BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF018G08

Length=700
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009604687.1|  PREDICTED: probable serine/threonine-protein...    167   3e-44   Nicotiana tomentosiformis
ref|XP_009784583.1|  PREDICTED: probable serine/threonine-protein...    166   8e-44   Nicotiana sylvestris
ref|XP_004244231.1|  PREDICTED: probable serine/threonine-protein...    165   2e-43   Solanum lycopersicum
ref|XP_006348252.1|  PREDICTED: probable serine/threonine-protein...    164   4e-43   Solanum tuberosum [potatoes]
emb|CDP05922.1|  unnamed protein product                                163   5e-43   Coffea canephora [robusta coffee]
ref|XP_010060566.1|  PREDICTED: probable serine/threonine-protein...    156   3e-40   Eucalyptus grandis [rose gum]
gb|KJB81952.1|  hypothetical protein B456_013G168700                    151   8e-39   Gossypium raimondii
gb|KDP27060.1|  hypothetical protein JCGZ_20995                         152   1e-38   Jatropha curcas
gb|KJB81951.1|  hypothetical protein B456_013G168700                    151   2e-38   Gossypium raimondii
ref|XP_002285008.1|  PREDICTED: probable serine/threonine-protein...    150   4e-38   Vitis vinifera
emb|CBI20299.3|  unnamed protein product                                150   4e-38   Vitis vinifera
ref|XP_006451848.1|  hypothetical protein CICLE_v10007617mg             150   6e-38   Citrus clementina [clementine]
ref|XP_006464753.1|  PREDICTED: probable serine/threonine-protein...    150   7e-38   Citrus sinensis [apfelsine]
ref|XP_007021485.1|  Kinase superfamily protein                         149   7e-38   
gb|KDO62492.1|  hypothetical protein CISIN_1g004999mg                   149   8e-38   Citrus sinensis [apfelsine]
ref|XP_002316895.2|  hypothetical protein POPTR_0011s12010g             148   1e-37   
ref|XP_011029485.1|  PREDICTED: probable serine/threonine-protein...    146   1e-36   Populus euphratica
ref|XP_004487708.1|  PREDICTED: probable serine/threonine-protein...    145   2e-36   Cicer arietinum [garbanzo]
ref|XP_010694982.1|  PREDICTED: probable serine/threonine-protein...    144   8e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694981.1|  PREDICTED: probable serine/threonine-protein...    144   8e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004146248.1|  PREDICTED: probable serine/threonine-protein...    141   1e-34   Cucumis sativus [cucumbers]
ref|XP_008456032.1|  PREDICTED: probable serine/threonine-protein...    140   2e-34   Cucumis melo [Oriental melon]
gb|KHN36823.1|  Putative serine/threonine-protein kinase                139   2e-34   Glycine soja [wild soybean]
gb|KJB45709.1|  hypothetical protein B456_007G322800                    139   4e-34   Gossypium raimondii
ref|XP_003543242.1|  PREDICTED: probable serine/threonine-protein...    139   5e-34   Glycine max [soybeans]
ref|XP_007149459.1|  hypothetical protein PHAVU_005G071900g             139   5e-34   Phaseolus vulgaris [French bean]
ref|XP_003540463.1|  PREDICTED: probable serine/threonine-protein...    137   3e-33   Glycine max [soybeans]
gb|KHN28061.1|  Putative serine/threonine-protein kinase                137   3e-33   Glycine soja [wild soybean]
ref|XP_003596750.1|  Serine/threonine protein kinase cdk9               136   5e-33   Medicago truncatula
ref|XP_006370257.1|  hypothetical protein POPTR_0001s41040g             136   5e-33   Populus trichocarpa [western balsam poplar]
gb|KHG22910.1|  hypothetical protein F383_06618                         135   1e-32   Gossypium arboreum [tree cotton]
