMT27288.1|  Fumarate hydratase 2, chloroplastic                     311   4e-99    
ref|XP_007058980.1|  PREDICTED: fumarate hydratase, mitochondrial...    310   6e-99    Chelonia mydas [green seaturtle]
gb|KFZ47909.1|  hypothetical protein N321_01653                         303   6e-99    Antrostomus carolinensis
ref|XP_006638882.1|  PREDICTED: fumarate hydratase, mitochondrial...    310   7e-99    
ref|XP_003557953.1|  PREDICTED: fumarate hydratase 1, mitochondri...    310   7e-99    Brachypodium distachyon [annual false brome]
ref|XP_005296563.1|  PREDICTED: fumarate hydratase, mitochondrial...    310   8e-99    Chrysemys picta bellii
ref|XP_003800133.1|  PREDICTED: fumarate hydratase, mitochondrial       308   1e-98    
ref|NP_851166.1|  fumarate hydratase 2                                  309   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006993784.1|  PREDICTED: fumarate hydratase, mitochondrial       308   3e-98    
ref|XP_007638787.1|  PREDICTED: fumarate hydratase, mitochondrial...    306   3e-98    Cricetulus griseus [Chinese hamsters]
ref|XP_006142426.1|  PREDICTED: fumarate hydratase, mitochondrial...    306   3e-98    
ref|XP_004653497.1|  PREDICTED: fumarate hydratase, mitochondrial       307   4e-98    Jaculus jaculus
gb|EAW70093.1|  fumarate hydratase, isoform CRA_d                       306   4e-98    Homo sapiens [man]
ref|XP_010170425.1|  PREDICTED: fumarate hydratase, mitochondrial       301   4e-98    Antrostomus carolinensis
gb|AAY59704.1|  fumarate hydratase                                      307   4e-98    Cricetulus griseus [Chinese hamsters]
gb|KFU98791.1|  hypothetical protein N339_03040                         307   5e-98    Pterocles gutturalis
ref|XP_004895655.1|  PREDICTED: fumarate hydratase, mitochondrial...    306   5e-98    
ref|XP_004626976.1|  PREDICTED: fumarate hydratase, mitochondrial       306   5e-98    Octodon degus
ref|XP_010075048.1|  PREDICTED: fumarate hydratase, mitochondrial       307   6e-98    Pterocles gutturalis
gb|EFX85065.1|  hypothetical protein DAPPUDRAFT_46417                   307   7e-98    Daphnia pulex
ref|XP_010811426.1|  PREDICTED: fumarate hydratase, mitochondrial...    306   7e-98    Bos taurus [bovine]
ref|XP_003893750.1|  PREDICTED: fumarate hydratase, mitochondrial       308   7e-98    Papio anubis [baboon]
ref|XP_010811425.1|  PREDICTED: fumarate hydratase, mitochondrial...    306   8e-98    
pdb|3E04|A  Chain A, Crystal Structure Of Human Fumarate Hydratase      307   9e-98    Homo sapiens [man]
ref|XP_010392198.1|  PREDICTED: fumarate hydratase, mitochondrial       306   9e-98    
ref|XP_003499892.1|  PREDICTED: fumarate hydratase, mitochondrial...    308   1e-97    Cricetulus griseus [Chinese hamsters]
ref|XP_008847403.1|  PREDICTED: fumarate hydratase, mitochondrial       307   1e-97    Nannospalax galili
gb|EOA97454.1|  Fumarate hydratase, mitochondrial                       306   1e-97    Anas platyrhynchos [duck]
ref|XP_005368585.1|  PREDICTED: fumarate hydratase, mitochondrial       307   1e-97    Microtus ochrogaster [prairie voles]
ref|XP_009675029.1|  PREDICTED: fumarate hydratase, mitochondrial       305   1e-97    Struthio camelus australis
gb|KFW11876.1|  hypothetical protein N326_13222                         306   1e-97    Eurypyga helias
ref|XP_004895654.1|  PREDICTED: fumarate hydratase, mitochondrial...    306   1e-97    
gb|EHH50891.1|  hypothetical protein EGM_01787                          307   1e-97    Macaca fascicularis [crab eating macaque]
gb|KFV82233.1|  hypothetical protein N308_03081                         306   1e-97    Struthio camelus australis
ref|XP_008524760.1|  PREDICTED: fumarate hydratase, mitochondrial       299   2e-97    Equus przewalskii [Przewalski horse]
gb|KFZ60559.1|  hypothetical protein N338_09291                         306   2e-97    Podiceps cristatus
ref|XP_007988126.1|  PREDICTED: fumarate hydratase, mitochondrial       307   2e-97    Chlorocebus sabaeus
sp|Q60HF9.1|FUMH_MACFA  RecName: Full=Fumarate hydratase, mitocho...    307   2e-97    Macaca fascicularis [crab eating macaque]
ref|XP_005078228.1|  PREDICTED: fumarate hydratase, mitochondrial       307   2e-97    Mesocricetus auratus [Syrian golden hamster]
ref|XP_004028710.1|  PREDICTED: fumarate hydratase, mitochondrial       307   2e-97    Gorilla gorilla gorilla [lowland gorilla]
gb|KFO70082.1|  hypothetical protein N303_02489                         306   2e-97    Cuculus canorus
ref|XP_006277022.1|  PREDICTED: fumarate hydratase, mitochondrial...    307   2e-97    
gb|EAW70090.1|  fumarate hydratase, isoform CRA_a                       306   2e-97    Homo sapiens [man]
ref|XP_004895653.1|  PREDICTED: fumarate hydratase, mitochondrial...    307   2e-97    
ref|XP_002760919.1|  PREDICTED: fumarate hydratase, mitochondrial       307   2e-97    Callithrix jacchus [common marmoset]
ref|XP_009508750.1|  PREDICTED: fumarate hydratase, mitochondrial       305   2e-97    Phalacrocorax carbo [common cormorant]
ref|XP_010182284.1|  PREDICTED: fumarate hydratase, mitochondrial       305   2e-97    Mesitornis unicolor
ref|XP_010382999.1|  PREDICTED: fumarate hydratase, mitochondrial       307   2e-97    Rhinopithecus roxellana
ref|XP_004450320.1|  PREDICTED: fumarate hydratase, mitochondrial...    303   2e-97    
ref|XP_005024942.1|  PREDICTED: fumarate hydratase, mitochondrial...    306   2e-97    Anas platyrhynchos [duck]
ref|XP_003267364.1|  PREDICTED: fumarate hydratase, mitochondrial       306   2e-97    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_009561479.1|  PREDICTED: fumarate hydratase, mitochondrial       306   2e-97    Cuculus canorus
ref|XP_003824573.1|  PREDICTED: fumarate hydratase, mitochondrial       306   2e-97    Pan paniscus [bonobo]
ref|NP_001267172.1|  fumarate hydratase, mitochondrial                  306   2e-97    Pan troglodytes
ref|XP_005969001.1|  PREDICTED: fumarate hydratase, mitochondrial       306   2e-97    Pantholops hodgsonii [Tibetan antelope]
ref|XP_003474362.1|  PREDICTED: fumarate hydratase, mitochondrial       306   3e-97    Cavia porcellus [guinea pig]
ref|XP_009439959.1|  PREDICTED: fumarate hydratase, mitochondrial...    306   3e-97    
ref|NP_000134.2|  fumarate hydratase, mitochondrial                     306   3e-97    Homo sapiens [man]
gb|EAW70091.1|  fumarate hydratase, isoform CRA_b                       306   3e-97    Homo sapiens [man]
gb|AAH06048.1|  Fumarate hydratase 1                                    306   3e-97    Mus musculus [mouse]
gb|KFW87389.1|  hypothetical protein N305_02194                         305   3e-97    Manacus vitellinus
gb|KFO62089.1|  hypothetical protein N302_14449                         305   3e-97    Corvus brachyrhynchos
ref|NP_001125540.1|  fumarate hydratase, mitochondrial                  306   3e-97    Pongo abelii [orang utan]
ref|XP_005041811.1|  PREDICTED: fumarate hydratase, mitochondrial...    305   3e-97    
ref|XP_010640964.1|  PREDICTED: fumarate hydratase, mitochondrial       306   3e-97    Fukomys damarensis [Damara mole rat]
ref|XP_009572884.1|  PREDICTED: fumarate hydratase, mitochondrial       305   3e-97    Fulmarus glacialis
ref|XP_002717380.1|  PREDICTED: fumarate hydratase, mitochondrial       306   3e-97    Oryctolagus cuniculus [domestic rabbit]
ref|XP_003199715.2|  PREDICTED: fumarate hydratase, mitochondrial...    300   3e-97    Danio rerio [leopard danio]
ref|NP_058701.2|  fumarate hydratase, mitochondrial precursor           306   3e-97    Rattus norvegicus [brown rat]
gb|KFM08161.1|  hypothetical protein AS27_00695                         305   4e-97    Aptenodytes forsteri
ref|XP_010157072.1|  PREDICTED: fumarate hydratase, mitochondrial       305   4e-97    Eurypyga helias
ref|XP_010581870.1|  PREDICTED: fumarate hydratase, mitochondrial...    304   4e-97    Haliaeetus leucocephalus
ref|XP_005041810.1|  PREDICTED: fumarate hydratase, mitochondrial...    305   4e-97    
emb|CDQ03094.1|  Protein BM-FUM-1                                       305   4e-97    
ref|NP_034339.2|  fumarate hydratase, mitochondrial precursor           306   4e-97    Mus musculus [mouse]
ref|XP_011378308.1|  PREDICTED: fumarate hydratase, mitochondrial...    303   4e-97    Pteropus vampyrus
ref|XP_009074698.1|  PREDICTED: fumarate hydratase, mitochondrial       305   5e-97    Acanthisitta chloris
gb|KFP18053.1|  hypothetical protein Z169_14841                         305   5e-97    Egretta garzetta
ref|XP_006050829.1|  PREDICTED: fumarate hydratase, mitochondrial       306   5e-97    Bubalus bubalis [domestic water buffalo]
ref|NP_001155363.1|  fumarate hydratase, mitochondrial                  306   5e-97    Ovis aries [domestic sheep]
ref|NP_001069271.1|  fumarate hydratase, mitochondrial                  306   5e-97    Bos taurus [bovine]
ref|XP_005326633.1|  PREDICTED: fumarate hydratase, mitochondrial       306   5e-97    Ictidomys tridecemlineatus
ref|XP_009957277.1|  PREDICTED: fumarate hydratase, mitochondrial       305   5e-97    Leptosomus discolor
ref|XP_010309788.1|  PREDICTED: fumarate hydratase, mitochondrial       305   5e-97    Balearica regulorum gibbericeps
gb|KFW71651.1|  hypothetical protein AS28_14072                         305   5e-97    Pygoscelis adeliae
ref|XP_010581869.1|  PREDICTED: fumarate hydratase, mitochondrial...    305   5e-97    Haliaeetus leucocephalus
gb|KFP81796.1|  hypothetical protein N310_10621                         305   5e-97    Acanthisitta chloris
ref|XP_006142425.1|  PREDICTED: fumarate hydratase, mitochondrial...    306   5e-97    Tupaia chinensis
ref|XP_010133173.1|  PREDICTED: fumarate hydratase, mitochondrial       305   5e-97    Buceros rhinoceros silvestris
gb|KGL93621.1|  hypothetical protein N301_03833                         304   5e-97    Charadrius vociferus
ref|XP_010295483.1|  PREDICTED: fumarate hydratase, mitochondrial       304   6e-97    Phaethon lepturus
ref|XP_010117491.1|  PREDICTED: fumarate hydratase, mitochondrial       304   6e-97    Chlamydotis macqueenii
gb|KFO88947.1|  hypothetical protein N320_10832                         304   6e-97    Buceros rhinoceros silvestris
ref|XP_003935387.1|  PREDICTED: fumarate hydratase, mitochondrial       306   6e-97    Saimiri boliviensis boliviensis
gb|KFV66685.1|  hypothetical protein N307_11320                         304   6e-97    Picoides pubescens
ref|XP_005419421.1|  PREDICTED: fumarate hydratase, mitochondrial...    306   6e-97    
gb|KFQ04696.1|  hypothetical protein N329_04765                         304   6e-97    Haliaeetus albicilla
ref|XP_001386687.1|  fumarase                                           304   6e-97    Scheffersomyces stipitis CBS 6054
ref|XP_005153635.1|  PREDICTED: fumarate hydratase, mitochondrial...    305   6e-97    Melopsittacus undulatus
gb|EFO24875.2|  fumarate hydratase                                      305   7e-97    Loa loa
ref|XP_006757714.1|  PREDICTED: fumarate hydratase, mitochondrial       303   7e-97    Myotis davidii
gb|KFP26128.1|  hypothetical protein N325_10917                         304   7e-97    Colius striatus
gb|KGL79172.1|  hypothetical protein N309_10896                         304   7e-97    Tinamus guttatus
ref|XP_008937257.1|  PREDICTED: fumarate hydratase, mitochondrial       304   7e-97    Merops nubicus
ref|XP_005806444.1|  PREDICTED: fumarate hydratase, mitochondrial...    304   7e-97    
gb|KFO98944.1|  hypothetical protein N300_02760                         304   7e-97    Calypte anna
ref|XP_009809639.1|  PREDICTED: fumarate hydratase, mitochondrial       304   8e-97    Gavia stellata
gb|KFV39301.1|  hypothetical protein N341_12919                         304   8e-97    Tyto alba [Schleiereule]
ref|XP_005510051.1|  PREDICTED: fumarate hydratase, mitochondrial...    304   8e-97    
ref|NP_001272104.1|  fumarate hydratase, mitochondrial                  305   8e-97    Macaca fascicularis [crab eating macaque]
gb|EMC82421.1|  Fumarate hydratase, mitochondrial                       304   8e-97    
ref|XP_008635756.1|  PREDICTED: fumarate hydratase, mitochondrial       305   8e-97    
ref|NP_001006382.1|  fumarate hydratase, mitochondrial                  305   8e-97    Gallus gallus [bantam]
ref|XP_009278489.1|  PREDICTED: fumarate hydratase, mitochondrial       305   9e-97    Aptenodytes forsteri
ref|XP_004711822.1|  PREDICTED: fumarate hydratase, mitochondrial...    305   9e-97    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_001900957.1|  fumarase                                           305   9e-97    Brugia malayi [agent of lymphatic filariasis]
ref|XP_006185613.1|  PREDICTED: fumarate hydratase, mitochondrial       305   9e-97    Camelus ferus
ref|XP_008489569.1|  PREDICTED: fumarate hydratase, mitochondrial       304   9e-97    Calypte anna
ref|XP_006198857.1|  PREDICTED: fumarate hydratase, mitochondrial       305   9e-97    Vicugna pacos
ref|XP_001094968.1|  PREDICTED: fumarate hydratase, mitochondrial...    305   9e-97    
ref|XP_010202049.1|  PREDICTED: fumarate hydratase, mitochondrial       304   9e-97    Colius striatus
sp|P10173.1|FUMH_PIG  RecName: Full=Fumarate hydratase, mitochond...    304   1e-96    
gb|EFB22120.1|  hypothetical protein PANDA_006972                       304   1e-96    Ailuropoda melanoleuca
ref|XP_008405153.1|  PREDICTED: fumarate hydratase, mitochondrial       305   1e-96    Poecilia reticulata
ref|XP_009962196.1|  PREDICTED: fumarate hydratase, mitochondrial       304   1e-96    Tyto alba [Schleiereule]
ref|XP_009328750.1|  PREDICTED: fumarate hydratase, mitochondrial       305   1e-96    Pygoscelis adeliae
ref|XP_008929917.1|  PREDICTED: fumarate hydratase, mitochondrial       305   1e-96    
ref|XP_537215.1|  PREDICTED: fumarate hydratase, mitochondrial is...    305   1e-96    Canis lupus familiaris [dogs]
ref|XP_002718365.1|  PREDICTED: fumarate hydratase, mitochondrial...    305   1e-96    Oryctolagus cuniculus [domestic rabbit]
ref|XP_005884158.1|  PREDICTED: fumarate hydratase, mitochondrial       304   1e-96    
ref|XP_010215690.1|  PREDICTED: fumarate hydratase, mitochondrial       304   1e-96    Tinamus guttatus
ref|XP_009897885.1|  PREDICTED: fumarate hydratase, mitochondrial       304   1e-96    Picoides pubescens
ref|XP_004619073.1|  PREDICTED: fumarate hydratase, mitochondrial       305   1e-96    Sorex araneus [Eurasian shrew]
sp|P14408.1|FUMH_RAT  RecName: Full=Fumarate hydratase, mitochond...    305   1e-96    
prf||1709138A  fumarase                                                 305   1e-96 
ref|XP_010990377.1|  PREDICTED: fumarate hydratase, mitochondrial...    304   1e-96    Camelus dromedarius [camel]
ref|XP_009883751.1|  PREDICTED: fumarate hydratase, mitochondrial       304   1e-96    Charadrius vociferus
ref|XP_010971718.1|  PREDICTED: fumarate hydratase, mitochondrial...    304   1e-96    Camelus bactrianus [camel]
ref|XP_009087608.1|  PREDICTED: fumarate hydratase, mitochondrial       304   1e-96    
ref|XP_010990376.1|  PREDICTED: fumarate hydratase, mitochondrial...    304   2e-96    Camelus dromedarius [camel]
ref|XP_010971707.1|  PREDICTED: fumarate hydratase, mitochondrial...    304   2e-96    Camelus bactrianus [camel]
ref|XP_005482998.1|  PREDICTED: fumarate hydratase, mitochondrial...    305   2e-96    Zonotrichia albicollis
ref|XP_002131656.1|  PREDICTED: fumarate hydratase, mitochondrial...    304   2e-96    Ciona intestinalis [sea vase]
gb|KFU88789.1|  hypothetical protein M959_14247                         303   2e-96    Chaetura pelagica
gb|KFX86446.1|  hypothetical protein O988_09571                         294   2e-96    Pseudogymnoascus sp. VKM F-3808
ref|XP_005517420.1|  PREDICTED: fumarate hydratase, mitochondrial...    304   2e-96    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005374877.1|  PREDICTED: fumarate hydratase, mitochondrial       304   2e-96    Chinchilla lanigera
ref|XP_009639608.1|  PREDICTED: fumarate hydratase, mitochondrial       304   2e-96    Egretta garzetta
ref|XP_002189151.2|  PREDICTED: fumarate hydratase, mitochondrial...    304   2e-96    Taeniopygia guttata
ref|XP_008692868.1|  PREDICTED: fumarate hydratase, mitochondrial       303   2e-96    Ursus maritimus [white bear]
ref|XP_002610139.1|  hypothetical protein BRAFLDRAFT_264293             303   2e-96    Branchiostoma floridae
ref|XP_011378307.1|  PREDICTED: fumarate hydratase, mitochondrial...    304   2e-96    Pteropus vampyrus
ref|XP_007940907.1|  PREDICTED: fumarate hydratase, mitochondrial       304   2e-96    Orycteropus afer afer
gb|ETE65589.1|  Fumarate hydratase, mitochondrial                       305   2e-96    Ophiophagus hannah
ref|XP_006924183.1|  PREDICTED: fumarate hydratase, mitochondrial       304   3e-96    Pteropus alecto
ref|XP_003293396.1|  fumarate hydratase                                 303   3e-96    Dictyostelium purpureum
ref|XP_009994835.1|  PREDICTED: fumarate hydratase, mitochondrial       303   3e-96    Chaetura pelagica
ref|XP_002918506.1|  PREDICTED: fumarate hydratase, mitochondrial       304   3e-96    Ailuropoda melanoleuca
ref|XP_004690836.1|  PREDICTED: fumarate hydratase, mitochondrial       303   3e-96    
ref|XP_009918043.1|  PREDICTED: fumarate hydratase, mitochondrial       304   3e-96    Haliaeetus albicilla
ref|XP_006102845.1|  PREDICTED: fumarate hydratase, mitochondrial       304   3e-96    Myotis lucifugus
ref|XP_003204919.2|  PREDICTED: fumarate hydratase, mitochondrial       304   4e-96    
ref|XP_004375908.1|  PREDICTED: fumarate hydratase, mitochondrial       303   4e-96    Trichechus manatus latirostris
ref|XP_004439637.1|  PREDICTED: fumarate hydratase, mitochondrial       303   4e-96    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004914678.1|  PREDICTED: fumarate hydratase, mitochondrial...    302   4e-96    
ref|XP_004578565.1|  PREDICTED: fumarate hydratase, mitochondrial       303   4e-96    Ochotona princeps [southern American pika]
ref|XP_007579139.1|  PREDICTED: fumarate hydratase, mitochondrial       303   4e-96    Poecilia formosa
ref|XP_001377948.1|  PREDICTED: fumarate hydratase, mitochondrial       303   4e-96    Monodelphis domestica
ref|XP_005242931.1|  PREDICTED: fumarate hydratase, mitochondrial...    303   5e-96    
ref|XP_004450319.1|  PREDICTED: fumarate hydratase, mitochondrial...    303   5e-96    
emb|CDJ92654.1|  Fumarate lyase and Fumarase C domain containing ...    303   5e-96    
ref|NP_001230517.1|  fumarate hydratase                                 303   6e-96    
gb|EYB92701.1|  hypothetical protein Y032_0191g1325                     293   7e-96    
ref|XP_008333578.1|  PREDICTED: fumarate hydratase, mitochondrial       303   7e-96    
ref|XP_008062082.1|  PREDICTED: fumarate hydratase, mitochondrial       305   7e-96    
ref|XP_003410962.1|  PREDICTED: fumarate hydratase, mitochondrial       303   8e-96    
ref|XP_003439886.2|  PREDICTED: fumarate hydratase, mitochondrial...    302   8e-96    
ref|XP_007532622.1|  PREDICTED: fumarate hydratase, mitochondrial       303   8e-96    
ref|XP_007182482.1|  PREDICTED: fumarate hydratase, mitochondrial       303   1e-95    
ref|XP_001492705.2|  PREDICTED: fumarate hydratase, mitochondrial       303   1e-95    
ref|XP_006868625.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    302   1e-95    
ref|XP_002935862.2|  PREDICTED: fumarate hydratase, mitochondrial...    302   1e-95    
gb|EHH15914.1|  hypothetical protein EGK_02083                          302   1e-95    
ref|XP_009464197.1|  PREDICTED: fumarate hydratase, mitochondrial       303   1e-95    
ref|XP_011289145.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    302   1e-95    
ref|XP_001222605.1|  conserved hypothetical protein                     296   1e-95    
ref|XP_004555021.1|  PREDICTED: fumarate hydratase, mitochondrial...    302   1e-95    
ref|XP_004414328.1|  PREDICTED: fumarate hydratase, mitochondrial       302   1e-95    
ref|XP_003139199.1|  fumarase 1                                         302   1e-95    
gb|AAA52483.1|  fumarase precursor (EC 4.2.1.2)                         301   2e-95    
ref|XP_008295685.1|  PREDICTED: fumarate hydratase, mitochondrial       301   2e-95    
ref|XP_004799295.1|  PREDICTED: fumarate hydratase, mitochondrial       302   2e-95    
ref|XP_010354171.1|  PREDICTED: fumarate hydratase, mitochondrial...    302   2e-95    
ref|XP_007077049.1|  PREDICTED: fumarate hydratase, mitochondrial       301   2e-95    
ref|XP_007670627.1|  PREDICTED: fumarate hydratase, mitochondrial...    299   2e-95    
ref|XP_007796907.1|  putative fumarate hydratase protein                300   2e-95    
ref|XP_006019062.1|  PREDICTED: fumarate hydratase, mitochondrial...    305   3e-95    
emb|CCI44251.1|  unnamed protein product                                300   3e-95    
gb|KFM73631.1|  Fumarate hydratase, mitochondrial                       301   3e-95    
ref|XP_006746745.1|  PREDICTED: fumarate hydratase, mitochondrial       301   3e-95    
emb|CCA23244.1|  unnamed protein product                                300   4e-95    
ref|XP_008156858.1|  PREDICTED: fumarate hydratase, mitochondrial       301   4e-95    
ref|XP_002161201.1|  PREDICTED: fumarate hydratase, mitochondrial...    300   5e-95    
gb|KFR02179.1|  hypothetical protein N306_08359                         299   6e-95    
ref|XP_007670626.1|  PREDICTED: fumarate hydratase, mitochondrial...    299   6e-95    
ref|XP_002839681.1|  hypothetical protein                               297   6e-95    
ref|XP_004068402.1|  PREDICTED: fumarate hydratase, mitochondrial       300   7e-95    
ref|XP_007462683.1|  PREDICTED: fumarate hydratase, mitochondrial       300   8e-95    
ref|NP_957257.1|  fumarate hydratase, mitochondrial precursor           300   1e-94    
ref|XP_006800490.1|  PREDICTED: fumarate hydratase, mitochondrial...    300   1e-94    
ref|XP_967085.1|  PREDICTED: fumarate hydratase, mitochondrial          299   1e-94    
ref|XP_001525196.1|  fumarate hydratase, mitochondrial precursor        298   1e-94    
ref|XP_011213885.1|  PREDICTED: fumarate hydratase, mitochondrial...    298   2e-94    
ref|XP_004525061.1|  PREDICTED: fumarate hydratase, mitochondrial...    298   2e-94    
gb|KIN01511.1|  hypothetical protein OIDMADRAFT_123939                  298   2e-94    
ref|XP_007916152.1|  putative fumarate hydratase protein                298   2e-94    
ref|XP_007373803.1|  hypothetical protein SPAPADRAFT_59650              298   2e-94    
ref|XP_011187289.1|  PREDICTED: fumarate hydratase, mitochondrial...    298   2e-94    
ref|XP_011213884.1|  PREDICTED: fumarate hydratase, mitochondrial...    299   2e-94    
ref|XP_009942498.1|  PREDICTED: fumarate hydratase, mitochondrial       299   2e-94    
gb|KHJ86634.1|  fumarate hydratase, class II                            296   2e-94    
ref|XP_003706837.1|  PREDICTED: probable fumarate hydratase, mito...    299   3e-94    
ref|XP_003974177.1|  PREDICTED: fumarate hydratase, mitochondrial...    298   3e-94    
ref|XP_003767837.1|  PREDICTED: fumarate hydratase, mitochondrial       300   3e-94    
ref|XP_011187288.1|  PREDICTED: fumarate hydratase, mitochondrial...    298   3e-94    
emb|CCX05451.1|  Similar to Fumarate hydratase, mitochondrial; ac...    299   3e-94    
gb|EPQ18839.1|  Fumarate hydratase, mitochondrial                       301   4e-94    
ref|XP_001658988.1|  AAEL008167-PA                                      296   5e-94    
emb|CEI85997.1|  Putative Fumarate hydratase class II                   295   5e-94    
dbj|BAP73733.1|  fumarate hydratase                                     297   5e-94    
dbj|BAO42339.1|  fumarate hydratase                                     297   5e-94    
ref|XP_006691770.1|  fumarate hydratase-like protein                    299   6e-94    
ref|XP_008610424.1|  fumarate hydratase, mitochondrial                  297   6e-94    
ref|XP_004525060.1|  PREDICTED: fumarate hydratase, mitochondrial...    298   6e-94    
dbj|BAM20634.1|  aspartate ammonia lyase                                293   6e-94    
gb|EQL30770.1|  fumarate hydratase, mitochondrial                       300   6e-94    
emb|CDO93438.1|  unnamed protein product                                297   6e-94    
ref|XP_002625783.1|  fumarate hydratase class II                        300   6e-94    
gb|EEQ86930.1|  fumarate hydratase class II                             299   7e-94    
ref|XP_453112.1|  hypothetical protein                                  297   8e-94    
ref|XP_007119566.1|  PREDICTED: fumarate hydratase, mitochondrial       298   8e-94    
ref|NP_001279653.1|  fumarate hydratase                                 295   8e-94    
emb|CEI93489.1|  Putative Fumarate hydratase                            294   9e-94    
ref|XP_003660142.1|  hypothetical protein MYCTH_2298064                 298   1e-93    
gb|KFY24949.1|  hypothetical protein V493_04923                         298   1e-93    
ref|XP_001658987.1|  AAEL008167-PB                                      297   1e-93    
gb|EJW81137.1|  fumarate hydratase                                      297   1e-93    
emb|CCE42940.1|  hypothetical protein CPAR2_205830                      296   1e-93    
emb|CEG73219.1|  Putative AaceriACR013Cp                                296   1e-93    
emb|CDW52898.1|  fumarate hydratase, mitochondrial                      295   2e-93    
gb|ESA01861.1|  hypothetical protein GLOINDRAFT_337726                  295   2e-93    
gb|KFY61763.1|  hypothetical protein V497_02745                         298   2e-93    
ref|XP_010735106.1|  PREDICTED: fumarate hydratase, mitochondrial       296   2e-93    
ref|XP_010894175.1|  PREDICTED: fumarate hydratase, mitochondrial       296   2e-93    
gb|KFY44404.1|  hypothetical protein V494_01487                         297   3e-93    
ref|XP_009535020.1|  hypothetical protein PHYSODRAFT_564447             295   3e-93    
ref|XP_003869568.1|  Fum11 fumarate hydratase                           296   3e-93    
gb|KFY69882.1|  hypothetical protein V499_09667                         297   3e-93    
ref|XP_005191048.1|  PREDICTED: fumarate hydratase, mitochondrial...    295   4e-93    
ref|XP_011295671.1|  PREDICTED: fumarate hydratase, mitochondrial...    295   4e-93    
gb|KIH91518.1|  fumarate hydratase, class II                            295   4e-93    
ref|XP_007892105.1|  PREDICTED: fumarate hydratase, mitochondrial       296   4e-93    
gb|KHN89095.1|  putative fumarate hydratase, mitochondrial              295   4e-93    
gb|AFM90352.1|  fumarate hydratase, mitochondrial precursor             295   5e-93    
gb|KFY86374.1|  hypothetical protein V500_07671                         296   5e-93    
gb|EFQ26635.1|  fumarate hydratase                                      296   5e-93    
gb|AFK11303.1|  fumarate hydratase, mitochondrial precursor             295   5e-93    
ref|XP_010774773.1|  PREDICTED: fumarate hydratase, mitochondrial       295   5e-93    
gb|KFZ17818.1|  hypothetical protein V502_04387                         296   5e-93    
ref|XP_009869372.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    294   6e-93    
ref|XP_005996889.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    300   6e-93    
gb|EPE08450.1|  fumarate hydratase                                      296   6e-93    
ref|XP_001593815.1|  conserved hypothetical protein                     294   7e-93    
gb|KFA62293.1|  hypothetical protein S40285_06550                       295   9e-93    
gb|KEY68811.1|  hypothetical protein S7711_00679                        295   9e-93    
ref|XP_008215404.1|  PREDICTED: LOW QUALITY PROTEIN: fumarate hyd...    294   1e-92    
ref|XP_003651420.1|  hypothetical protein THITE_2111697                 295   1e-92    
ref|XP_001730777.1|  hypothetical protein MGL_1776                      295   1e-92    
emb|CDX80112.1|  BnaA05g00440D                                          294   1e-92    
gb|EQB57830.1|  fumarate hydratase                                      293   1e-92    
gb|ELR03472.1|  fumarate hydratase, class II                            295   1e-92    
gb|KFY08291.1|  hypothetical protein V492_06360                         295   1e-92    
gb|KDN71424.1|  putative fumarate hydratase                             293   1e-92    
ref|XP_007274400.1|  fumarate hydratase                                 293   1e-92    
ref|XP_002998691.1|  fumarate hydratase, mitochondrial precursor        293   1e-92    
ref|XP_681976.1|  hypothetical protein AN8707.2                         295   2e-92    
ref|XP_009855147.1|  fumarate hydratase mitochondrial precursor         295   2e-92    
gb|ETP40548.1|  fumarate hydratase, mitochondrial                       293   2e-92    
ref|XP_959454.1|  fumarate hydratase                                    295   2e-92    
gb|AEE62611.1|  unknown                                                 294   2e-92    
gb|ERT00077.1|  fumarate hydratase, mitochondrial                       293   2e-92    
ref|XP_001241976.1|  hypothetical protein CIMG_05872                    293   2e-92    
gb|KIY98553.1|  fumarate hydratase, class II                            290   3e-92    
gb|EEH06285.1|  fumarate hydratase                                      295   3e-92    
gb|EYE96944.1|  fumarate hydratase                                      293   3e-92    
gb|KFY64660.1|  hypothetical protein V496_03115                         295   3e-92    
gb|EAQ71131.1|  hypothetical protein MGCH7_ch7g538                      291   3e-92    
ref|XP_002422013.1|  fumarase, putative; fumarate hydratase, mito...    292   3e-92    
ref|NP_727108.1|  lethal (1) G0255, isoform B                           292   3e-92    
ref|XP_011499133.1|  PREDICTED: fumarate hydratase, mitochondrial...    292   4e-92    
ref|XP_460970.2|  DEHA2F13948p                                          292   4e-92    
ref|XP_002099923.1|  GE16764                                            293   5e-92    
ref|NP_572339.1|  lethal (1) G0255, isoform A                           293   5e-92    
gb|EMR90539.1|  putative fumarate hydratase protein                     294   5e-92    
ref|XP_001964189.1|  GF21422                                            293   5e-92    
ref|XP_008908527.1|  fumarate hydratase, mitochondrial                  293   5e-92    
ref|XP_001978469.1|  GG19604                                            292   5e-92    
ref|WP_038451252.1|  fumarate hydratase                                 291   6e-92    
ref|WP_038459664.1|  fumarate hydratase                                 291   6e-92    
ref|XP_001548578.1|  fumarate hydratase                                 294   6e-92    
ref|WP_041583496.1|  fumarate hydratase                                 291   6e-92    
emb|CAE79212.1|  fumarate hydratase                                     291   6e-92    
ref|XP_002057251.1|  GJ16987                                            292   6e-92    
ref|XP_007861040.1|  fumarate hydratase                                 292   6e-92    
gb|KHN98805.1|  fumarate hydratase                                      293   6e-92    
gb|EHK97670.1|  putative Fumarate hydratase, mitochondrial              291   6e-92    
ref|XP_001951601.1|  PREDICTED: fumarate hydratase, mitochondrial...    293   7e-92    
ref|XP_007295218.1|  fumarate hydratase                                 293   8e-92    
gb|EWG38672.1|  fumarate hydratase, mitochondrial                       293   8e-92    
ref|XP_009651690.1|  fumarate hydratase                                 292   8e-92    
ref|XP_011111479.1|  hypothetical protein H072_5623                     291   8e-92    
gb|ETI42691.1|  fumarate hydratase, mitochondrial                       293   8e-92    
gb|EAS30393.3|  fumarate hydratase, class II                            293   8e-92    
emb|CEF64732.1|  Fumarate hydratase, mitochondrial                      291   9e-92    
ref|XP_003325994.1|  fumarate hydratase, mitochondrial                  292   9e-92    
gb|EXK34074.1|  fumarate hydratase, mitochondrial                       293   9e-92    
gb|ETN79756.1|  fumarate hydratase, class II                            292   9e-92    
gb|ETK82718.1|  fumarate hydratase, mitochondrial                       293   9e-92    
ref|XP_321179.4|  AGAP001884-PA                                         292   1e-91    
gb|EER36542.1|  fumarate hydratase class II                             294   1e-91    
gb|EGU80484.1|  hypothetical protein FOXB_08944                         293   1e-91    
gb|EAL58737.1|  fumarate hydratase, class II                            287   1e-91    
emb|CCT70191.1|  probable FUM1-fumarate hydratase                       293   1e-91    
ref|XP_002133384.1|  GA22866                                            291   1e-91    
gb|ELQ41093.1|  fumarate hydratase class II 1                           291   1e-91    
gb|EEH23130.2|  fumarate hydratase, mitochondrial                       293   1e-91    
ref|XP_003069297.1|  Fumarate hydratase, mitochondrial precursor ...    293   1e-91    
ref|XP_008087033.1|  L-aspartase-like protein                           293   1e-91    
emb|CDY57717.1|  BnaC04g51900D                                          291   1e-91    
gb|EXV03852.1|  fumarase                                                291   1e-91    
ref|XP_002117225.1|  hypothetical protein TRIADDRAFT_61292              291   1e-91    
ref|XP_003378803.1|  fumarate hydratase, class II                       291   2e-91    
emb|CCE27068.1|  probable FUM1-fumarate hydratase                       292   2e-91    
ref|XP_002850457.1|  fumarate hydratase                                 292   2e-91    
gb|AAL90297.1|  LD46083p                                                291   2e-91    
ref|XP_008544746.1|  PREDICTED: fumarate hydratase, mitochondrial...    290   2e-91    
ref|NP_871673.1|  Protein FUM-1, isoform b                              286   2e-91    
gb|KDQ63611.1|  hypothetical protein JAAARDRAFT_44408                   290   2e-91    
ref|XP_011499132.1|  PREDICTED: fumarate hydratase, mitochondrial...    291   2e-91    
ref|XP_007840757.1|  fumarate hydratase                                 292   2e-91    
gb|ERG84110.1|  putative fumarate                                       290   2e-91    
gb|KDR21372.1|  Fumarate hydratase, mitochondrial                       291   2e-91    
gb|EMS18643.1|  fumarate hydratase, class II                            291   2e-91    
ref|XP_005650930.1|  fumarate hydratase                                 290   2e-91    
ref|XP_008595655.1|  fumarate hydratase                                 292   3e-91    
ref|WP_015588589.1|  Fumarate hydratase, class II                       290   3e-91    
gb|KGQ09969.1|  Fumarate hydratase                                      291   3e-91    
ref|WP_017532669.1|  fumarate hydratase                                 290   3e-91    
ref|XP_007820058.1|  fumarate hydratase                                 291   3e-91    
gb|KID72552.1|  fumarate hydratase                                      291   3e-91    
ref|XP_001395836.2|  fumarate hydratase                                 292   3e-91    
emb|CCU98193.1|  unnamed protein product                                290   3e-91    
gb|KFG85558.1|  fumarate hydratase                                      291   3e-91    
ref|XP_786111.3|  PREDICTED: fumarate hydratase class II-like           294   4e-91    
ref|WP_015090456.1|  fumarate hydratase                                 290   4e-91    
gb|AAP51177.1|  fumarase                                                289   4e-91    
ref|XP_001992377.1|  GH24716                                            290   4e-91    
emb|CAK41235.1|  unnamed protein product                                291   4e-91    
gb|ENH86884.1|  fumarate hydratase                                      291   4e-91    
gb|KID89475.1|  fumarate hydratase                                      291   4e-91    
ref|XP_010763447.1|  fumarate hydratase, mitochondrial                  292   4e-91    
ref|XP_007360110.1|  fumarate hydratase                                 290   5e-91    
ref|WP_006012723.1|  fumarate hydratase                                 289   5e-91    
gb|KIE00198.1|  fumarate hydratase                                      291   5e-91    
ref|XP_007595676.1|  fumarate hydratase                                 291   5e-91    
ref|XP_009259090.1|  hypothetical protein FPSE_07697                    291   5e-91    
ref|XP_004199172.1|  Piso0_002585                                       290   5e-91    
gb|EPZ35407.1|  Fumarate hydratase, mitochondrial                       289   6e-91    
ref|XP_002798049.1|  fumarate hydratase                                 285   6e-91    
ref|XP_008544745.1|  PREDICTED: fumarate hydratase, mitochondrial...    290   6e-91    
gb|EHK50052.1|  fumarate hydratase                                      289   6e-91    
gb|KIL89638.1|  hypothetical protein FAVG1_07218                        291   6e-91    
ref|XP_003720956.1|  fumarate hydratase                                 291   7e-91    
ref|XP_003347025.1|  hypothetical protein SMAC_05224                    291   7e-91    
gb|EGE07834.1|  fumarate hydratase                                      290   8e-91    
gb|ETN58394.1|  aspartate ammonia lyase                                 290   8e-91    
gb|ESX01327.1|  Fumarate hydratase, mitochondrial                       289   8e-91    
ref|XP_011320020.1|  fumarate hydratase                                 290   8e-91    
ref|XP_002029465.1|  GL15602                                            281   8e-91    
ref|XP_002989327.1|  hypothetical protein SELMODRAFT_129619             292   9e-91    