gb|EYU26381.1|  hypothetical protein MIMGU_mgv1a002080mg                135   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_011004643.1|  PREDICTED: probable serine/threonine-protein...    134   4e-32   Populus euphratica
ref|XP_011098308.1|  PREDICTED: probable serine/threonine-protein...    133   6e-32   Sesamum indicum [beniseed]
ref|XP_008226629.1|  PREDICTED: probable serine/threonine-protein...    130   9e-31   Prunus mume [ume]
ref|XP_007214536.1|  hypothetical protein PRUPE_ppa002182mg             130   9e-31   Prunus persica
ref|XP_004296506.1|  PREDICTED: probable serine/threonine-protein...    129   3e-30   Fragaria vesca subsp. vesca
ref|XP_008386179.1|  PREDICTED: probable serine/threonine-protein...    128   3e-30   
ref|XP_009341042.1|  PREDICTED: probable serine/threonine-protein...    125   4e-29   Pyrus x bretschneideri [bai li]
ref|XP_009356808.1|  PREDICTED: probable serine/threonine-protein...    125   5e-29   Pyrus x bretschneideri [bai li]
ref|XP_008366989.1|  PREDICTED: probable serine/threonine-protein...    124   1e-28   
ref|XP_003527250.1|  PREDICTED: probable serine/threonine-protein...    119   6e-27   Glycine max [soybeans]
ref|XP_006582172.1|  PREDICTED: probable serine/threonine-protein...    119   7e-27   Glycine max [soybeans]
ref|XP_006582173.1|  PREDICTED: probable serine/threonine-protein...    119   7e-27   Glycine max [soybeans]
ref|XP_006582174.1|  PREDICTED: probable serine/threonine-protein...    119   7e-27   Glycine max [soybeans]
ref|XP_003540111.1|  PREDICTED: probable serine/threonine-protein...    114   2e-25   Glycine max [soybeans]
ref|XP_006592612.1|  PREDICTED: probable serine/threonine-protein...    114   2e-25   Glycine max [soybeans]
ref|XP_006592611.1|  PREDICTED: probable serine/threonine-protein...    114   3e-25   Glycine max [soybeans]
ref|XP_010272444.1|  PREDICTED: probable serine/threonine-protein...    112   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010112974.1|  putative serine/threonine-protein kinase           111   6e-24   
ref|XP_010260204.1|  PREDICTED: probable serine/threonine-protein...    110   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010260205.1|  PREDICTED: probable serine/threonine-protein...    108   3e-23   Nelumbo nucifera [Indian lotus]
ref|XP_006392837.1|  hypothetical protein EUTSA_v10011275mg             105   4e-22   Eutrema salsugineum [saltwater cress]
ref|NP_175713.1|  putative serine/threonine protein kinase              100   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42182.1|  putative cell division-related protein                  100   2e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25738.1|  BnaC03g69370D                                        97.8    1e-19   Brassica napus [oilseed rape]
emb|CDY02525.1|  BnaA08g01320D                                        97.4    2e-19   
ref|XP_010479840.1|  PREDICTED: probable serine/threonine-protein...  97.8    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009107008.1|  PREDICTED: probable serine/threonine-protein...  97.4    2e-19   Brassica rapa
ref|XP_010462163.1|  PREDICTED: probable serine/threonine-protein...  97.1    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010545831.1|  PREDICTED: probable serine/threonine-protein...  97.1    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_009144802.1|  PREDICTED: probable serine/threonine-protein...  95.9    6e-19   Brassica rapa
ref|XP_006303920.1|  hypothetical protein CARUB_v10008475mg           95.5    9e-19   