>ref|XP_002302734.1| Fumarate hydratase 1 family protein [Populus trichocarpa]
 gb|EEE82007.1| Fumarate hydratase 1 family protein [Populus trichocarpa]
Length=490

 Score =   363 bits (933),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  296  AHDAFVETSGALNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  355

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGDASASFEKNCVR
Sbjct  356  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPMIASGLLHSIRLLGDASASFEKNCVR  415

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAK AHKEG++LKEAA  L +LT+EE
Sbjct  416  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKLAHKEGSTLKEAALKLGMLTSEE  475

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGPTD
Sbjct  476  FDTLVVPEKMIGPTD  490



>ref|XP_007200983.1| hypothetical protein PRUPE_ppa004758mg [Prunus persica]
 gb|EMJ02182.1| hypothetical protein PRUPE_ppa004758mg [Prunus persica]
Length=493

 Score =   363 bits (933),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDAFVETSGALNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV GNHV +TVGGSNGHFELNVFKPMIA+ LLHSVRLLGDASASFEKNCVR
Sbjct  359  CEALTMVCAQVFGNHVAITVGGSNGHFELNVFKPMIASGLLHSVRLLGDASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAA+VAKKAHKEG++LKEAA  L VLT+EE
Sbjct  419  GIKANRERISKLLHESLMLVTSLNPKIGYDNAASVAKKAHKEGSTLKEAALKLGVLTSEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  479  FDTLVVPEKMIGPSD  493



>gb|KDP28204.1| hypothetical protein JCGZ_13975 [Jatropha curcas]
Length=495

 Score =   363 bits (933),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG LNTIA SLMK+ANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDAFVESSGALNTIATSLMKVANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIA++LLHSVRLLGDASASFEKNCVR
Sbjct  361  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPMIASNLLHSVRLLGDASASFEKNCVR  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAK AHKEG++LKEAA  L VLT+EE
Sbjct  421  GIQANRERISKLLHESLMLVTALNPKIGYDNAAAVAKLAHKEGSTLKEAALKLGVLTSEE  480

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVP KMIGP+D
Sbjct  481  FDSLVVPHKMIGPSD  495



>ref|XP_011007799.1| PREDICTED: fumarate hydratase 1, mitochondrial [Populus euphratica]
Length=490

 Score =   360 bits (925),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  296  AHDAFVETSGALNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  355

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGDASASFEKNCVR
Sbjct  356  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPMIASGLLHSIRLLGDASASFEKNCVR  415

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAK AHKEG++LKEAA  L +LT+EE
Sbjct  416  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKLAHKEGSTLKEAALKLGMLTSEE  475

Query  279  FDQLVVPEKMIGPT  238
            FD LVVPEKMIGPT
Sbjct  476  FDTLVVPEKMIGPT  489



>ref|XP_010103413.1| Fumarate hydratase 1 [Morus notabilis]
 gb|EXB95732.1| Fumarate hydratase 1 [Morus notabilis]
Length=494

 Score =   360 bits (925),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDAFVEASGALNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IAN LLHSVRLLGDASASFEKNCVR
Sbjct  360  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPLIANGLLHSVRLLGDASASFEKNCVR  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERI+KLLHESLMLVT LNPKIGYDNAAAVAK AHKEG +LKEAA  L VL++EE
Sbjct  420  GIQANRERIAKLLHESLMLVTSLNPKIGYDNAAAVAKTAHKEGCTLKEAALKLGVLSSEE  479

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  480  FDTLVVPEKMIGPSD  494



>ref|XP_008359427.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial-like 
[Malus domestica]
Length=499

 Score =   360 bits (924),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  305  AHDAFVETSGALNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  364

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GN+V +TVGGSNGHFELNVFKPMIA+ LLHSVRLLGDASASFEKNCVR
Sbjct  365  CEALTMVCAQVMGNNVAITVGGSNGHFELNVFKPMIASGLLHSVRLLGDASASFEKNCVR  424

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAK AHKEG++LKEAA  L +L++EE
Sbjct  425  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKTAHKEGSTLKEAALKLGMLSSEE  484

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGPTD
Sbjct  485  FDTLVVPEKMIGPTD  499



>ref|XP_007145184.1| hypothetical protein PHAVU_007G217600g [Phaseolus vulgaris]
 gb|ESW17178.1| hypothetical protein PHAVU_007G217600g [Phaseolus vulgaris]
Length=495

 Score =   359 bits (921),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTIAASLMKI NDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDAFVETSGALNTIAASLMKIGNDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGD+SASFEKNCVR
Sbjct  361  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPMIASCLLHSLRLLGDSSASFEKNCVR  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYD AAAVAK AHKEGT+LKEAA  L VL++EE
Sbjct  421  GIQANRERISKLLHESLMLVTSLNPKIGYDKAAAVAKTAHKEGTTLKEAALKLGVLSSEE  480

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKM+GP+D
Sbjct  481  FDKLVVPEKMLGPSD  495



>ref|XP_008386708.1| PREDICTED: fumarate hydratase 1, mitochondrial [Malus domestica]
Length=571

 Score =   362 bits (928),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  377  AHDAFVETSGALNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  436

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GN+V +TVGGSNGHFELNVFKPMIA+ LLHSVRLLGDASASFEKNCVR
Sbjct  437  CEALTMVCAQVMGNNVAITVGGSNGHFELNVFKPMIASGLLHSVRLLGDASASFEKNCVR  496

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAK AHKEG++LKEAA  L +L++EE
Sbjct  497  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKTAHKEGSTLKEAALKLGMLSSEE  556

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGPTD
Sbjct  557  FDTLVVPEKMIGPTD  571



>ref|XP_011079617.1| PREDICTED: fumarate hydratase 1, mitochondrial [Sesamum indicum]
Length=491

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMK+ANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  297  AHDAFVETSGALNTVAASLMKVANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  356

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LL S+RLLGDASASFEKNCVR
Sbjct  357  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPVIASNLLQSLRLLGDASASFEKNCVR  416

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAA VAK AHKEG++LKEAA  L VL +EE
Sbjct  417  GIQANRERISKLLHESLMLVTSLNPKIGYDNAALVAKTAHKEGSTLKEAALKLGVLNSEE  476

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  477  FDSLVVPEKMIGPSD  491



>ref|XP_009346608.1| PREDICTED: fumarate hydratase 1, mitochondrial [Pyrus x bretschneideri]
Length=493

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFV++SG LNT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDAFVQTSGALNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GN+V +TVGGSNGHFELNVFKPMIA+ LLHSVRLLGDASASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNNVAITVGGSNGHFELNVFKPMIASGLLHSVRLLGDASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN+ERISKLLHESLMLVT LNPKIGYDNAAAVAK AHKEG++LKEAA  L +L++EE
Sbjct  419  GIQANKERISKLLHESLMLVTSLNPKIGYDNAAAVAKTAHKEGSTLKEAALKLGMLSSEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGPTD
Sbjct  479  FDTLVVPEKMIGPTD  493



>ref|XP_003518952.1| PREDICTED: fumarate hydratase 1, mitochondrial [Glycine max]
 gb|KHN08664.1| Fumarate hydratase 1, mitochondrial [Glycine soja]
Length=495

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTIAASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDAFVETSGALNTIAASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQVIGNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGD+SASFEKNCVR
Sbjct  361  CEALTMVCAQVIGNHVAVTVGGSNGHFELNVFKPMIASCLLHSLRLLGDSSASFEKNCVR  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYD AAAVAK AHKEG +LKEAA  L VL++E+
Sbjct  421  GIQANRERISKLLHESLMLVTSLNPKIGYDKAAAVAKTAHKEGCTLKEAALKLGVLSSED  480

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKM+GP+D
Sbjct  481  FDKLVVPEKMLGPSD  495



>gb|KHN08665.1| Fumarate hydratase 2, chloroplastic [Glycine soja]
Length=466

 Score =   356 bits (914),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+ ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  272  AHDAFVETSGALNTVVASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  331

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIAN LLHS+RLLGD+SASFEKNC+R
Sbjct  332  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPMIANCLLHSLRLLGDSSASFEKNCLR  391

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYD AA VAK AHKEGT+LKEAA  L VL++E+
Sbjct  392  GIQANRERISKLLHESLMLVTSLNPKIGYDKAATVAKTAHKEGTTLKEAALKLGVLSSED  451

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKM+GP+D
Sbjct  452  FDKLVVPEKMLGPSD  466



>ref|XP_009622151.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=403

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG +NT+AASLMK+ NDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  209  AHDAFVETSGAVNTVAASLMKVGNDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  268

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKPMIAN+LLHSVRLLGDASASFEKNCVR
Sbjct  269  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPMIANALLHSVRLLGDASASFEKNCVR  328

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERI+KLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLK+AA NL VL +EE
Sbjct  329  GIQANRERIAKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKDAALNLGVLKSEE  388

Query  279  FDQLVVPEKMIGPTD  235
            FDQLVVPEKMIGPTD
Sbjct  389  FDQLVVPEKMIGPTD  403



>ref|XP_003536023.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Glycine 
max]
Length=495

 Score =   357 bits (916),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTIAASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDAFVETSGALNTIAASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQVIGNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGD+SASFEKNCVR
Sbjct  361  CEALTMVCAQVIGNHVAVTVGGSNGHFELNVFKPMIASCLLHSLRLLGDSSASFEKNCVR  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYD AAAVAK AHKEG +LKEAA  L VL++E+
Sbjct  421  GIQANRERISKLLHESLMLVTSLNPKIGYDKAAAVAKTAHKEGCTLKEAALKLGVLSSED  480

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKM+GP+D
Sbjct  481  FDKLVVPEKMLGPSD  495



>gb|KHN30668.1| Fumarate hydratase 1, mitochondrial [Glycine soja]
Length=495

 Score =   357 bits (916),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTIAASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDAFVETSGALNTIAASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQVIGNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGD+SASFEKNCVR
Sbjct  361  CEALTMVCAQVIGNHVAVTVGGSNGHFELNVFKPMIASCLLHSLRLLGDSSASFEKNCVR  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYD AAAVAK AHKEG +LKEAA  L VL++E+
Sbjct  421  GIQANRERISKLLHESLMLVTSLNPKIGYDKAAAVAKTAHKEGCTLKEAALKLGVLSSED  480

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKM+GP+D
Sbjct  481  FDKLVVPEKMLGPSD  495



>ref|XP_004495932.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Cicer arietinum]
Length=493

 Score =   357 bits (915),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTIAASLMK+ANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDAFVETSGALNTIAASLMKVANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVG SNGHFELNVFKP+IA+ LLHS+RLLGD+SASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAITVGASNGHFELNVFKPVIASCLLHSLRLLGDSSASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYD AAAVAK AHKEGT+LKEAA  L VL++EE
Sbjct  419  GIQANRERISKLLHESLMLVTSLNPKIGYDKAAAVAKTAHKEGTTLKEAALKLGVLSSEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  479  FDSLVVPEKMIGPSD  493



>ref|XP_010321878.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X2 [Solanum 
lycopersicum]
Length=416

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKI NDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  222  AHDAFVETSGALNTVAVSLMKIGNDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  281

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIAN+LLHSVRLLGDASASFEKNCVR
Sbjct  282  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPMIANALLHSVRLLGDASASFEKNCVR  341

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERI+KLLHESLMLVTCLNPKIGYD+AAAVAKKAHKEGTSLKEAA NL VLT +E
Sbjct  342  GIQANRERIAKLLHESLMLVTCLNPKIGYDSAAAVAKKAHKEGTSLKEAALNLNVLTGDE  401

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKMIGPTD
Sbjct  402  FDKLVVPEKMIGPTD  416



>ref|XP_003518957.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Glycine 
max]
Length=465

 Score =   354 bits (909),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+ ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  271  AHDAFVETSGALNTVVASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  330

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIAN LLHS+RLLGD+SASFEKNC+R
Sbjct  331  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPMIANCLLHSLRLLGDSSASFEKNCLR  390

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYD AA VAK AHKEGT+LKEAA  L VL +E+
Sbjct  391  GIQANRERISKLLHESLMLVTSLNPKIGYDKAATVAKTAHKEGTTLKEAALKLGVLCSED  450

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKM+GP+D
Sbjct  451  FDKLVVPEKMLGPSD  465



>ref|XP_009622148.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622149.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009622150.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
Length=493

 Score =   355 bits (910),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG +NT+AASLMK+ NDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDAFVETSGAVNTVAASLMKVGNDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKPMIAN+LLHSVRLLGDASASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPMIANALLHSVRLLGDASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERI+KLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLK+AA NL VL +EE
Sbjct  419  GIQANRERIAKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKDAALNLGVLKSEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FDQLVVPEKMIGPTD
Sbjct  479  FDQLVVPEKMIGPTD  493



>ref|XP_009778286.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009778287.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009778288.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009778289.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=493

 Score =   353 bits (907),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG +NT+AASLMK+ NDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDAFVETSGAINTVAASLMKVGNDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKPMIAN+LLHSVRL+GDASASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPMIANALLHSVRLIGDASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERI+KLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLK+AA NL VL +EE
Sbjct  419  GIQANRERIAKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKDAALNLGVLKSEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FDQLVVPEKMIGPTD
Sbjct  479  FDQLVVPEKMIGPTD  493



>ref|XP_004240578.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Solanum 
lycopersicum]
Length=488

 Score =   353 bits (907),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKI NDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  294  AHDAFVETSGALNTVAVSLMKIGNDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  353

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIAN+LLHSVRLLGDASASFEKNCVR
Sbjct  354  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPMIANALLHSVRLLGDASASFEKNCVR  413

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERI+KLLHESLMLVTCLNPKIGYD+AAAVAKKAHKEGTSLKEAA NL VLT +E
Sbjct  414  GIQANRERIAKLLHESLMLVTCLNPKIGYDSAAAVAKKAHKEGTSLKEAALNLNVLTGDE  473

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKMIGPTD
Sbjct  474  FDKLVVPEKMIGPTD  488



>ref|NP_001119412.1| fumarate hydratase 2 [Arabidopsis thaliana]
 gb|AED96016.1| fumarate hydratase 2 [Arabidopsis thaliana]
Length=423

 Score =   350 bits (897),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  229  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  288

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA++LLHS+RL+ DASASFEKNCVR
Sbjct  289  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIASALLHSIRLIADASASFEKNCVR  348

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAK+AHKEG +LK AA  L VLT+EE
Sbjct  349  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKRAHKEGCTLKHAAMKLGVLTSEE  408

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  409  FDTLVVPEKMIGPSD  423



>gb|EYU46762.1| hypothetical protein MIMGU_mgv1a005258mg [Erythranthe guttata]
Length=491

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAF E+SG LNTIA SLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  297  AHDAFAETSGALNTIAVSLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  356

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEAITMVCAQV+GN+V +TVG SNGHFELNVFKP+IA++LLHS+RLLGDASASFEKNCVR
Sbjct  357  CEAITMVCAQVMGNNVAITVGASNGHFELNVFKPVIASNLLHSLRLLGDASASFEKNCVR  416

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN+ERI+KLLHESLMLVT LNPKIGYDNAA VAK AHKEG++LK+AA  L VL++EE
Sbjct  417  GIQANKERIAKLLHESLMLVTSLNPKIGYDNAALVAKTAHKEGSTLKDAALKLGVLSSEE  476

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  477  FDTLVVPEKMIGPSD  491



>ref|XP_004247395.1| PREDICTED: fumarate hydratase 1, mitochondrial [Solanum lycopersicum]
Length=494

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAF E+SG LNT+AASLMKI NDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDAFAETSGALNTVAASLMKIGNDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVG SNGHFELNVFKPMIAN+LLHSVRLLGDASASFEKNCVR
Sbjct  360  CEALTMVCAQVMGNHVAVTVGASNGHFELNVFKPMIANALLHSVRLLGDASASFEKNCVR  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
             IQANR+RI+KLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAA NL VLT+EE
Sbjct  420  DIQANRDRIAKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAALNLAVLTSEE  479

Query  279  FDQLVVPEKMIGPTD  235
            FDQLVVPEKMIGPTD
Sbjct  480  FDQLVVPEKMIGPTD  494



>ref|XP_010442613.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X2 
[Camelina sativa]
Length=491

 Score =   351 bits (900),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  297  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  356

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IAN+LLHS+RLL DASASFEKNCVR
Sbjct  357  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIANALLHSIRLLADASASFEKNCVR  416

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERIS+LLHESLMLVT LNPKIGYDNAAAVAK+AH+EG +LK AA +L VLT+EE
Sbjct  417  GIEANRERISRLLHESLMLVTSLNPKIGYDNAAAVAKRAHREGCTLKVAAMDLGVLTSEE  476

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKM+GP+D
Sbjct  477  FDTLVVPEKMLGPSD  491



>ref|NP_001275422.1| fumarate hydratase 1, mitochondrial-like [Solanum tuberosum]
 emb|CAA62817.1| fumarase [Solanum tuberosum]
Length=493

 Score =   351 bits (901),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAF E+SG LNT+AASLMKI NDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDAFAETSGALNTLAASLMKIGNDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVG SNGHFELNVFKPMIAN+LLHSVRLLGDASASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAVTVGASNGHFELNVFKPMIANALLHSVRLLGDASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
             IQANR+RI+KLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAA NL VLT+EE
Sbjct  419  DIQANRDRIAKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAALNLGVLTSEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FDQLVVPEKMIGPTD
Sbjct  479  FDQLVVPEKMIGPTD  493



>ref|XP_010442599.1| PREDICTED: fumarate hydratase 2, chloroplastic [Camelina sativa]
Length=498

 Score =   351 bits (901),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  304  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  363

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA++LLHS+RL+ DASASFEKNCVR
Sbjct  364  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIASALLHSIRLVADASASFEKNCVR  423

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAA+VAKKAHKEG +LK AA NL VLT EE
Sbjct  424  GIEANRERISKLLHESLMLVTSLNPKIGYDNAASVAKKAHKEGCTLKVAAMNLGVLTPEE  483

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  484  FDSLVVPEKMIGPSD  498



>ref|NP_199908.1| fumarate hydratase 2 [Arabidopsis thaliana]
 sp|Q9FI53.1|FUM2_ARATH RecName: Full=Fumarate hydratase 2, chloroplastic; Short=Fumarase 
2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08741.1| fumarate hydratase [Arabidopsis thaliana]
 gb|AAK97668.1| AT5g50950/K3K7_11 [Arabidopsis thaliana]
 gb|AAM47378.1| AT5g50950/K3K7_11 [Arabidopsis thaliana]
 gb|AED96015.1| fumarate hydratase 2 [Arabidopsis thaliana]
Length=499

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  305  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  364

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA++LLHS+RL+ DASASFEKNCVR
Sbjct  365  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIASALLHSIRLIADASASFEKNCVR  424

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAK+AHKEG +LK AA  L VLT+EE
Sbjct  425  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKRAHKEGCTLKHAAMKLGVLTSEE  484

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  485  FDTLVVPEKMIGPSD  499



>ref|XP_010442609.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X1 
[Camelina sativa]
Length=499

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  305  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  364

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IAN+LLHS+RLL DASASFEKNCVR
Sbjct  365  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIANALLHSIRLLADASASFEKNCVR  424

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERIS+LLHESLMLVT LNPKIGYDNAAAVAK+AH+EG +LK AA +L VLT+EE
Sbjct  425  GIEANRERISRLLHESLMLVTSLNPKIGYDNAAAVAKRAHREGCTLKVAAMDLGVLTSEE  484

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKM+GP+D
Sbjct  485  FDTLVVPEKMLGPSD  499



>ref|XP_008345222.1| PREDICTED: fumarate hydratase 1, mitochondrial [Malus domestica]
Length=495

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNT+A SLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDAAVETSGALNTVATSLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCA+V+GN+V +TVGGSNGHFELNVFKPMIA+ LL S+RLLGDASASFEKNCVR
Sbjct  361  CEALTMVCARVMGNNVAITVGGSNGHFELNVFKPMIASGLLQSLRLLGDASASFEKNCVR  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISK LHESLMLVT LN KIGYDNAAAVAK AHKEG++LKEAA  L++L++EE
Sbjct  421  GIQANRERISKFLHESLMLVTSLNXKIGYDNAAAVAKTAHKEGSTLKEAALKLRMLSSEE  480

Query  279  FDQLVVPEKMIGPTD  235
            FD +VVPEKMIGPTD
Sbjct  481  FDTIVVPEKMIGPTD  495



>ref|XP_006359871.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X2 
[Solanum tuberosum]
Length=493

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAF E+SG LNT+AASLMKI NDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDAFAETSGALNTLAASLMKIGNDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVG SNGHFELNVFKPMIAN+LLHSVRLLGDASASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAVTVGASNGHFELNVFKPMIANALLHSVRLLGDASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
             IQANR+RI+KLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAA NL VLT+EE
Sbjct  419  DIQANRDRIAKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAALNLGVLTSEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FDQLVVPEKMIGPTD
Sbjct  479  FDQLVVPEKMIGPTD  493



>ref|XP_010482421.1| PREDICTED: fumarate hydratase 2, chloroplastic-like [Camelina 
sativa]
Length=499

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  305  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  364

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IAN+LLHS+RLL DASASFEKNCVR
Sbjct  365  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIANALLHSIRLLADASASFEKNCVR  424

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERIS+LLHESLMLVT LNPKIGYDNAAAVAK+AH+EG +LK AA +L VLT+EE
Sbjct  425  GIKANRERISRLLHESLMLVTSLNPKIGYDNAAAVAKRAHREGCTLKVAAMDLGVLTSEE  484

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKM+GP+D
Sbjct  485  FDTLVVPEKMLGPSD  499



>ref|XP_009802913.1| PREDICTED: fumarate hydratase 1, mitochondrial [Nicotiana sylvestris]
Length=465

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG +NT+AASLMK+ NDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  271  AHDAFVETSGAVNTVAASLMKVGNDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  330

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKPMIAN+LLHSVRLLGD SASFEKNCVR
Sbjct  331  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPMIANALLHSVRLLGDVSASFEKNCVR  390

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERI+KLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLK+AA NL VL +EE
Sbjct  391  GIQANRERIAKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKDAALNLGVLKSEE  450

Query  279  FDQLVVPEKMIGPTD  235
            FDQLVVPEKMI PTD
Sbjct  451  FDQLVVPEKMIDPTD  465



>ref|XP_006280350.1| hypothetical protein CARUB_v10026277mg [Capsella rubella]
 gb|EOA13248.1| hypothetical protein CARUB_v10026277mg [Capsella rubella]
Length=498

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  304  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  363

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA++LLHS+RL+ DASASFEKNCVR
Sbjct  364  CEAMTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIASALLHSIRLIADASASFEKNCVR  423

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYD AAAVAK+AHKEG +LK AA NL VLT+EE
Sbjct  424  GIKANRERISKLLHESLMLVTSLNPKIGYDKAAAVAKRAHKEGCTLKVAAMNLGVLTSEE  483

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  484  FDTLVVPEKMIGPSD  498



>ref|XP_010482423.1| PREDICTED: fumarate hydratase 2, chloroplastic-like [Camelina 
sativa]
Length=498

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  304  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  363

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA++LLHS+RL+ DASASFEKNCVR
Sbjct  364  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIASALLHSIRLVADASASFEKNCVR  423

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI ANRERISKLLHESLMLVT LNPKIGYDNAA+VAKKAHKEG +LK AA NL VLT EE
Sbjct  424  GIVANRERISKLLHESLMLVTSLNPKIGYDNAASVAKKAHKEGCTLKVAAMNLGVLTPEE  483

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKMIGP+D
Sbjct  484  FDRLVVPEKMIGPSD  498



>gb|KHG29130.1| Fumarate hydratase 1, mitochondrial -like protein [Gossypium 
arboreum]
Length=461

 Score =   348 bits (893),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMK+ANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  267  AHDAFVETSGALNTVATSLMKVANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  326

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEAITMVCAQV+GNHV +TVGGSNGHFELNVFKPMIAN+LLHS+RLLGDASASFEKNCVR
Sbjct  327  CEAITMVCAQVMGNHVAITVGGSNGHFELNVFKPMIANALLHSLRLLGDASASFEKNCVR  386

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA +L VLT+EE
Sbjct  387  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALSLGVLTSEE  446

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  447  FDTLVVPEKMIGPSD  461



>gb|KJB09427.1| hypothetical protein B456_001G141300 [Gossypium raimondii]
 gb|KJB09428.1| hypothetical protein B456_001G141300 [Gossypium raimondii]
Length=496

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMK+ANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  302  AHDAFVETSGALNTVATSLMKVANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  361

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEAITMVCAQV+GNHV +TVGGSNGHFELNVFKPMIAN+LLHS+RLLGDASASFEKNCVR
Sbjct  362  CEAITMVCAQVMGNHVAITVGGSNGHFELNVFKPMIANALLHSLRLLGDASASFEKNCVR  421

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA +L VLT+EE
Sbjct  422  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALSLGVLTSEE  481

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  482  FDTLVVPEKMIGPSD  496



>ref|XP_007051016.1| Fumarase 1 isoform 2 [Theobroma cacao]
 gb|EOX95173.1| Fumarase 1 isoform 2 [Theobroma cacao]
Length=497

 Score =   347 bits (890),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTIA SLMK+ANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  303  AHDAFVETSGALNTIATSLMKVANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  362

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIA++LLHSVRLLGDASASFEKNCVR
Sbjct  363  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPMIASALLHSVRLLGDASASFEKNCVR  422

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VLT+EE
Sbjct  423  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTSEE  482

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  483  FDNLVVPEKMIGPSD  497



>ref|XP_007051015.1| Fumarase 1 isoform 1 [Theobroma cacao]
 gb|EOX95172.1| Fumarase 1 isoform 1 [Theobroma cacao]
Length=496

 Score =   347 bits (889),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTIA SLMK+ANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  302  AHDAFVETSGALNTIATSLMKVANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  361

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIA++LLHSVRLLGDASASFEKNCVR
Sbjct  362  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPMIASALLHSVRLLGDASASFEKNCVR  421

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VLT+EE
Sbjct  422  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTSEE  481

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  482  FDNLVVPEKMIGPSD  496



>ref|XP_010442577.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X2 
[Camelina sativa]
Length=491

 Score =   346 bits (888),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+ G LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  297  AHDACVETCGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  356

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA++LLHS+RLL DASASFEKNCVR
Sbjct  357  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIAHALLHSIRLLADASASFEKNCVR  416

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERIS+LLHESLMLVT LNPKIGYDNAAAVAK+AH+EG +LK AA +L VLT+EE
Sbjct  417  GIKANRERISRLLHESLMLVTSLNPKIGYDNAAAVAKRAHREGCTLKVAAMDLGVLTSEE  476

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKM+GP+D
Sbjct  477  FDTLVVPEKMLGPSD  491



>ref|XP_008795801.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial-like 
[Phoenix dactylifera]
Length=474

 Score =   345 bits (886),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTI+ASL+KIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  280  AHDAFVETSGALNTISASLVKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  339

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNV+KP+IA++LL S+RLLGDA +SFEKNCVR
Sbjct  340  CEALTMVCAQVMGNHVAITVGGSNGHFELNVYKPLIASALLGSLRLLGDACSSFEKNCVR  399

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+AN ERISKLLHESLMLVT LNPKIGYD AA+VAKKAHKEG++LKE+A NL VLT +E
Sbjct  400  GIKANSERISKLLHESLMLVTSLNPKIGYDKAASVAKKAHKEGSTLKESAFNLGVLTEQE  459

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKMIGP+D
Sbjct  460  FDELVVPEKMIGPSD  474



>gb|KDO87119.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=403

 Score =   343 bits (880),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMKIAND+R LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  209  AHDAFVETSGALNTVAASLMKIANDVRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  268

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQVIGNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGDASASFEKNCVR
Sbjct  269  CEALTMVCAQVIGNHVAITVGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVR  328

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK+AA  L VL +EE
Sbjct  329  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEE  388

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  389  FDNLVVPEKMIGPSD  403



>ref|XP_010442576.1| PREDICTED: fumarate hydratase 2, chloroplastic-like isoform X1 
[Camelina sativa]
Length=499

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+ G LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  305  AHDACVETCGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  364

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA++LLHS+RLL DASASFEKNCVR
Sbjct  365  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIAHALLHSIRLLADASASFEKNCVR  424

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERIS+LLHESLMLVT LNPKIGYDNAAAVAK+AH+EG +LK AA +L VLT+EE
Sbjct  425  GIKANRERISRLLHESLMLVTSLNPKIGYDNAAAVAKRAHREGCTLKVAAMDLGVLTSEE  484

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKM+GP+D
Sbjct  485  FDTLVVPEKMLGPSD  499



>gb|KDO87117.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
 gb|KDO87118.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=423

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMKIAND+R LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  229  AHDAFVETSGALNTVAASLMKIANDVRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  288

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQVIGNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGDASASFEKNCVR
Sbjct  289  CEALTMVCAQVIGNHVAITVGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVR  348

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK+AA  L VL +EE
Sbjct  349  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEE  408

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  409  FDNLVVPEKMIGPSD  423



>ref|XP_011458750.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X2 [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   344 bits (882),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  298  AHDAFVETSGALNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  357

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEAITMVCAQV+GN+V +TVGGSNGHFELNVFKPMIA++LLHSVRLLGDASASFEKNCVR
Sbjct  358  CEAITMVCAQVMGNNVAITVGGSNGHFELNVFKPMIASALLHSVRLLGDASASFEKNCVR  417

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VLT+EE
Sbjct  418  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTSEE  477

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGPTD
Sbjct  478  FDTLVVPEKMIGPTD  492



>ref|XP_011458749.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   344 bits (882),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  298  AHDAFVETSGALNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  357

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEAITMVCAQV+GN+V +TVGGSNGHFELNVFKPMIA++LLHSVRLLGDASASFEKNCVR
Sbjct  358  CEAITMVCAQVMGNNVAITVGGSNGHFELNVFKPMIASALLHSVRLLGDASASFEKNCVR  417

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VLT+EE
Sbjct  418  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLDVLTSEE  477

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  478  FDSLVVPEKMIGPSD  492



>ref|XP_006444417.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 gb|ESR57657.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
Length=494

 Score =   343 bits (881),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMKIAND+R LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDAFVETSGALNTVAASLMKIANDVRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQVIGNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGDASASFEKNCVR
Sbjct  360  CEALTMVCAQVIGNHVAITVGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVR  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK+AA  L VL +EE
Sbjct  420  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEE  479

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  480  FDNLVVPEKMIGPSD  494



>ref|XP_006444418.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 ref|XP_006444419.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 ref|XP_006480012.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X2 
[Citrus sinensis]
 ref|XP_006480013.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X3 
[Citrus sinensis]
 gb|ESR57658.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 gb|ESR57659.1| hypothetical protein CICLE_v10019838mg [Citrus clementina]
 gb|KDO87112.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
 gb|KDO87113.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=497

 Score =   343 bits (881),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMKIAND+R LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  303  AHDAFVETSGALNTVAASLMKIANDVRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  362

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQVIGNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGDASASFEKNCVR
Sbjct  363  CEALTMVCAQVIGNHVAITVGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVR  422

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK+AA  L VL +EE
Sbjct  423  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEE  482

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  483  FDNLVVPEKMIGPSD  497



>ref|XP_009378742.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial-like 
[Pyrus x bretschneideri]
Length=566

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNT+A SLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  372  AHDAVVETSGALNTVATSLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  431

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCA+V+GN+V +TVGGS GHFELNVFKPMIA+ LLHSVRLLGDASASFEKNCVR
Sbjct  432  CEALTMVCARVMGNNVAITVGGSTGHFELNVFKPMIASGLLHSVRLLGDASASFEKNCVR  491

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISK L+ESLMLVT LN  +GYDNAAAVA+ AHKEG++LKEAA  L +L++EE
Sbjct  492  GIQANRERISKFLNESLMLVTSLNHTVGYDNAAAVARTAHKEGSTLKEAALKLGMLSSEE  551

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGPTD
Sbjct  552  FDTLVVPEKMIGPTD  566



>ref|XP_010523964.1| PREDICTED: fumarate hydratase 1, mitochondrial [Tarenaya hassleriana]
 ref|XP_010523965.1| PREDICTED: fumarate hydratase 1, mitochondrial [Tarenaya hassleriana]
Length=493

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDACVETSGSLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHS+RL+GDAS+SFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSIRLIGDASSSFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK+AA NL VL+ EE
Sbjct  419  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALNLGVLSPEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  479  FDNLVVPEKMIGPSD  493



>ref|XP_006480011.1| PREDICTED: fumarate hydratase 1, mitochondrial-like isoform X1 
[Citrus sinensis]
Length=522

 Score =   343 bits (879),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMKIAND+R LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  328  AHDAFVETSGALNTVAASLMKIANDVRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  387

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQVIGNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGDASASFEKNCVR
Sbjct  388  CEALTMVCAQVIGNHVAITVGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVR  447

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK+AA  L VL +EE
Sbjct  448  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEE  507

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  508  FDNLVVPEKMIGPSD  522



>ref|XP_004152237.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004156827.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN52832.1| hypothetical protein Csa_4G001990 [Cucumis sativus]
Length=495

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDAFVETSGSLNTVAASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNV+KPMIAN+LLHS+RLLGDASASFEKNCVR
Sbjct  360  CEALTMVCAQVMGNHVAITVGGSNGHFELNVYKPMIANALLHSLRLLGDASASFEKNCVR  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VL+ E+
Sbjct  420  GIQANRERISKLLHESLMLVTALNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLSEED  479

Query  279  FDQLVVPEKMIGPTD  235
            FD+ VVPEKMIGP+D
Sbjct  480  FDKHVVPEKMIGPSD  494



>emb|CDP17101.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKI NDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  295  AHDAFVETSGALNTVATSLMKIGNDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  354

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA+ LLHS+RL+GDAS+SFEKNCVR
Sbjct  355  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPLIASCLLHSLRLIGDASSSFEKNCVR  414

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERI+KLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA NL VLT+EE
Sbjct  415  GIQANRERITKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALNLGVLTSEE  474

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  475  FDTLVVPEKMIGPSD  489



>ref|XP_011082445.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Sesamum 
indicum]
Length=423

 Score =   339 bits (869),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTIA SLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  229  AHDAFVETSGALNTIAVSLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  288

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TV GSNGHFELN FKP+IA++LLHS+RLLGDA ASFEKNC+R
Sbjct  289  CEALTMVCAQVMGNHVAVTVAGSNGHFELNAFKPVIASNLLHSLRLLGDACASFEKNCIR  348

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERIS LLHESLMLVT LNPKIGYDNAA VAK AH+EG++LKEA   L VL+ EE
Sbjct  349  GIQANRERISMLLHESLMLVTSLNPKIGYDNAALVAKTAHEEGSTLKEAVFKLGVLSPEE  408

Query  279  FDQLVVPEKMIGP  241
            FD LVVP+ MIGP
Sbjct  409  FDSLVVPKNMIGP  421



>emb|CDY51427.1| BnaA04g27040D [Brassica napus]
Length=357

 Score =   337 bits (863),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  163  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  222

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHS+RL+ DASASFEKNCVR
Sbjct  223  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSIRLVADASASFEKNCVR  282

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VLTAEE
Sbjct  283  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTAEE  342

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  343  FDTLVVPEKMIGPSD  357



>ref|NP_182273.1| fumarate hydratase 1 [Arabidopsis thaliana]
 ref|NP_001078075.1| fumarate hydratase 1 [Arabidopsis thaliana]
 sp|P93033.2|FUM1_ARATH RecName: Full=Fumarate hydratase 1, mitochondrial; Short=Fumarase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB71399.1| fumarase [Arabidopsis thaliana]
 gb|AAC62859.1| putative fumarase [Arabidopsis thaliana]
 gb|AAL06911.1| At2g47510/T30B22.19 [Arabidopsis thaliana]
 gb|AAL32538.1| putative fumarase [Arabidopsis thaliana]
 gb|AAO29979.1| putative fumarase [Arabidopsis thaliana]
 gb|AEC10852.1| fumarate hydratase 1 [Arabidopsis thaliana]
 gb|AEC10853.1| fumarate hydratase 1 [Arabidopsis thaliana]
Length=492

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  298  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  357

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHSVRL+ DASASFEKNCVR
Sbjct  358  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVR  417

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG +LKEAA NL VLTAEE
Sbjct  418  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGCTLKEAALNLGVLTAEE  477

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  478  FDTLVVPEKMIGPSD  492



>dbj|BAH19491.1| AT2G47510 [Arabidopsis thaliana]
Length=492

 Score =   338 bits (868),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  298  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  357

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHSVRL+ DASASFEKNCVR
Sbjct  358  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVR  417

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT  NPKIGYDNAAAVAKKAHKEG +LKEAA NL VLTAEE
Sbjct  418  GIEANRERISKLLHESLMLVTSWNPKIGYDNAAAVAKKAHKEGCTLKEAALNLGVLTAEE  477

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  478  FDTLVVPEKMIGPSD  492



>ref|XP_002880309.1| hypothetical protein ARALYDRAFT_483931 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56568.1| hypothetical protein ARALYDRAFT_483931 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/195 (88%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIAASLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  298  AHDACVETSGSLNTIAASLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  357

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHSVRL+ DASASFEKNCVR
Sbjct  358  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVR  417

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG +LK+AA  L VLTAEE
Sbjct  418  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGCTLKDAALKLGVLTAEE  477

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  478  FDTLVVPEKMIGPSD  492



>emb|CDY27481.1| BnaC04g51220D [Brassica napus]
Length=487

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  293  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  352

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHS+RL+ DASASFEKNCVR
Sbjct  353  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSIRLVADASASFEKNCVR  412

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VLTAEE
Sbjct  413  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTAEE  472

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  473  FDTLVVPEKMIGPSD  487



>ref|XP_002273033.1| PREDICTED: fumarate hydratase 1, mitochondrial [Vitis vinifera]
 emb|CBI36898.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG +NT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDAFVETSGSVNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA+ LL S+RLLGDASASFEKNCVR
Sbjct  360  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPLIASGLLRSIRLLGDASASFEKNCVR  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN+ERI KLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG +LKEAA NL VLT+EE
Sbjct  420  GIQANKERILKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGRTLKEAALNLGVLTSEE  479

Query  279  FDQLVVPEKMIGPTD  235
            FDQLVVPEKMIGP+D
Sbjct  480  FDQLVVPEKMIGPSD  494



>ref|XP_006397946.1| hypothetical protein EUTSA_v10001422mg [Eutrema salsugineum]
 gb|ESQ39399.1| hypothetical protein EUTSA_v10001422mg [Eutrema salsugineum]
Length=492