gb|KFK35750.1|  hypothetical protein AALP_AA4G031500                  94.4    2e-18   Arabis alpina [alpine rockcress]
ref|XP_010500934.1|  PREDICTED: probable serine/threonine-protein...  94.4    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010535099.1|  PREDICTED: probable serine/threonine-protein...  94.0    3e-18   Tarenaya hassleriana [spider flower]
emb|CDY50511.1|  BnaC06g10110D                                        93.6    4e-18   Brassica napus [oilseed rape]
ref|XP_002274225.1|  PREDICTED: probable serine/threonine-protein...  75.1    4e-12   
ref|XP_010035763.1|  PREDICTED: probable serine/threonine-protein...  74.3    9e-12   Eucalyptus grandis [rose gum]
emb|CBI21859.3|  unnamed protein product                              74.7    9e-12   Vitis vinifera
ref|XP_007043608.1|  ATP binding protein, putative                    73.2    2e-11   
ref|XP_010915425.1|  PREDICTED: probable serine/threonine-protein...  73.2    2e-11   Elaeis guineensis
ref|XP_010915422.1|  PREDICTED: probable serine/threonine-protein...  73.2    2e-11   Elaeis guineensis
ref|NP_001042320.2|  Os01g0201000                                     67.8    5e-11   
ref|XP_008791729.1|  PREDICTED: probable serine/threonine-protein...  71.6    6e-11   
ref|XP_008794126.1|  PREDICTED: probable serine/threonine-protein...  70.5    1e-10   Phoenix dactylifera
gb|KHG29152.1|  hypothetical protein F383_15438                       70.5    1e-10   Gossypium arboreum [tree cotton]
ref|XP_002533553.1|  Cell division protein kinase, putative           69.3    3e-10   
ref|XP_008229000.1|  PREDICTED: probable serine/threonine-protein...  69.3    4e-10   Prunus mume [ume]
ref|XP_011037349.1|  PREDICTED: probable serine/threonine-protein...  68.9    5e-10   Populus euphratica
ref|XP_010915426.1|  PREDICTED: probable serine/threonine-protein...  68.6    5e-10   
ref|XP_010915423.1|  PREDICTED: probable serine/threonine-protein...  68.6    6e-10   Elaeis guineensis
ref|XP_009341988.1|  PREDICTED: probable serine/threonine-protein...  68.6    7e-10   Pyrus x bretschneideri [bai li]
ref|XP_010915421.1|  PREDICTED: probable serine/threonine-protein...  68.6    7e-10   Elaeis guineensis
ref|XP_009336211.1|  PREDICTED: probable serine/threonine-protein...  68.2    7e-10   Pyrus x bretschneideri [bai li]
gb|KJB77258.1|  hypothetical protein B456_012G128100                  68.2    9e-10   Gossypium raimondii
gb|KJB77257.1|  hypothetical protein B456_012G128100                  67.8    9e-10   Gossypium raimondii
gb|KJB77256.1|  hypothetical protein B456_012G128100                  68.2    9e-10   Gossypium raimondii
gb|EEE54064.1|  hypothetical protein OsJ_00765                        67.8    9e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70121.1|  hypothetical protein OsI_00791                        67.8    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_007198826.1|  hypothetical protein PRUPE_ppa002174mg           67.4    1e-09   Prunus persica
ref|XP_008791720.1|  PREDICTED: probable serine/threonine-protein...  67.0    2e-09   Phoenix dactylifera
ref|XP_008337487.1|  PREDICTED: probable serine/threonine-protein...  66.6    2e-09   
ref|XP_008794127.1|  PREDICTED: probable serine/threonine-protein...  66.2    3e-09   
ref|XP_004303108.1|  PREDICTED: probable serine/threonine-protein...  66.2    4e-09   Fragaria vesca subsp. vesca
ref|XP_008794125.1|  PREDICTED: probable serine/threonine-protein...  65.9    4e-09   Phoenix dactylifera
ref|XP_010925563.1|  PREDICTED: probable serine/threonine-protein...  65.9    5e-09   