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  298  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  357

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHS+RL+ DASASFEKNCVR
Sbjct  358  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSIRLIADASASFEKNCVR  417

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LK+AA  L VLTAEE
Sbjct  418  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKDAALKLGVLTAEE  477

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  478  FDTLVVPEKMIGPSD  492



>ref|XP_008454312.1| PREDICTED: fumarate hydratase 1, mitochondrial [Cucumis melo]
Length=494

 Score =   338 bits (866),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDAFVETSGSLNTVAASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNV+KPMIAN+LLHS+RLLGDASASFEKNCVR
Sbjct  360  CEALTMVCAQVMGNHVAITVGGSNGHFELNVYKPMIANALLHSLRLLGDASASFEKNCVR  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG +LKEAA  L VL  EE
Sbjct  420  GIQANRERISKLLHESLMLVTALNPKIGYDNAAAVAKKAHKEGCTLKEAALKLGVLCEEE  479

Query  279  FDQLVVPEKMIGPT  238
            FD+ VVPEKMIGP+
Sbjct  480  FDKHVVPEKMIGPS  493



>ref|XP_010069886.1| PREDICTED: fumarate hydratase 1, mitochondrial [Eucalyptus grandis]
 gb|KCW58394.1| hypothetical protein EUGRSUZ_H01081 [Eucalyptus grandis]
Length=497

 Score =   337 bits (863),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  303  AHDAFVETSGALNTVATSLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  362

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCA+V+GNHV +TVGGSNGHFELNVFKPMIA+ LL S+RLLGDAS+SF+KNCV 
Sbjct  363  CEALTMVCARVMGNHVAVTVGGSNGHFELNVFKPMIASGLLQSLRLLGDASSSFDKNCVH  422

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VLT+EE
Sbjct  423  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTSEE  482

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  483  FDNLVVPEKMIGPSD  497



>ref|XP_006296086.1| hypothetical protein CARUB_v10025236mg [Capsella rubella]
 gb|EOA28984.1| hypothetical protein CARUB_v10025236mg [Capsella rubella]
Length=493

 Score =   336 bits (862),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHSVRL+ DASASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LK+AA  L VLT+EE
Sbjct  419  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKDAALKLGVLTSEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  479  FDTLVVPEKMIGPSD  493



>ref|XP_004290822.2| PREDICTED: fumarate hydratase 1, mitochondrial isoform X3 [Fragaria 
vesca subsp. vesca]
Length=469

 Score =   335 bits (860),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKI NDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  275  AHDAFVETSGALNTVATSLMKIGNDIRFLGSGPRCGLGELGLPENEPGSSIMPGKVNPTQ  334

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP++A++LLHS+RLLGDAS SFEKNCV+
Sbjct  335  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPLMASNLLHSLRLLGDASVSFEKNCVK  394

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN+ERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VLT+EE
Sbjct  395  GIQANKERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLDVLTSEE  454

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  455  FDSLVVPEKMIGPSD  469



>ref|XP_010506787.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Camelina 
sativa]
Length=493

 Score =   336 bits (861),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 171/195 (88%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHSVRL+ DASASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG +LK+AA  L VLTAEE
Sbjct  419  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGCTLKDAALKLGVLTAEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  479  FDTLVVPEKMIGPSD  493



>gb|KJB22510.1| hypothetical protein B456_004G051500 [Gossypium raimondii]
Length=436

 Score =   334 bits (856),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  242  AHDAFVETSGALNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  301

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP++A++LLHS+RL+ DASASF KNCV+
Sbjct  302  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPLMASALLHSIRLVSDASASFVKNCVK  361

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN++RISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG+SLKEAA NL +LT EE
Sbjct  362  GIQANKDRISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSSLKEAALNLGMLTEEE  421

Query  279  FDQLVVPEKMIGPTD  235
            F+ LVVPEKMI P+D
Sbjct  422  FESLVVPEKMIAPSD  436



>ref|XP_010518455.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Camelina 
sativa]
Length=493

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA S+MKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDACVETSGSLNTIATSMMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHSVRL+ DASASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG +LK+AA  L VLTAEE
Sbjct  419  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGCTLKDAALKLGVLTAEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  479  FDTLVVPEKMIGPSD  493



>ref|XP_010507882.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X3 [Camelina 
sativa]
Length=493

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNT+A SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDACVETSGSLNTVATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA++LLHSVRL+ DASASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG +LK+AA  L VLTAEE
Sbjct  419  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGCTLKDAALKLGVLTAEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  479  FDTLVVPEKMIGPSD  493



>ref|XP_010507880.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X1 [Camelina 
sativa]
 ref|XP_010507881.1| PREDICTED: fumarate hydratase 1, mitochondrial isoform X2 [Camelina 
sativa]
Length=493

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNT+A SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDACVETSGSLNTVATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA++LLHSVRL+ DASASFEKNCVR
Sbjct  359  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVR  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG +LK+AA  L VLTAEE
Sbjct  419  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGCTLKDAALKLGVLTAEE  478

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  479  FDTLVVPEKMIGPSD  493



>ref|XP_006840369.1| hypothetical protein AMTR_s00045p00124970 [Amborella trichopoda]
 gb|ERN02044.1| hypothetical protein AMTR_s00045p00124970 [Amborella trichopoda]
Length=494

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKI NDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDAFVETSGALNTVATSLMKIGNDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNV+KPMIA++LL S+RLL DAS SFEKNCVR
Sbjct  360  CEALTMVCAQVMGNHVAITVGGSNGHFELNVYKPMIASNLLRSLRLLADASISFEKNCVR  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANR+RISKLLHESLMLVT LNPKIGYDNAAAVAKKAH+EGT+LK+AA +L VL+++E
Sbjct  420  GIQANRQRISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHREGTTLKDAALSLGVLSSQE  479

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVP KMIGP+D
Sbjct  480  FDELVVPNKMIGPSD  494



>ref|XP_009142525.1| PREDICTED: fumarate hydratase 1, mitochondrial [Brassica rapa]
Length=492

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  298  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  357

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LLHSVRL+ DASASFEKNCVR
Sbjct  358  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIASALLHSVRLIADASASFEKNCVR  417

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHE  MLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VLT+EE
Sbjct  418  GIEANRERISKLLHEVYMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTSEE  477

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  478  FDTLVVPEKMIGPSD  492



>ref|XP_003591472.1| Fumarate hydratase [Medicago truncatula]
 gb|AES61723.1| fumarate hydratase [Medicago truncatula]
Length=491

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHD+FVE+SG LNTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  297  AHDSFVETSGALNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  356

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LL SVRLLGD+ ASFEKNCVR
Sbjct  357  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPVIASNLLQSVRLLGDSCASFEKNCVR  416

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYD AAAVAKKAHKEG++LKEAA  L VLT+EE
Sbjct  417  GIQANRERISKLLHESLMLVTSLNPKIGYDKAAAVAKKAHKEGSTLKEAALKLGVLTSEE  476

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKM+GP+D
Sbjct  477  FDSLVVPEKMLGPSD  491



>gb|KFK37522.1| hypothetical protein AALP_AA4G268000 [Arabis alpina]
Length=487

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTI  SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  293  AHDACVETSGSLNTIVVSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  352

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA +LLHS+RL+ DASASFEKNCVR
Sbjct  353  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVIARALLHSIRLVADASASFEKNCVR  412

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LK+AA  L+VLTA+E
Sbjct  413  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKDAALKLRVLTAQE  472

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  473  FDTLVVPEKMIGPSD  487



>ref|XP_007145185.1| hypothetical protein PHAVU_007G217700g [Phaseolus vulgaris]
 gb|ESW17179.1| hypothetical protein PHAVU_007G217700g [Phaseolus vulgaris]
Length=461

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  267  AHDAFVETSGALNTVAASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  326

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIA+ LL S+RLLGD+ ASFEKNCVR
Sbjct  327  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPMIASCLLRSLRLLGDSVASFEKNCVR  386

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLL ESLMLVT LN KIGYD AAAVAK AHKEGT+LKEAA  + VL++E+
Sbjct  387  GIQANRERISKLLRESLMLVTSLNQKIGYDKAAAVAKTAHKEGTTLKEAALKIGVLSSED  446

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPE+M+GP+D
Sbjct  447  FDELVVPEQMLGPSD  461



>ref|XP_010680310.1| PREDICTED: fumarate hydratase 1, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=490

 Score =   331 bits (848),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  296  AHDAFVETSGALNTVAASLMKIANDIRFLGSGPRCGLGELTLPENEPGSSIMPGKVNPTQ  355

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GN+V +TVGGSNGHFELNV+KP++AN+LLHS+RLL DASASFEKNCVR
Sbjct  356  CEALTMVCAQVMGNNVAVTVGGSNGHFELNVYKPLMANALLHSLRLLADASASFEKNCVR  415

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLL+ESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK+AA  L VLT EE
Sbjct  416  GIEANRERISKLLNESLMLVTALNPKIGYDNAAAVAKKAHKEGTTLKDAALKLGVLTEEE  475

Query  279  FDQLVVPEKMIGPTD  235
            F Q V+PEKMIGP+D
Sbjct  476  FHQYVLPEKMIGPSD  490



>gb|AAB39989.1| fumarase [Arabidopsis thaliana]
Length=491

 Score =   328 bits (842),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  297  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELVLPENEPGSSIMPGKVNPTQ  356

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+ +++LLHSVRL+ DASASFEKNCVR
Sbjct  357  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPVTSSALLHSVRLIADASASFEKNCVR  416

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LN KIG DNAAAVAKKAHKEG +LKEAA NL VLTAEE
Sbjct  417  GIEANRERISKLLHESLMLVTSLNRKIGCDNAAAVAKKAHKEGCTLKEAALNLGVLTAEE  476

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  477  FDTLVVPEKMIGPSD  491



>ref|XP_010026118.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Eucalyptus 
grandis]
Length=479

 Score =   325 bits (833),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  285  AHDAFVETSGALNTVATSLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  344

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCA+V+GN+V +TVGGSNGHFELNVFKPMIA+ LL S+RLLGDA +SF+KNC++
Sbjct  345  CEALTMVCARVMGNNVAITVGGSNGHFELNVFKPMIASGLLQSLRLLGDACSSFDKNCIQ  404

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLL ESLMLVT LNPKIGYDNAA VAKKAHKEG++LKE+A  L++LT+EE
Sbjct  405  GIQANRERISKLLQESLMLVTSLNPKIGYDNAAKVAKKAHKEGSTLKESALKLKLLTSEE  464

Query  279  FDQLVVPEKMIGPT  238
            FD LVVPEKMIGP+
Sbjct  465  FDNLVVPEKMIGPS  478



>gb|KCW58396.1| hypothetical protein EUGRSUZ_H01083 [Eucalyptus grandis]
Length=478

 Score =   325 bits (833),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  284  AHDAFVETSGALNTVATSLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  343

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCA+V+GN+V +TVGGSNGHFELNVFKPMIA+ LL S+RLLGDA +SF+KNC++
Sbjct  344  CEALTMVCARVMGNNVAITVGGSNGHFELNVFKPMIASGLLQSLRLLGDACSSFDKNCIQ  403

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLL ESLMLVT LNPKIGYDNAA VAKKAHKEG++LKE+A  L++LT+EE
Sbjct  404  GIQANRERISKLLQESLMLVTSLNPKIGYDNAAKVAKKAHKEGSTLKESALKLKLLTSEE  463

Query  279  FDQLVVPEKMIGPT  238
            FD LVVPEKMIGP+
Sbjct  464  FDNLVVPEKMIGPS  477



>ref|XP_002864085.1| hypothetical protein ARALYDRAFT_495160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40344.1| hypothetical protein ARALYDRAFT_495160 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   325 bits (834),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  305  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  364

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQ +GNHV +T+GGSNGHFELNVFKP+IA++LLHS+RL+ DASASF+KNCVR
Sbjct  365  CEALTMVCAQAMGNHVAVTIGGSNGHFELNVFKPVIASALLHSIRLIADASASFDKNCVR  424

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            G +ANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEG +LK AA  L VLT+EE
Sbjct  425  GSEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGCTLKHAAMKLGVLTSEE  484

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  485  FDTLVVPEKMIGPSD  499



>gb|ABK24782.1| unknown [Picea sitchensis]
 gb|ABR17637.1| unknown [Picea sitchensis]
Length=495

 Score =   323 bits (827),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG +NT++ SLMKIANDIRFLGSGPRCGLGEL+LPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDAFVETSGAVNTVSVSLMKIANDIRFLGSGPRCGLGELLLPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKP+IA++LL S+ LLGDA+ASFEKNCVR
Sbjct  361  CEALTMVCAQVMGNHVAITVGGSNGHFELNVFKPLIASALLRSLTLLGDAAASFEKNCVR  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN  RI +L+ ESLMLVT LNPKIGYD AAA AKKAHKEG++LKEAA  L VLT+EE
Sbjct  421  GIQANHRRIGQLVRESLMLVTALNPKIGYDKAAATAKKAHKEGSTLKEAALQLGVLTSEE  480

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKMIGP+D
Sbjct  481  FDELVVPEKMIGPSD  495



>ref|XP_002523133.1| aspartate ammonia lyase, putative [Ricinus communis]
 gb|EEF39318.1| aspartate ammonia lyase, putative [Ricinus communis]
Length=470

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG LNTIA SLMKIAND+R LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDAFVESSGALNTIATSLMKIANDVRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNVFKPMIA++LLHSVRLLGDASASFEKNCVR
Sbjct  361  CEALTMVCAQVMGNHVAVTVGGSNGHFELNVFKPMIASNLLHSVRLLGDASASFEKNCVR  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLK  319
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAK AHKEG++LK
Sbjct  421  GIQANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKLAHKEGSTLK  467



>ref|XP_009384520.1| PREDICTED: fumarate hydratase 1, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=498

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  304  AHDAFVETSGALNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  363

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNV+KP+IA+ LL S+RLLGDASASFEKNCVR
Sbjct  364  CEALTMVCAQVMGNHVAITVGGSNGHFELNVYKPLIASGLLRSLRLLGDASASFEKNCVR  423

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+AN +RISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK+AA NL VLTAEE
Sbjct  424  GIKANHQRISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKDAALNLNVLTAEE  483

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKM+GP+D
Sbjct  484  FDELVVPEKMLGPSD  498



>ref|XP_007445160.1| PREDICTED: fumarate hydratase, mitochondrial-like, partial [Python 
bivittatus]
Length=208

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  15   AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  74

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEAITMV AQV+GNHV +TVGGS+GHFELNVFKPMI  ++LHS +LLGDA  SF +NCV 
Sbjct  75   CEAITMVAAQVMGNHVAVTVGGSSGHFELNVFKPMIIRNVLHSAQLLGDACVSFTENCVI  134

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHKEG +LKE A  L  LTAE+
Sbjct  135  GIQANTERINKLMNESLMLVTALNPYIGYDKAAKIAKTAHKEGMTLKETATKLGFLTAEQ  194

Query  279  FDQLVVPEKMIGP  241
            FDQ V PE M+GP
Sbjct  195  FDQWVKPENMLGP  207



>gb|KDO87114.1| hypothetical protein CISIN_1g010908mg [Citrus sinensis]
Length=487

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 176/195 (90%), Gaps = 10/195 (5%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+AASLMKIAND+R LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  303  AHDAFVETSGALNTVAASLMKIANDVRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  362

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQVIGNHV +TVGGSNGHFELNVFKPMIA+ LLHS+RLLGDASASFEKNCVR
Sbjct  363  CEALTMVCAQVIGNHVAITVGGSNGHFELNVFKPMIASGLLHSLRLLGDASASFEKNCVR  422

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHE          KIGYDNAAAVAKKAHKEGT+LK+AA  L VL +EE
Sbjct  423  GIQANRERISKLLHE----------KIGYDNAAAVAKKAHKEGTTLKDAALKLGVLNSEE  472

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  473  FDNLVVPEKMIGPSD  487



>ref|XP_010259454.1| PREDICTED: fumarate hydratase 1, mitochondrial [Nelumbo nucifera]
Length=495

 Score =   318 bits (815),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDAFVETSGALNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA+ LL S+RLLGDAS SFEKNCVR
Sbjct  361  CEALTMVCAQVMGNHVAITIGGSNGHFELNVFKPLIASGLLRSLRLLGDASTSFEKNCVR  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK++A  L VLT+EE
Sbjct  421  GIQANRERISKLLHESLMLVTALNPKIGYDNAAAVAKKAHKEGTTLKDSAMKLGVLTSEE  480

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVP KMIGP+D
Sbjct  481  FDKLVVPGKMIGPSD  495



>ref|XP_008111212.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Anolis 
carolinensis]
Length=434

 Score =   316 bits (810),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  241  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  300

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEAITMV AQV+GNHV +TVGGSNGHFELNVFKPMI  ++LHS RLLGDAS SF  NCV 
Sbjct  301  CEAITMVAAQVMGNHVAVTVGGSNGHFELNVFKPMIIKNVLHSARLLGDASVSFTDNCVV  360

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKE A  L  LT+E+
Sbjct  361  GIQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKETAIKLGFLTSEQ  420

Query  279  FDQLVVPEKMIGP  241
            FDQ V PE+M+GP
Sbjct  421  FDQWVKPEEMLGP  433



>ref|XP_010938348.1| PREDICTED: fumarate hydratase 1, mitochondrial [Elaeis guineensis]
Length=498

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  304  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  363

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNV+KP+IA++LL S+RLLGDAS SFEKNCVR
Sbjct  364  CEALTMVCAQVMGNHVAITVGGSNGHFELNVYKPLIASALLRSLRLLGDASTSFEKNCVR  423

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQANRERISKLLHESLMLVT LNPKIGYD AAAVAKKAHKEG++LKEAA +L VLT +E
Sbjct  424  GIQANRERISKLLHESLMLVTSLNPKIGYDKAAAVAKKAHKEGSTLKEAALSLGVLTEQE  483

Query  279  FDQLVVPEKMIGPTD  235
            F+QLVVPEKMIGP+D
Sbjct  484  FNQLVVPEKMIGPSD  498



>ref|XP_008111211.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Anolis 
carolinensis]
Length=501

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  308  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  367

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEAITMV AQV+GNHV +TVGGSNGHFELNVFKPMI  ++LHS RLLGDAS SF  NCV 
Sbjct  368  CEAITMVAAQVMGNHVAVTVGGSNGHFELNVFKPMIIKNVLHSARLLGDASVSFTDNCVV  427

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKE A  L  LT+E+
Sbjct  428  GIQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKETAIKLGFLTSEQ  487

Query  279  FDQLVVPEKMIGP  241
            FDQ V PE+M+GP
Sbjct  488  FDQWVKPEEMLGP  500



>ref|NP_001146296.1| uncharacterized protein LOC100279871 [Zea mays]
 gb|ACN32151.1| unknown [Zea mays]
 tpg|DAA45270.1| TPA: hypothetical protein ZEAMMB73_835410 [Zea mays]
Length=498

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  304  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  363

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHVG+T+GG+NGHFELNVFKPMIA  LL S+RLLGDAS SFEKNCVR
Sbjct  364  CEALTMVCAQVMGNHVGVTIGGANGHFELNVFKPMIAAGLLRSLRLLGDASVSFEKNCVR  423

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RIS+LLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LKEAA +L VLT +E
Sbjct  424  GIQANHKRISQLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKEAALDLGVLTEQE  483

Query  279  FDQLVVPEKMIGPTD  235
            F +LVVPEKMIGP+D
Sbjct  484  FHELVVPEKMIGPSD  498



>ref|XP_008235134.1| PREDICTED: LOW QUALITY PROTEIN: fumarate hydratase 1, mitochondrial 
[Prunus mume]
Length=490