ref|XP_006859032.1|  hypothetical protein AMTR_s00068p00177220        65.5    6e-09   
ref|XP_009336210.1|  PREDICTED: probable serine/threonine-protein...  65.5    7e-09   Pyrus x bretschneideri [bai li]
ref|XP_006376478.1|  hypothetical protein POPTR_0013s13360g           65.5    7e-09   
ref|XP_009341987.1|  PREDICTED: probable serine/threonine-protein...  65.1    8e-09   
ref|XP_006643878.1|  PREDICTED: probable serine/threonine-protein...  64.7    8e-09   Oryza brachyantha
ref|XP_009421283.1|  PREDICTED: probable serine/threonine-protein...  64.7    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010327074.1|  PREDICTED: probable serine/threonine-protein...  64.3    1e-08   
ref|XP_004248172.1|  PREDICTED: probable serine/threonine-protein...  64.7    1e-08   Solanum lycopersicum
ref|XP_008342901.1|  PREDICTED: probable serine/threonine-protein...  63.2    3e-08   
ref|XP_009618925.1|  PREDICTED: probable serine/threonine-protein...  62.0    4e-08   Nicotiana tomentosiformis
ref|XP_009802541.1|  PREDICTED: probable serine/threonine-protein...  62.8    5e-08   Nicotiana sylvestris
ref|XP_004971749.1|  PREDICTED: probable serine/threonine-protein...  62.4    5e-08   
gb|KJB45710.1|  hypothetical protein B456_007G322800                  60.8    5e-08   Gossypium raimondii
ref|XP_002457168.1|  hypothetical protein SORBIDRAFT_03g002610        61.2    1e-07   Sorghum bicolor [broomcorn]
ref|XP_009757169.1|  PREDICTED: probable serine/threonine-protein...  60.8    2e-07   Nicotiana sylvestris
ref|XP_009757170.1|  PREDICTED: probable serine/threonine-protein...  60.8    2e-07   Nicotiana sylvestris
ref|XP_009757168.1|  PREDICTED: probable serine/threonine-protein...  60.8    2e-07   Nicotiana sylvestris
ref|XP_009757166.1|  PREDICTED: probable serine/threonine-protein...  60.8    2e-07   Nicotiana sylvestris
ref|XP_009588481.1|  PREDICTED: probable serine/threonine-protein...  60.5    3e-07   Nicotiana tomentosiformis
ref|XP_009588477.1|  PREDICTED: probable serine/threonine-protein...  60.5    3e-07   Nicotiana tomentosiformis
ref|XP_009588480.1|  PREDICTED: probable serine/threonine-protein...  60.5    3e-07   Nicotiana tomentosiformis
ref|XP_009588482.1|  PREDICTED: probable serine/threonine-protein...  60.1    3e-07   Nicotiana tomentosiformis
gb|EMT17795.1|  Putative serine/threonine-protein kinase              60.1    3e-07   
ref|XP_006367646.1|  PREDICTED: probable serine/threonine-protein...  59.3    7e-07   Solanum tuberosum [potatoes]
ref|XP_002517906.1|  ATP binding protein, putative                    58.9    1e-06   Ricinus communis
gb|EYU24917.1|  hypothetical protein MIMGU_mgv1a002276mg              58.5    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_006357474.1|  PREDICTED: probable serine/threonine-protein...  57.8    2e-06   Solanum tuberosum [potatoes]
ref|XP_004243358.1|  PREDICTED: probable serine/threonine-protein...  57.4    3e-06   Solanum lycopersicum
gb|KDO53901.1|  hypothetical protein CISIN_1g005111mg                 57.0    4e-06   Citrus sinensis [apfelsine]
ref|XP_006447296.1|  hypothetical protein CICLE_v10014434mg           57.0    4e-06   Citrus clementina [clementine]
ref|XP_010089557.1|  putative serine/threonine-protein kinase         56.2    7e-06   Morus notabilis
gb|KDP24118.1|  hypothetical protein JCGZ_25775                       55.8    9e-06   Jatropha curcas
dbj|BAK06871.1|  predicted protein                                    55.1    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP14791.1|  unnamed protein product                              55.5    1e-05   Coffea canephora [robusta coffee]