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/195 (83%), Positives = 173/195 (89%), Gaps = 3/195 (2%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDAFVETSGALNTVATSLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV GNHV +TVGGSNGHFELNVFKPMIA+ LLHSVRLLGDASASFEKNCV+
Sbjct  359  CEALTMVCAQVFGNHVAITVGGSNGHFELNVFKPMIASGLLHSVRLLGDASASFEKNCVK  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI    E      + SLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA  L VLT+EE
Sbjct  419  GID---EEYRTFXYSSLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALKLGVLTSEE  475

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  476  FDTLVVPEKMIGPSD  490



>ref|XP_004984441.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Setaria 
italica]
Length=496

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  302  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  361

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHVG+TVGG+NGHFELNVFKPMIA  LL S+RLLGDAS SFEKNCVR
Sbjct  362  CEALTMVCAQVMGNHVGVTVGGANGHFELNVFKPMIAAGLLRSLRLLGDASVSFEKNCVR  421

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RIS+LLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK+AA +L VLT EE
Sbjct  422  GIQANHKRISQLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKKAALDLGVLTEEE  481

Query  279  FDQLVVPEKMIGPTD  235
            F +LVVPEKMIGP+D
Sbjct  482  FHELVVPEKMIGPSD  496



>ref|XP_008790868.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=498

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  304  AHDAFVETSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  363

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNV+KP+IA++LL S+RLLGDAS SFEKNCVR
Sbjct  364  CEALTMVCAQVMGNHVAITVGGSNGHFELNVYKPLIASALLRSLRLLGDASLSFEKNCVR  423

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERISKLLHESLMLVT LNPKIGYD AAAVAKKAHKEG++LKEAA +L VLT +E
Sbjct  424  GIKANRERISKLLHESLMLVTSLNPKIGYDKAAAVAKKAHKEGSTLKEAALSLGVLTEQE  483

Query  279  FDQLVVPEKMIGPTD  235
            F+QLVVPEKMIGP+D
Sbjct  484  FNQLVVPEKMIGPSD  498



>gb|EEE59021.1| hypothetical protein OsJ_10766 [Oryza sativa Japonica Group]
Length=480

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  286  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  345

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHVG+TVGGSNGHFELNVFKPMIA  LL S+RLLGDAS SFEKNCVR
Sbjct  346  CEALTMVCAQVMGNHVGVTVGGSNGHFELNVFKPMIAAGLLRSLRLLGDASVSFEKNCVR  405

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RIS+LLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA +L VLT  E
Sbjct  406  GIQANHKRISQLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALDLGVLTESE  465

Query  279  FDQLVVPEKMIGPTD  235
            F +LVVPEKMIGP+D
Sbjct  466  FHELVVPEKMIGPSD  480



>ref|XP_006134175.1| PREDICTED: fumarate hydratase, mitochondrial-like isoform X2 
[Pelodiscus sinensis]
Length=447

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  254  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  313

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPMI  ++L+S RLLGD S SF  NCV 
Sbjct  314  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMIIKNVLNSARLLGDVSVSFTDNCVV  373

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LTAE+
Sbjct  374  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTAEQ  433

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  434  FDQWVKPKDMLGP  446



>gb|ABF95833.1| Fumarate hydratase 1, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAH01638.1| unnamed protein product [Oryza sativa Japonica Group]
Length=502

 Score =   313 bits (803),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  308  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  367

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHVG+TVGGSNGHFELNVFKPMIA  LL S+RLLGDAS SFEKNCVR
Sbjct  368  CEALTMVCAQVMGNHVGVTVGGSNGHFELNVFKPMIAAGLLRSLRLLGDASVSFEKNCVR  427

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RIS+LLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA +L VLT  E
Sbjct  428  GIQANHKRISQLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALDLGVLTESE  487

Query  279  FDQLVVPEKMIGPTD  235
            F +LVVPEKMIGP+D
Sbjct  488  FHELVVPEKMIGPSD  502



>ref|XP_006281482.1| hypothetical protein CARUB_v10027566mg [Capsella rubella]
 gb|EOA14380.1| hypothetical protein CARUB_v10027566mg [Capsella rubella]
Length=481

 Score =   313 bits (801),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 170/195 (87%), Gaps = 6/195 (3%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIR LGSGPRCGLGEL LP+ E G      KVNPTQ
Sbjct  293  AHDACVETSGSLNTIATSLMKIANDIRLLGSGPRCGLGELSLPDLEAG------KVNPTQ  346

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVC QV+GNHV +T+GGSNGHFELNVFKP+IA++LLHS+RLL DASASFEKNCVR
Sbjct  347  CEAMTMVCTQVMGNHVAVTIGGSNGHFELNVFKPVIASALLHSIRLLADASASFEKNCVR  406

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANRERIS+LLHES MLVT LNPKIGYDNAAAVAK+AHKEG +LK AA  L VLT+E 
Sbjct  407  GIEANRERISRLLHESPMLVTSLNPKIGYDNAAAVAKRAHKEGCTLKVAAMKLGVLTSEA  466

Query  279  FDQLVVPEKMIGPTD  235
            FD LVVPEKMIGP+D
Sbjct  467  FDTLVVPEKMIGPSD  481



>gb|EEC75213.1| hypothetical protein OsI_11478 [Oryza sativa Indica Group]
Length=502

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 169/195 (87%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  308  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  367

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHVG+TVGGSNGHFELNVFKPMIA  LL S+RLLGDAS SFEKNCVR
Sbjct  368  CEALTMVCAQVMGNHVGVTVGGSNGHFELNVFKPMIAAGLLRSLRLLGDASVSFEKNCVR  427

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RIS+LLHESLMLVT LNPKIGYDNAAAVAKKAHKEG++LKEAA +L VLT  E
Sbjct  428  GIQANHKRISQLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALDLGVLTESE  487

Query  279  FDQLVVPEKMIGPTD  235
            F +LVVPEKMIGP+D
Sbjct  488  FHELVVPEKMIGPSD  502



>ref|XP_008167561.1| PREDICTED: fumarate hydratase, mitochondrial isoform X3 [Chrysemys 
picta bellii]
Length=434

 Score =   311 bits (797),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  241  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  300

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPMI  ++L+S RLLGD S SF  NCV 
Sbjct  301  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMIIKNVLNSARLLGDVSVSFTDNCVV  360

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  361  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSEQ  420

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  421  FDQWVKPKDMLGP  433



>ref|XP_002283168.2| PREDICTED: fumarate hydratase 1, mitochondrial [Vitis vinifera]
 emb|CBI39552.3| unnamed protein product [Vitis vinifera]
Length=496

 Score =   313 bits (802),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTI ASLMKI NDIR LGSGPRCGLGEL LP+NEPGSSIMPGKVNPTQ
Sbjct  302  AHDAFVETSGALNTICASLMKIGNDIRLLGSGPRCGLGELTLPDNEPGSSIMPGKVNPTQ  361

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNV+KP+IA+ LL S+RLLGDASASFEKNC+R
Sbjct  362  CEALTMVCAQVMGNHVAITVGGSNGHFELNVYKPLIASGLLRSLRLLGDASASFEKNCIR  421

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN+ERISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LK AA NL VLT+EE
Sbjct  422  GIQANQERISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKHAALNLGVLTSEE  481

Query  279  FDQLVVPEKMIGPTD  235
            F++LVVPEKMIGP+D
Sbjct  482  FEKLVVPEKMIGPSD  496



>dbj|BAN21048.1| aspartate ammonia lyase [Riptortus pedestris]
Length=510

 Score =   313 bits (803),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG LNT+A S+MKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVEVSGALNTVAVSIMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEAITMV AQV+GNHV +T+GGSNGHFELNVFKPM+  ++L S+RLLGD+S +F  NCV 
Sbjct  377  CEAITMVAAQVMGNHVAVTIGGSNGHFELNVFKPMMVANVLRSIRLLGDSSKAFTNNCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQA++ERI+KLLHESLMLVT LNP IGYD AA +AK AHK  ++LKEAA  L +LT+EE
Sbjct  437  GIQADKERIAKLLHESLMLVTALNPHIGYDKAALIAKTAHKNKSTLKEAAIKLNILTSEE  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V PE M+GP
Sbjct  497  FDKYVKPEDMLGP  509



>gb|ACL53645.1| unknown [Zea mays]
Length=498

 Score =   313 bits (801),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  304  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  363

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHVG+T+GG+NGHFELNVFKPMIA  LL S+RLLGDAS SFEKNCVR
Sbjct  364  CEALTMVCAQVMGNHVGVTIGGANGHFELNVFKPMIAAGLLRSLRLLGDASVSFEKNCVR  423

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RIS+LLHESLML+T LNPKIGYDNAAAVAKKAHKEGT+LKEAA +L VLT +E
Sbjct  424  GIQANHKRISQLLHESLMLLTSLNPKIGYDNAAAVAKKAHKEGTTLKEAALDLGVLTEQE  483

Query  279  FDQLVVPEKMIGPTD  235
            F +LVVPEKMIGP+D
Sbjct  484  FHELVVPEKMIGPSD  498



>gb|KJB81339.1| hypothetical protein B456_013G139800 [Gossypium raimondii]
 gb|KJB81340.1| hypothetical protein B456_013G139800 [Gossypium raimondii]
Length=176

 Score =   301 bits (772),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  762  MKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQCEAITMVCAQVIGNHVGLT  583
            MK+ANDI  LGSGPRCGLGELILPENEPGSSIMPGKVNPTQCEAITMVCAQV+GNHV +T
Sbjct  1    MKVANDIHLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQCEAITMVCAQVMGNHVAIT  60

Query  582  VGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVRGIQANRERISKLLHESLML  403
            VGGSNGH ELNVFKPMIAN+LLHS+RLLGDASASFEKNCVRGIQANRERISKLLHESLM 
Sbjct  61   VGGSNGHSELNVFKPMIANALLHSLRLLGDASASFEKNCVRGIQANRERISKLLHESLMH  120

Query  402  VTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEEFDQLVVPEKMIGPTD  235
            VT LNPKIGYDNAAAVAKKAHKEG++LKEAA +L VLT+EEFD LVVPEK IGP+D
Sbjct  121  VTSLNPKIGYDNAAAVAKKAHKEGSTLKEAALSLGVLTSEEFDTLVVPEKTIGPSD  176



>ref|XP_009490201.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Pelecanus 
crispus]
Length=208

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  15   AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  74

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  75   CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  134

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  135  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAALKLGFLTSDQ  194

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  195  FDQWVKPKDMLGP  207



>gb|EMS52788.1| Fumarate hydratase 2, chloroplastic [Triticum urartu]
Length=494

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHVG+T+GGSNGHFELNV+KPMIA  LL S+RLLGDAS SFEKNCVR
Sbjct  360  CEALTMVCAQVMGNHVGVTIGGSNGHFELNVYKPMIAAGLLRSLRLLGDASVSFEKNCVR  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+AN +RIS+LLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LKEAA +L VLT +E
Sbjct  420  GIEANHKRISQLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKEAALSLGVLTEKE  479

Query  279  FDQLVVPEKMIGPTD  235
            F +LVVPEKMIGP+D
Sbjct  480  FHELVVPEKMIGPSD  494



>ref|XP_006651566.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Oryza brachyantha]
Length=491

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 181/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  297  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  356

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHVG+T+GGSNGHFELNVFKPMIA  LL S+RLLGDAS SFEKNCV 
Sbjct  357  CEALTMVCAQVMGNHVGVTIGGSNGHFELNVFKPMIAAGLLRSLRLLGDASVSFEKNCVS  416

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RIS+LLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LKEAA +L VLT  E
Sbjct  417  GIQANHKRISQLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKEAALSLGVLTETE  476

Query  279  FDQLVVPEKMIGPTD  235
            F +LVVPEKMIGP+D
Sbjct  477  FHELVVPEKMIGPSD  491



>ref|XP_006134174.1| PREDICTED: fumarate hydratase, mitochondrial-like isoform X1 
[Pelodiscus sinensis]
Length=506

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  313  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  372

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPMI  ++L+S RLLGD S SF  NCV 
Sbjct  373  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMIIKNVLNSARLLGDVSVSFTDNCVV  432

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LTAE+
Sbjct  433  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTAEQ  492

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  493  FDQWVKPKDMLGP  505



>ref|XP_010245463.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Nelumbo 
nucifera]
Length=553

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  359  AHDAFVETSGALNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  418

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +TVGGSNGHFELNV+KP+IA+ LL S+RLLGDAS SFEKNCVR
Sbjct  419  CEALTMVCAQVMGNHVAITVGGSNGHFELNVYKPLIASGLLRSLRLLGDASISFEKNCVR  478

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN  RISKLLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LKE+A  L VL +EE
Sbjct  479  GIQANHGRISKLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKESALKLGVLASEE  538

Query  279  FDQLVVPEKMIGPTD  235
            FD+LVVPEKMIGP+D
Sbjct  539  FDKLVVPEKMIGPSD  553



>ref|XP_008573483.1| PREDICTED: fumarate hydratase, mitochondrial [Galeopterus variegatus]
Length=469

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  276  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  335

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  336  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  395

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+HESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  396  GIQANTERINKLMHESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  455

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  456  FDEWVKPKDMLGP  468



>ref|XP_008167560.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Chrysemys 
picta bellii]
Length=500

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  307  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  366

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPMI  ++L+S RLLGD S SF  NCV 
Sbjct  367  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMIIKNVLNSARLLGDVSVSFTDNCVV  426

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  427  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSEQ  486

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  487  FDQWVKPKDMLGP  499



>gb|EMT27288.1| Fumarate hydratase 2, chloroplastic [Aegilops tauschii]
Length=494

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGELILPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHVG+T+GGSNGHFELNV+KPMIA  LL S+RLLGDAS SFEKNCVR
Sbjct  360  CEALTMVCAQVMGNHVGVTIGGSNGHFELNVYKPMIAAGLLRSLRLLGDASVSFEKNCVR  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+AN +RIS+LLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LKE+A +L VLT +E
Sbjct  420  GIEANHKRISQLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKESALSLGVLTEKE  479

Query  279  FDQLVVPEKMIGPTD  235
            F +LVVPEKMIGP+D
Sbjct  480  FHELVVPEKMIGPSD  494



>ref|XP_007058980.1| PREDICTED: fumarate hydratase, mitochondrial-like [Chelonia mydas]
Length=488

 Score =   310 bits (794),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  295  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  354

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPMI  ++L+S RLLGD S SF  NCV 
Sbjct  355  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMIIKNVLNSARLLGDVSVSFTDNCVV  414

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  415  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSEQ  474

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  475  FDQWVKPKDMLGP  487



>gb|KFZ47909.1| hypothetical protein N321_01653, partial [Caprimulgus carolinensis]
Length=267

 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  74   AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  133

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  134  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  193

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  194  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  253

Query  279  FDQLVVPEKMIGP  241
            FDQ V P  M+GP
Sbjct  254  FDQWVKPTDMLGP  266



>ref|XP_006638882.1| PREDICTED: fumarate hydratase, mitochondrial-like [Lepisosteus 
oculatus]
Length=471

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  278  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  337

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +T+GGSNGHFELNVFKPM+  ++L+S +LLGDAS SF +NCV 
Sbjct  338  CEAMTMVAAQVMGNHVAVTIGGSNGHFELNVFKPMMIKNMLNSAKLLGDASVSFTENCVV  397

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AAA+AK AHKEG++LKEAA  L  L++E+
Sbjct  398  GIQANTERINKLMSESLMLVTALNPHIGYDKAAAIAKTAHKEGSTLKEAAIKLGYLSSEQ  457

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  458  FDQWVKPQDMLGP  470



>ref|XP_003557953.1| PREDICTED: fumarate hydratase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=494

 Score =   310 bits (794),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVESSG +NTI+ASLMKIANDIR LGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDAFVESSGAVNTISASLMKIANDIRLLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHVG+T+GGSNGHFELNVFKPMIA  LL S+RLLGDAS SFEKNCVR
Sbjct  360  CEALTMVCAQVMGNHVGVTIGGSNGHFELNVFKPMIAAGLLRSLRLLGDASVSFEKNCVR  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+AN +RIS+LLHESLMLVT LNPKIGYDNAAAVAKKAHKEGT+LKEAA +L VLT +E
Sbjct  420  GIEANHKRISQLLHESLMLVTSLNPKIGYDNAAAVAKKAHKEGTTLKEAALSLGVLTEKE  479

Query  279  FDQLVVPEKMIGPTD  235
            F +LVVPEKMIGP+D
Sbjct  480  FHELVVPEKMIGPSD  494



>ref|XP_005296563.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Chrysemys 
picta bellii]
Length=510

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPMI  ++L+S RLLGD S SF  NCV 
Sbjct  377  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMIIKNVLNSARLLGDVSVSFTDNCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSEQ  496

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  497  FDQWVKPKDMLGP  509



>ref|XP_003800133.1| PREDICTED: fumarate hydratase, mitochondrial [Otolemur garnettii]
Length=463

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  270  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  329

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  330  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  389

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  390  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  449

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  450  FDQWVKPKDMLGP  462



>ref|NP_851166.1| fumarate hydratase 2 [Arabidopsis thaliana]
 dbj|BAH19582.1| AT5G50950 [Arabidopsis thaliana]
 gb|AED96014.1| fumarate hydratase 2 [Arabidopsis thaliana]
Length=510

 Score =   309 bits (792),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE+SG LNTIA SLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  305  AHDACVETSGSLNTIATSLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  364

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNHV +T+GGSNGHFELNVFKP+IA++LLHS+RL+ DASASFEKNCVR
Sbjct  365  CEALTMVCAQVMGNHVAVTIGGSNGHFELNVFKPVIASALLHSIRLIADASASFEKNCVR  424

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLK  319
            GI+ANRERISKLLHESLMLVT LNPKIGYDNAAAVAK+AHKEG +LK
Sbjct  425  GIEANRERISKLLHESLMLVTSLNPKIGYDNAAAVAKRAHKEGCTLK  471



>ref|XP_006993784.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Peromyscus 
maniculatus bairdii]
Length=466

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  333  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK+G++LKE A  L  LTAE+
Sbjct  393  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKKGSTLKETAIELGYLTAEQ  452

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  453  FDEWVKPKDMLGP  465



>ref|XP_007638787.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Cricetulus 
griseus]
 ref|XP_007637781.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Cricetulus 
griseus]
Length=434

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  241  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  300

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  301  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  360

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK+G++LKE A  L  LTAE+
Sbjct  361  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKKGSTLKETAIELGYLTAEQ  420

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  421  FDEWVKPKDMLGP  433



>ref|XP_006142426.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Tupaia 
chinensis]
Length=422

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  229  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  288

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  289  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  348

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  349  GIQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGFLTAEQ  408

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  409  FDEWVKPKDMLGP  421



>ref|XP_004653497.1| PREDICTED: fumarate hydratase, mitochondrial [Jaculus jaculus]
Length=465

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  272  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  331

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  332  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  391

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK+G++LKE A  L  LTAE+
Sbjct  392  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKKGSTLKETAMELGYLTAEQ  451

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  452  FDEWVKPKDMLGP  464



>gb|EAW70093.1| fumarate hydratase, isoform CRA_d [Homo sapiens]
Length=434

 Score =   306 bits (785),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  241  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  300

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  301  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  360

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  361  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  420

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  421  FDEWVKPKDMLGP  433



>ref|XP_010170425.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Caprimulgus 
carolinensis]
Length=291

 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  98   AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  157

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  158  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  217

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  218  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  277

Query  279  FDQLVVPEKMIGP  241
            FDQ V P  M+GP
Sbjct  278  FDQWVKPTDMLGP  290



>gb|AAY59704.1| fumarate hydratase [Cricetulus griseus]
Length=467

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  274  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  334  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK+G++LKE A  L  LTAE+
Sbjct  394  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKKGSTLKETAIELGYLTAEQ  453

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  454  FDEWVKPKDMLGP  466



>gb|KFU98791.1| hypothetical protein N339_03040, partial [Pterocles gutturalis]
Length=466

 Score =   307 bits (787),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  393  GIQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSEQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_004895655.1| PREDICTED: fumarate hydratase, mitochondrial isoform X3 [Heterocephalus 
glaber]
 ref|XP_004895656.1| PREDICTED: fumarate hydratase, mitochondrial isoform X4 [Heterocephalus 
glaber]
 ref|XP_004853526.1| PREDICTED: fumarate hydratase, mitochondrial isoform X3 [Heterocephalus 
glaber]
Length=435

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  242  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  301

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  302  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  361

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  362  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  421

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  422  FDEWVKPKDMLGP  434



>ref|XP_004626976.1| PREDICTED: fumarate hydratase, mitochondrial [Octodon degus]
Length=437

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  244  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  303

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  304  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  363

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  364  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  423

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  424  FDEWVKPKDMLGP  436



>ref|XP_010075048.1| PREDICTED: fumarate hydratase, mitochondrial [Pterocles gutturalis]
Length=476

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  283  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  342

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  343  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  402

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  403  GIQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSEQ  462

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  463  FDQWVKPKDMLGP  475



>gb|EFX85065.1| hypothetical protein DAPPUDRAFT_46417 [Daphnia pulex]
Length=467

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            +HDA V+ SG LNT+A SLMKIANDIRFL SGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  274  SHDALVQMSGSLNTVAVSLMKIANDIRFLASGPRCGLGELSLPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEAITMV AQV+GNHV +T+GGSNGHFELNVFKP+I +++L S+RLL D+S +F KNCV 
Sbjct  334  CEAITMVAAQVMGNHVAVTIGGSNGHFELNVFKPLIVSNVLRSIRLLADSSNAFTKNCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+ANR+RI+KLLHESLMLVT LNP IGYD AA +AK AHKEG++LKE A  L  LT E+
Sbjct  394  GIEANRDRINKLLHESLMLVTALNPHIGYDKAAKIAKTAHKEGSTLKETALKLGYLTEEQ  453

Query  279  FDQLVVPEKMIGP  241
            F+Q V PE M+GP
Sbjct  454  FNQWVKPEDMLGP  466



>ref|XP_010811426.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Bos 
taurus]
Length=434

 Score =   306 bits (783),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  241  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  300

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  301  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  360

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERISKL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  361  GIQANTERISKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  420

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  421  FDEWVKPKDMLGP  433



>ref|XP_003893750.1| PREDICTED: fumarate hydratase, mitochondrial [Papio anubis]
Length=510

 Score =   308 bits (789),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            G+QAN ERISKL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GVQANTERISKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_010811425.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Bos 
taurus]
Length=436

 Score =   306 bits (783),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  243  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  302

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  303  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  362

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERISKL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  363  GIQANTERISKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  422

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  423  FDEWVKPKDMLGP  435



>pdb|3E04|A Chain A, Crystal Structure Of Human Fumarate Hydratase
 pdb|3E04|B Chain B, Crystal Structure Of Human Fumarate Hydratase
 pdb|3E04|C Chain C, Crystal Structure Of Human Fumarate Hydratase
 pdb|3E04|D Chain D, Crystal Structure Of Human Fumarate Hydratase
Length=490

 Score =   307 bits (786),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  297  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  356

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  357  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  416

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  417  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  476

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  477  FDEWVKPKDMLGP  489



>ref|XP_010392198.1| PREDICTED: fumarate hydratase, mitochondrial [Corvus cornix cornix]
Length=467

 Score =   306 bits (785),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  274  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  334  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN++RI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  394  GIQANKDRINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  453

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  454  FDQWVKPKDMLGP  466



>ref|XP_003499892.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Cricetulus 
griseus]
 ref|XP_007637780.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Cricetulus 
griseus]
 gb|EGW05762.1| Fumarate hydratase, mitochondrial [Cricetulus griseus]
 gb|ERE73303.1| fumarate hydratase [Cricetulus griseus]
Length=507

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  314  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  373

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  374  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  433

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK+G++LKE A  L  LTAE+
Sbjct  434  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKKGSTLKETAIELGYLTAEQ  493

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  494  FDEWVKPKDMLGP  506



>ref|XP_008847403.1| PREDICTED: fumarate hydratase, mitochondrial [Nannospalax galili]
Length=508

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  315  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  374

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  375  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  434

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK+G++LKE A  L  LTAE+
Sbjct  435  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKKGSNLKETAIELGYLTAEQ  494

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  495  FDEWVKPKDMLGP  507



>gb|EOA97454.1| Fumarate hydratase, mitochondrial, partial [Anas platyrhynchos]
Length=468

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  275  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  334

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  335  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  394

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  395  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAVKLGFLTSEQ  454

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  455  FDQWVKPKDMLGP  467



>ref|XP_005368585.1| PREDICTED: fumarate hydratase, mitochondrial [Microtus ochrogaster]
Length=507

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  314  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  373

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  374  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  433

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK+G++LKE A  L  LTAE+
Sbjct  434  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKKGSTLKETAVELGYLTAEQ  493

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  494  FDEWVKPKDMLGP  506



>ref|XP_009675029.1| PREDICTED: fumarate hydratase, mitochondrial [Struthio camelus 
australis]
 ref|XP_009675030.1| PREDICTED: fumarate hydratase, mitochondrial [Struthio camelus 
australis]
Length=434

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  241  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  300

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  301  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  360

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RISKL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  361  GIQANTDRISKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  420

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  421  FDQWVKPKDMLGP  433



>gb|KFW11876.1| hypothetical protein N326_13222, partial [Eurypyga helias]
Length=466

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVA  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_004895654.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Heterocephalus 
glaber]
 ref|XP_004853525.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Heterocephalus 
glaber]
Length=473

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  280  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  339

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  340  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  399

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  400  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  459

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  460  FDEWVKPKDMLGP  472



>gb|EHH50891.1| hypothetical protein EGM_01787 [Macaca fascicularis]
Length=510

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVEPSGFMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>gb|KFV82233.1| hypothetical protein N308_03081, partial [Struthio camelus australis]
Length=466

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RISKL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRISKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_008524760.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Equus 
przewalskii]
Length=275

 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  86   AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  145

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDA+ SF +NCV 
Sbjct  146  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDAAVSFTENCVV  205

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERISKL+ ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  206  GIQANTERISKLMSESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAVELGYLTAEQ  265

Query  279  FDQLVVPEKM  250
            FD+ V P+ M
Sbjct  266  FDEWVKPKDM  275



>gb|KFZ60559.1| hypothetical protein N338_09291, partial [Podiceps cristatus]
Length=466

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSEQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_007988126.1| PREDICTED: fumarate hydratase, mitochondrial [Chlorocebus sabaeus]
Length=510

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>sp|Q60HF9.1|FUMH_MACFA RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Macaca fascicularis]
 dbj|BAD51956.1| fumarate hydratase [Macaca fascicularis]
Length=510

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_005078228.1| PREDICTED: fumarate hydratase, mitochondrial [Mesocricetus auratus]
Length=507

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  314  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  373

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  374  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  433

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK+G++LKE A  L  LTAE+
Sbjct  434  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKKGSTLKETAIELGYLTAEQ  493

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  494  FDEWVKPKDMLGP  506



>ref|XP_004028710.1| PREDICTED: fumarate hydratase, mitochondrial [Gorilla gorilla 
gorilla]
Length=510

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>gb|KFO70082.1| hypothetical protein N303_02489, partial [Cuculus canorus]
Length=466

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_006277022.1| PREDICTED: fumarate hydratase, mitochondrial-like [Alligator 
mississippiensis]
Length=506

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  313  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  372

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +T+GGSNGHFELNVFKPMI  ++L+S RLLGD   SF  NCV 
Sbjct  373  CEAVTMVAAQVMGNHVAVTIGGSNGHFELNVFKPMIIKNVLNSARLLGDVCISFTDNCVV  432

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  433  GIQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSEQ  492

Query  279  FDQLVVPEKMIGP  241
            FDQ V P +M+GP
Sbjct  493  FDQWVKPTEMLGP  505



>gb|EAW70090.1| fumarate hydratase, isoform CRA_a [Homo sapiens]
Length=493

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  360  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  420  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  479

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  480  FDEWVKPKDMLGP  492



>ref|XP_004895653.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Heterocephalus 
glaber]
 ref|XP_004853524.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Heterocephalus 
glaber]
 gb|EHB09990.1| Fumarate hydratase, mitochondrial [Heterocephalus glaber]
Length=508

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  315  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  374

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  375  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  434

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  435  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  494

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  495  FDEWVKPKDMLGP  507



>ref|XP_002760919.1| PREDICTED: fumarate hydratase, mitochondrial [Callithrix jacchus]
Length=510

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_009508750.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Phalacrocorax 
carbo]
 gb|KFW97120.1| hypothetical protein N336_11437, partial [Phalacrocorax carbo]
Length=466

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LTA++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAVKLGFLTADQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_010182284.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Mesitornis 
unicolor]
 gb|KFQ35201.1| hypothetical protein N332_12002, partial [Mesitornis unicolor]
Length=466

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_010382999.1| PREDICTED: fumarate hydratase, mitochondrial [Rhinopithecus roxellana]
Length=510

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVL  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_004450320.1| PREDICTED: fumarate hydratase, mitochondrial isoform 2 [Dasypus 
novemcinctus]
Length=390

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIAND RFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  197  AHDALVELSGAMNTAACSLMKIANDTRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  256

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGD S SF +NCV 
Sbjct  257  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIRNVLHSARLLGDVSVSFTENCVM  316

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  317  GIQANTERINKLMNESLMLVTALNPHIGYDKAAQIAKTAHKSGSTLKETAIELGYLTAEQ  376

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  377  FDEWVKPKDMLGP  389



>ref|XP_005024942.1| PREDICTED: fumarate hydratase, mitochondrial-like [Anas platyrhynchos]
Length=482

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  289  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  348

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  349  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  408

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  409  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAVKLGFLTSEQ  468

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  469  FDQWVKPKDMLGP  481



>ref|XP_003267364.1| PREDICTED: fumarate hydratase, mitochondrial [Nomascus leucogenys]
Length=510

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIKLGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_009561479.1| PREDICTED: fumarate hydratase, mitochondrial [Cuculus canorus]
Length=476

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  283  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  342

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  343  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  402

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  403  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  462

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  463  FDQWVKPKDMLGP  475



>ref|XP_003824573.1| PREDICTED: fumarate hydratase, mitochondrial [Pan paniscus]
Length=510

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIKLGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|NP_001267172.1| fumarate hydratase, mitochondrial [Pan troglodytes]
 dbj|BAK62931.1| fumarate hydratase, mitochondrial precursor [Pan troglodytes]
Length=510

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGSMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIKLGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_005969001.1| PREDICTED: fumarate hydratase, mitochondrial [Pantholops hodgsonii]
Length=510

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERISKL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  437  GIQANTERISKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_003474362.1| PREDICTED: fumarate hydratase, mitochondrial [Cavia porcellus]
Length=508

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  315  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  374

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +T+GGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  375  CEAMTMVAAQVMGNHVAVTIGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  434

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  435  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAVELGYLTAEQ  494

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  495  FDEWVKPKDMLGP  507



>ref|XP_009439959.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Pan 
troglodytes]
Length=510

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIKLGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|NP_000134.2| fumarate hydratase, mitochondrial [Homo sapiens]
 sp|P07954.3|FUMH_HUMAN RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Homo sapiens]
 gb|AAB66354.1| fumarase precursor [Homo sapiens]
 gb|AAD00071.1| fumarase [Homo sapiens]
 gb|AAH03108.1| Fumarate hydratase [Homo sapiens]
 gb|AAH17444.1| Fumarate hydratase [Homo sapiens]
 gb|AAP88841.1| fumarate hydratase [Homo sapiens]
 gb|AAX32244.1| fumarate hydratase [synthetic construct]
 gb|AAX32245.1| fumarate hydratase [synthetic construct]
 gb|EAW70092.1| fumarate hydratase, isoform CRA_c [Homo sapiens]
 gb|ABW03809.1| fumarate hydratase [synthetic construct]
 dbj|BAG35325.1| unnamed protein product [Homo sapiens]
 dbj|BAJ20674.1| fumarate hydratase [synthetic construct]
 gb|AIC48761.1| FH, partial [synthetic construct]
Length=510

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>gb|EAW70091.1| fumarate hydratase, isoform CRA_b [Homo sapiens]
Length=511

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  318  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  377

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  378  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  437

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  438  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  497

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  498  FDEWVKPKDMLGP  510



>gb|AAH06048.1| Fumarate hydratase 1 [Mus musculus]
Length=507

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  314  AHDALVELSGAMNTAACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  373

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  374  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  433

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  434  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  493

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  494  FDEWVKPKDMLGP  506



>gb|KFW87389.1| hypothetical protein N305_02194, partial [Manacus vitellinus]
Length=467

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  274  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  334  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  394  GIQANTDRINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  453

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  454  FDQWVKPKDMLGP  466



>gb|KFO62089.1| hypothetical protein N302_14449, partial [Corvus brachyrhynchos]
Length=467

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  274  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  334  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  394  GIQANTDRINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  453

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  454  FDQWVKPKDMLGP  466



>ref|NP_001125540.1| fumarate hydratase, mitochondrial [Pongo abelii]
 emb|CAH90940.1| hypothetical protein [Pongo abelii]
Length=510

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_005041811.1| PREDICTED: fumarate hydratase, mitochondrial-like isoform X2 
[Ficedula albicollis]
Length=467

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  274  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  334  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  394  GIQANTDRINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  453

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  454  FDQWVKPKDMLGP  466



>ref|XP_010640964.1| PREDICTED: fumarate hydratase, mitochondrial [Fukomys damarensis]
 gb|KFO25479.1| Fumarate hydratase, mitochondrial [Fukomys damarensis]
Length=508

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  315  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  374

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  375  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  434

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTA++
Sbjct  435  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAQQ  494

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  495  FDEWVKPKDMLGP  507



>ref|XP_009572884.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Fulmarus 
glacialis]
 gb|KFW02045.1| hypothetical protein N327_00663, partial [Fulmarus glacialis]
Length=466

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVA  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAVKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_002717380.1| PREDICTED: fumarate hydratase, mitochondrial [Oryctolagus cuniculus]
 ref|XP_002722110.1| PREDICTED: fumarate hydratase, mitochondrial [Oryctolagus cuniculus]
Length=508

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIAND+RFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  315  AHDALVELSGAMNTTACSLMKIANDVRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  374

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  375  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVL  434

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  435  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  494

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  495  FDEWVKPKDMLGP  507



>ref|XP_003199715.2| PREDICTED: fumarate hydratase, mitochondrial-like [Danio rerio]
Length=332

 Score =   300 bits (769),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG LNT+A S+MKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  139  AHDALVELSGALNTVAVSMMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  198

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHVG+TVGGSNGHFELNVFKPMI  ++L+S RLLGDAS SF  NCV 
Sbjct  199  CEAMTMVAAQVMGNHVGVTVGGSNGHFELNVFKPMIIKNVLNSARLLGDASVSFTNNCVV  258

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+AN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHK+G++LKEAA  L  L  ++
Sbjct  259  GIEANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKDGSTLKEAALKLGFLNEQQ  318

Query  279  FDQLVVPEKMIGP  241
            F++ V P  M+GP
Sbjct  319  FEEWVRPHDMLGP  331



>ref|NP_058701.2| fumarate hydratase, mitochondrial precursor [Rattus norvegicus]
 gb|AAH87598.1| Fumarate hydratase 1 [Rattus norvegicus]
 gb|EDL94769.1| fumarate hydratase 1 [Rattus norvegicus]
Length=507

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  314  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  373

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  374  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  433

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  434  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  493

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  494  FDEWVKPKDMLGP  506



>gb|KFM08161.1| hypothetical protein AS27_00695, partial [Aptenodytes forsteri]
Length=466

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P++M+GP
Sbjct  453  FDQWVKPKEMLGP  465



>ref|XP_010157072.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Eurypyga 
helias]
Length=490

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  297  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  356

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  357  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVA  416

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  417  GIQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  476

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  477  FDQWVKPKDMLGP  489



>ref|XP_010581870.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Haliaeetus 
leucocephalus]
 ref|XP_010581872.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Haliaeetus 
leucocephalus]
Length=434

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  241  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  300

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  301  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  360

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  361  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAALKLGFLTSDQ  420

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  421  FDQWVKPKDMLGP  433



>ref|XP_005041810.1| PREDICTED: fumarate hydratase, mitochondrial-like isoform X1 
[Ficedula albicollis]
Length=477

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  284  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  343

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  344  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  403

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  404  GIQANTDRINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  463

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  464  FDQWVKPKDMLGP  476



>emb|CDQ03094.1| Protein BM-FUM-1, partial [Brugia malayi]
Length=486

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE  G LNTIAASLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  293  AHDAMVEVHGSLNTIAASLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  352

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV GN V ++VGGSNGHFELNVFKPMI  ++L S RL+ DAS SF  NCV 
Sbjct  353  CEAVTMVAAQVFGNQVAVSVGGSNGHFELNVFKPMIVRNVLQSTRLIADASVSFTVNCVD  412

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+AN+E I+K+L ESLMLVT LNP IGYDNAA +AK AHK GT+LKE A  L +LTAE+
Sbjct  413  GIKANKENIAKILRESLMLVTALNPHIGYDNAAKIAKTAHKNGTTLKEEAIKLGILTAEQ  472

Query  279  FDQLVVPEKMIGP  241
            FD+ V PEKM+ P
Sbjct  473  FDEWVRPEKMLAP  485



>ref|NP_034339.2| fumarate hydratase, mitochondrial precursor [Mus musculus]
 sp|P97807.3|FUMH_MOUSE RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
AltName: Full=EF-3; Flags: Precursor [Mus musculus]
 dbj|BAE27597.1| unnamed protein product [Mus musculus]
 gb|EDL13210.1| fumarate hydratase 1 [Mus musculus]
Length=507

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  314  AHDALVELSGAMNTAACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  373

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF  NCV 
Sbjct  374  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTDNCVV  433

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  434  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  493

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  494  FDEWVKPKDMLGP  506



>ref|XP_011378308.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Pteropus 
vampyrus]
Length=434

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  241  AHDALVELSGAMNTSACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  300

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  301  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  360

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  361  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  420

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  421  FDEWVKPKDMLGP  433



>ref|XP_009074698.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Acanthisitta 
chloris]
Length=466

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>gb|KFP18053.1| hypothetical protein Z169_14841, partial [Egretta garzetta]
Length=466

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVA  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAALKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_006050829.1| PREDICTED: fumarate hydratase, mitochondrial [Bubalus bubalis]
 ref|XP_010834988.1| PREDICTED: fumarate hydratase, mitochondrial [Bison bison bison]
Length=510

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERISKL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  437  GIQANTERISKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|NP_001155363.1| fumarate hydratase, mitochondrial [Ovis aries]
 gb|ACR55776.1| fumarate hydratase [Ovis aries]
Length=510

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERISKL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  437  GIQANTERISKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|NP_001069271.1| fumarate hydratase, mitochondrial [Bos taurus]
 gb|AAI18451.1| Fumarate hydratase [Bos taurus]
 tpg|DAA21383.1| TPA: fumarate hydratase, mitochondrial [Bos taurus]
Length=510

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERISKL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  437  GIQANTERISKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_005326633.1| PREDICTED: fumarate hydratase, mitochondrial [Ictidomys tridecemlineatus]
Length=508

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  315  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  374

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  375  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  434

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL++ESLMLVT LNP IGYD AA +AK AHK+G++LKE A  L  LTAE+
Sbjct  435  GIQANTDRINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKKGSTLKETAIELGYLTAEQ  494

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  495  FDEWVKPKDMLGP  507



>ref|XP_009957277.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Leptosomus 
discolor]
 gb|KFQ16015.1| hypothetical protein N330_14129, partial [Leptosomus discolor]
Length=466

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_010309788.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Balearica 
regulorum gibbericeps]
 gb|KFO06525.1| hypothetical protein N312_01122, partial [Balearica regulorum 
gibbericeps]
Length=466

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>gb|KFW71651.1| hypothetical protein AS28_14072, partial [Pygoscelis adeliae]
Length=466

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAALKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P++M+GP
Sbjct  453  FDQWVKPKEMLGP  465



>ref|XP_010581869.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Haliaeetus 
leucocephalus]
Length=467

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  274  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  334  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  394  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAALKLGFLTSDQ  453

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  454  FDQWVKPKDMLGP  466



>gb|KFP81796.1| hypothetical protein N310_10621, partial [Acanthisitta chloris]
Length=467

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  274  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  334  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  394  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  453

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  454  FDQWVKPKDMLGP  466



>ref|XP_006142425.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Tupaia 
chinensis]
 gb|ELW70929.1| Fumarate hydratase, mitochondrial [Tupaia chinensis]
Length=508

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  315  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  374

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  375  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  434

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL+ ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  435  GIQANTERINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGFLTAEQ  494

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  495  FDEWVKPKDMLGP  507



>ref|XP_010133173.1| PREDICTED: fumarate hydratase, mitochondrial [Buceros rhinoceros 
silvestris]
Length=472

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  279  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  338

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  339  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  398

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  399  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAVKLGFLTSDQ  458

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  459  FDQWVKPKDMLGP  471



>gb|KGL93621.1| hypothetical protein N301_03833, partial [Charadrius vociferus]
Length=466

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_010295483.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Phaethon 
lepturus]
 gb|KFQ65379.1| hypothetical protein N335_01053, partial [Phaethon lepturus]
Length=466

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_010117491.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Chlamydotis 
macqueenii]
 gb|KFP41368.1| hypothetical protein N324_08945, partial [Chlamydotis macqueenii]
Length=466

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAALKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>gb|KFO88947.1| hypothetical protein N320_10832, partial [Buceros rhinoceros 
silvestris]
Length=466

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAVKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_003935387.1| PREDICTED: fumarate hydratase, mitochondrial [Saimiri boliviensis 
boliviensis]
Length=510

 Score =   306 bits (783),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG  NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGATNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>gb|KFV66685.1| hypothetical protein N307_11320, partial [Picoides pubescens]
Length=466

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_005419421.1| PREDICTED: fumarate hydratase, mitochondrial-like [Geospiza fortis]
Length=529

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  336  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  395

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  396  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  455

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  456  GIQANTDRINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSEQ  515

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  516  FDQWVKPKDMLGP  528



>gb|KFQ04696.1| hypothetical protein N329_04765, partial [Haliaeetus albicilla]
 gb|KFQ97614.1| hypothetical protein Y956_03361, partial [Nipponia nippon]
Length=466

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAALKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_001386687.1| fumarase [Scheffersomyces stipitis CBS 6054]
 gb|ABN68658.1| fumarase [Scheffersomyces stipitis CBS 6054]
Length=463

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDAFVE+SG LNT+A SL KIAND+R+LGSGPRCG GEL LPENEPGSSIMPGKVNPTQ
Sbjct  269  AHDAFVETSGALNTVAVSLFKIANDVRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ  328

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMVCAQV+GNH  +T  G++G FELNVFKP++A +LL S+RLLGDA+ SF  NCV 
Sbjct  329  CEAMTMVCAQVMGNHTTITFSGASGQFELNVFKPVMAYNLLTSIRLLGDAAKSFRINCVE  388

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI AN+E+I+K+L+ESLMLVT LNPKIGYDNA+ VAK AHK+G +LKE+   L +LT+EE
Sbjct  389  GIVANKEKIAKVLNESLMLVTALNPKIGYDNASKVAKNAHKKGITLKESCLELNMLTSEE  448

Query  279  FDQLVVPEKMIGPTD  235
            FDQ V PE MIGP D
Sbjct  449  FDQWVRPENMIGPKD  463



>ref|XP_005153635.1| PREDICTED: fumarate hydratase, mitochondrial-like [Melopsittacus 
undulatus]
Length=479

 Score =   305 bits (780),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  286  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  345

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  346  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  405

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  406  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  465

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  466  FDQWVKPKDMLGP  478



>gb|EFO24875.2| fumarate hydratase [Loa loa]
Length=504

 Score =   305 bits (782),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE  G LNT AASLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  311  AHDAMVEVHGALNTTAASLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  370

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV GN V +TVGGSNGHFELNVFKPMI  ++L S RL+ DAS SF  NCV 
Sbjct  371  CEAVTMVAAQVFGNQVAVTVGGSNGHFELNVFKPMIVRNVLQSTRLIADASVSFAVNCVD  430

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+AN+E I+K+L ESLMLVT LNP IGYDNAA +AK AHK GT+LKE A  L +LTAE+
Sbjct  431  GIKANKENIAKILRESLMLVTALNPHIGYDNAAKIAKTAHKNGTTLKEEAVKLGILTAEQ  490

Query  279  FDQLVVPEKMIGP  241
            FD+ V PEKM+ P
Sbjct  491  FDEWVRPEKMLAP  503



>ref|XP_006757714.1| PREDICTED: fumarate hydratase, mitochondrial [Myotis davidii]
Length=434

 Score =   303 bits (776),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  241  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  300

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDA+ SF +NCV 
Sbjct  301  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDAAVSFTENCVV  360

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN++RI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  361  GIQANKDRIAKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  420

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  421  FDEWVKPKDMLGP  433



>gb|KFP26128.1| hypothetical protein N325_10917, partial [Colius striatus]
Length=467

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  274  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  334  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  394  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  453

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  454  FDQWVKPKDMLGP  466



>gb|KGL79172.1| hypothetical protein N309_10896, partial [Tinamus guttatus]
Length=466

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_008937257.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Merops 
nubicus]
 gb|KFQ18343.1| hypothetical protein N331_10611, partial [Merops nubicus]
Length=466

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_005806444.1| PREDICTED: fumarate hydratase, mitochondrial-like [Xiphophorus 
maculatus]
Length=466

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG LNT+A S+MK+ANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGALNTVAVSMMKVANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGDAS SF  NCV 
Sbjct  333  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMVKNVLNSARLLGDASVSFTNNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK+G++LK  A  L  LT E+
Sbjct  393  GIQANTERINKLMNESLMLVTALNPHIGYDKAATIAKTAHKKGSTLKAVAVELGYLTEEQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P +M+GP
Sbjct  453  FDQWVKPSEMLGP  465



>gb|KFO98944.1| hypothetical protein N300_02760, partial [Calypte anna]
Length=468

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  275  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  334

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NC+ 
Sbjct  335  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCIV  394

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  395  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAVKLGFLTSDQ  454

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  455  FDQWVKPKDMLGP  467



>ref|XP_009809639.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Gavia 
stellata]
 gb|KFV39801.1| hypothetical protein N328_10765, partial [Gavia stellata]
Length=466

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NC+ 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCIV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAVKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>gb|KFV39301.1| hypothetical protein N341_12919, partial [Tyto alba]
Length=467

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  274  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  334  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCISFTDNCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  394  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  453

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  454  FDQWVKPKDMLGP  466



>ref|XP_005510051.1| PREDICTED: fumarate hydratase, mitochondrial-like [Columba livia]
Length=474

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  281  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  340

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  341  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  400

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  401  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  460

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  461  FDQWVKPKDMLGP  473



>ref|NP_001272104.1| fumarate hydratase, mitochondrial [Macaca fascicularis]
 dbj|BAE89793.1| unnamed protein product [Macaca fascicularis]
Length=510

 Score =   305 bits (782),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGK NPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKANPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>gb|EMC82421.1| Fumarate hydratase, mitochondrial, partial [Columba livia]
Length=466

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>ref|XP_008635756.1| PREDICTED: fumarate hydratase, mitochondrial [Corvus brachyrhynchos]
Length=492

 Score =   305 bits (780),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  299  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  358

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  359  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  418

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  419  GIQANTDRINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  478

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  479  FDQWVKPKDMLGP  491



>ref|NP_001006382.1| fumarate hydratase, mitochondrial [Gallus gallus]
 emb|CAG31462.1| hypothetical protein RCJMB04_6k20 [Gallus gallus]
Length=507

 Score =   305 bits (781),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  314  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  373

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  374  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  433

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+E+
Sbjct  434  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSEQ  493

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  494  FDQWVKPKDMLGP  506



>ref|XP_009278489.1| PREDICTED: fumarate hydratase, mitochondrial [Aptenodytes forsteri]
Length=489

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  296  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  355

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  356  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  415

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  416  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  475

Query  279  FDQLVVPEKMIGP  241
            FDQ V P++M+GP
Sbjct  476  FDQWVKPKEMLGP  488



>ref|XP_004711822.1| PREDICTED: fumarate hydratase, mitochondrial-like [Echinops telfairi]
Length=503

 Score =   305 bits (781),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  310  AHDALVELSGAMNTAACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  369

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +T+GGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  370  CEALTMVAAQVMGNHVAVTIGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  429

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  430  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  489

Query  279  FDQLVVPEKMIGP  241
            FD+ V P  M+GP
Sbjct  490  FDEWVKPTDMLGP  502



>ref|XP_001900957.1| fumarase [Brugia malayi]
Length=504

 Score =   305 bits (781),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE  G LNTIAASLMKIANDIRFLGSGPRCGLGEL LPENEPGSSIMPGKVNPTQ
Sbjct  311  AHDAMVEVHGSLNTIAASLMKIANDIRFLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQ  370

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV GN V ++VGGSNGHFELNVFKPMI  ++L S RL+ DAS SF  NCV 
Sbjct  371  CEAVTMVAAQVFGNQVAVSVGGSNGHFELNVFKPMIVRNVLQSTRLIADASVSFTVNCVD  430

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GI+AN+E I+K+L ESLMLVT LNP IGYDNAA +AK AHK GT+LKE A  L +LTAE+
Sbjct  431  GIKANKENIAKILRESLMLVTALNPHIGYDNAAKIAKTAHKNGTTLKEEAIKLGILTAEQ  490

Query  279  FDQLVVPEKMIGP  241
            FD+ V PEKM+ P
Sbjct  491  FDEWVRPEKMLAP  503



>ref|XP_006185613.1| PREDICTED: fumarate hydratase, mitochondrial [Camelus ferus]
 ref|XP_010971696.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Camelus 
bactrianus]
 ref|XP_010990375.1| PREDICTED: fumarate hydratase, mitochondrial isoform X1 [Camelus 
dromedarius]
Length=510

 Score =   305 bits (782),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  437  GIQANTERIDKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_008489569.1| PREDICTED: fumarate hydratase, mitochondrial [Calypte anna]
Length=474

 Score =   304 bits (779),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  281  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  340

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NC+ 
Sbjct  341  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCIV  400

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  401  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAVKLGFLTSDQ  460

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  461  FDQWVKPKDMLGP  473



>ref|XP_006198857.1| PREDICTED: fumarate hydratase, mitochondrial [Vicugna pacos]
Length=510

 Score =   305 bits (781),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  437  GIQANTERIDKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_001094968.1| PREDICTED: fumarate hydratase, mitochondrial isoform 2 [Macaca 
mulatta]
Length=510

 Score =   305 bits (781),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  317  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  376

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGS+GHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  377  CEAMTMVAAQVMGNHVAVTVGGSSGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  436

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  437  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  496

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  497  FDEWVKPKDMLGP  509



>ref|XP_010202049.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Colius 
striatus]
Length=466

 Score =   304 bits (778),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  333  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  393  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  452

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  453  FDQWVKPKDMLGP  465



>sp|P10173.1|FUMH_PIG RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase 
[Sus scrofa]
Length=466

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  273  AHDALVEHSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  332

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDA+ SF +NCV 
Sbjct  333  CEALTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDAAVSFTENCVV  392

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  393  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAVELGYLTAEQ  452

Query  279  FDQLVVPEKMIGP  241
            FD+ V P  M+GP
Sbjct  453  FDEWVKPRDMLGP  465



>gb|EFB22120.1| hypothetical protein PANDA_006972 [Ailuropoda melanoleuca]
Length=467

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  274  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  333

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDA+ SF +NCV 
Sbjct  334  CEALTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDAAVSFTENCVV  393

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  394  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAVELGYLTAEQ  453

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  454  FDEWVRPKDMLGP  466



>ref|XP_008405153.1| PREDICTED: fumarate hydratase, mitochondrial [Poecilia reticulata]
Length=499

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG LNT+A S+MK+ANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  306  AHDALVELSGALNTVAVSMMKVANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  365

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGDAS SF  NCV 
Sbjct  366  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMVKNVLNSARLLGDASVSFTNNCVV  425

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AAA+AK AHK+G++LK  A  L  LT E+
Sbjct  426  GIQANTERINKLMNESLMLVTALNPHIGYDKAAAIAKTAHKKGSTLKAVAVELGYLTEEQ  485

Query  279  FDQLVVPEKMIGP  241
            FDQ V P +M+GP
Sbjct  486  FDQWVKPSEMLGP  498



>ref|XP_009962196.1| PREDICTED: fumarate hydratase, mitochondrial, partial [Tyto alba]
Length=476

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  283  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  342

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  343  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCISFTDNCVV  402

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  403  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  462

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  463  FDQWVKPKDMLGP  475



>ref|XP_009328750.1| PREDICTED: fumarate hydratase, mitochondrial [Pygoscelis adeliae]
Length=494

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  361  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  421  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAALKLGFLTSDQ  480

Query  279  FDQLVVPEKMIGP  241
            FDQ V P++M+GP
Sbjct  481  FDQWVKPKEMLGP  493



>ref|XP_008929917.1| PREDICTED: fumarate hydratase, mitochondrial [Manacus vitellinus]
Length=493

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  300  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  359

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  360  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  419

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  420  GIQANTDRINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  479

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  480  FDQWVKPKDMLGP  492



>ref|XP_537215.1| PREDICTED: fumarate hydratase, mitochondrial isoform 1 [Canis 
lupus familiaris]
Length=508

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  315  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  374

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDA+ SF +NCV 
Sbjct  375  CEALTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDAAVSFTENCVM  434

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERISKL+ ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  435  GIQANTERISKLMSESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  494

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  495  FDEWVKPKDMLGP  507



>ref|XP_002718365.1| PREDICTED: fumarate hydratase, mitochondrial-like [Oryctolagus 
cuniculus]
Length=508

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIAND+RFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  315  AHDALVELSGAMNTTACSLMKIANDVRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  374

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV + VGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  375  CEAMTMVAAQVMGNHVAVAVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVL  434

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LKE A  L  LTAE+
Sbjct  435  GIQANTERINKLMNESLMLVTALNPYIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQ  494

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  495  FDEWVKPKDMLGP  507



>ref|XP_005884158.1| PREDICTED: fumarate hydratase, mitochondrial [Myotis brandtii]
Length=473

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  280  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  339

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDA+ SF +NCV 
Sbjct  340  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDAAVSFTENCVV  399

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN++RI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  400  GIQANKDRIAKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  459

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  460  FDEWVKPKDMLGP  472



>ref|XP_010215690.1| PREDICTED: fumarate hydratase, mitochondrial [Tinamus guttatus]
Length=494

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  361  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  421  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  480

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  481  FDQWVKPKDMLGP  493



>ref|XP_009897885.1| PREDICTED: fumarate hydratase, mitochondrial [Picoides pubescens]
Length=486

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  293  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  352

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  353  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  412

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  413  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  472

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  473  FDQWVKPKDMLGP  485



>ref|XP_004619073.1| PREDICTED: fumarate hydratase, mitochondrial [Sorex araneus]
Length=512

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  319  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  378

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  379  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  438

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  439  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  498

Query  279  FDQLVVPEKMIGP  241
            FD+ V P++M+GP
Sbjct  499  FDEWVKPKEMLGP  511



>sp|P14408.1|FUMH_RAT RecName: Full=Fumarate hydratase, mitochondrial; Short=Fumarase; 
Flags: Precursor [Rattus norvegicus]
 gb|AAA41177.1| fumarase precursor (EC 4.2.1.2) [Rattus norvegicus]
Length=507

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  314  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  373

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  374  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  433

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LK+ A  L  LTAE+
Sbjct  434  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKKTAIELGYLTAEQ  493

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  494  FDEWVKPKDMLGP  506



>prf||1709138A fumarase
Length=507

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  314  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  373

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  374  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  433

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI+KL++ESLMLVT LNP IGYD AA +AK AHK G++LK+ A  L  LTAE+
Sbjct  434  GIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKKTAIELGYLTAEQ  493

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  494  FDEWVKPKDMLGP  506



>ref|XP_010990377.1| PREDICTED: fumarate hydratase, mitochondrial isoform X3 [Camelus 
dromedarius]
Length=499

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  306  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  365

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  366  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  425

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  426  GIQANTERIDKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  485

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  486  FDEWVKPKDMLGP  498



>ref|XP_009883751.1| PREDICTED: fumarate hydratase, mitochondrial [Charadrius vociferus]
Length=494

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  301  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  360

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  361  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  420

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL+ ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  421  GIQANTDRINKLMSESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  480

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  481  FDQWVKPKDMLGP  493



>ref|XP_010971718.1| PREDICTED: fumarate hydratase, mitochondrial isoform X3 [Camelus 
bactrianus]
Length=499

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  306  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  365

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  366  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  425

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  426  GIQANTERIDKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  485

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  486  FDEWVKPKDMLGP  498



>ref|XP_009087608.1| PREDICTED: fumarate hydratase, mitochondrial [Serinus canaria]
Length=485

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT+A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  292  AHDALVELSGAMNTVACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  351

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++L+S RLLGD   SF  NCV 
Sbjct  352  CEAVTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLNSARLLGDVCVSFTDNCVV  411

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN +RI+KL++ESLMLVT LNP IGYD AA +AK AHKEGT+LKEAA  L  LT+++
Sbjct  412  GIQANTDRINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKEGTTLKEAAIKLGFLTSDQ  471

Query  279  FDQLVVPEKMIGP  241
            FDQ V P+ M+GP
Sbjct  472  FDQWVKPKDMLGP  484



>ref|XP_010990376.1| PREDICTED: fumarate hydratase, mitochondrial isoform X2 [Camelus 
dromedarius]
Length=503

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 162/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  819  AHDAFVESSGXLNTIAASLMKIANDIRFLGSGPRCGLGELILPENEPGSSIMPGKVNPTQ  640
            AHDA VE SG +NT A SLMKIANDIRFLGSGPR GLGELILPENEPGSSIMPGKVNPTQ
Sbjct  310  AHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQ  369

Query  639  CEAITMVCAQVIGNHVGLTVGGSNGHFELNVFKPMIANSLLHSVRLLGDASASFEKNCVR  460
            CEA+TMV AQV+GNHV +TVGGSNGHFELNVFKPM+  ++LHS RLLGDAS SF +NCV 
Sbjct  370  CEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVV  429

Query  459  GIQANRERISKLLHESLMLVTCLNPKIGYDNAAAVAKKAHKEGTSLKEAACNLQVLTAEE  280
            GIQAN ERI KL++ESLMLVT LNP IGYD AA +AK AHK G++LK  A  L  LTAE+
Sbjct  430  GIQANTERIDKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKATAIELGYLTAEQ  489

Query  279  FDQLVVPEKMIGP  241
            FD+ V P+ M+GP
Sbjct  490  FDEWVKPKDMLGP  502



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1673236833030