gb|KGN46735.1|  hypothetical protein Csa_6G127470                     55.5    1e-05   Cucumis sativus [cucumbers]
ref|XP_004140036.1|  PREDICTED: probable serine/threonine-protein...  55.5    1e-05   
ref|XP_008655744.1|  PREDICTED: probable serine/threonine-protein...  55.1    2e-05   Zea mays [maize]
dbj|BAK06672.1|  predicted protein                                    54.7    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004505575.1|  PREDICTED: probable serine/threonine-protein...  54.7    2e-05   
ref|XP_010230587.1|  PREDICTED: probable serine/threonine-protein...  54.3    3e-05   Brachypodium distachyon [annual false brome]
gb|ACL54761.1|  unknown                                               52.8    4e-05   Zea mays [maize]
ref|XP_010930474.1|  PREDICTED: probable serine/threonine-protein...  53.9    4e-05   Elaeis guineensis
ref|XP_008448297.1|  PREDICTED: probable serine/threonine-protein...  53.9    4e-05   Cucumis melo [Oriental melon]
ref|XP_008786562.1|  PREDICTED: probable serine/threonine-protein...  53.9    4e-05   
ref|XP_011100264.1|  PREDICTED: probable serine/threonine-protein...  53.5    6e-05   Sesamum indicum [beniseed]
ref|XP_008448301.1|  PREDICTED: probable serine/threonine-protein...  53.1    7e-05   Cucumis melo [Oriental melon]
ref|XP_008448300.1|  PREDICTED: probable serine/threonine-protein...  53.1    7e-05   Cucumis melo [Oriental melon]
ref|XP_011095772.1|  PREDICTED: probable serine/threonine-protein...  53.1    8e-05   Sesamum indicum [beniseed]
gb|KHG15886.1|  hypothetical protein F383_23532                       52.8    9e-05   Gossypium arboreum [tree cotton]
ref|XP_010062385.1|  PREDICTED: probable serine/threonine-protein...  52.8    1e-04   Eucalyptus grandis [rose gum]
tpg|DAA52935.1|  TPA: putative protein kinase superfamily protein     52.8    1e-04   
ref|XP_006836804.1|  hypothetical protein AMTR_s00099p00026630        52.4    1e-04   Amborella trichopoda
ref|XP_010912690.1|  PREDICTED: probable serine/threonine-protein...  52.0    2e-04   Elaeis guineensis
ref|XP_003526281.1|  PREDICTED: probable serine/threonine-protein...  52.0    2e-04   Glycine max [soybeans]
ref|XP_008806997.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  51.6    2e-04   
ref|XP_008795313.1|  PREDICTED: probable serine/threonine-protein...  51.6    3e-04   Phoenix dactylifera
dbj|BAF98226.1|  CM0545.690.nc                                        48.1    3e-04   Lotus japonicus
ref|XP_010910391.1|  PREDICTED: probable serine/threonine-protein...  51.2    3e-04   Elaeis guineensis
gb|KJB31671.1|  hypothetical protein B456_005G200800                  51.2    4e-04   Gossypium raimondii
ref|XP_009385619.1|  PREDICTED: probable serine/threonine-protein...  50.8    4e-04   
ref|XP_004972482.1|  PREDICTED: probable serine/threonine-protein...  51.2    4e-04   Setaria italica
gb|EEC82802.1|  hypothetical protein OsI_27571                        50.4    6e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001060831.1|  Os08g0112500                                     50.4    6e-04   
ref|XP_006659052.1|  PREDICTED: probable serine/threonine-protein...  50.4    6e-04   
ref|XP_008678323.1|  PREDICTED: probable serine/threonine-protein...  50.4    6e-04   Zea mays [maize]



>ref|XP_009604687.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana tomentosiformis]
Length=712

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 112/137 (82%), Gaps = 4/137 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV----HQNDEG  531
            VAARRS+  E+  ++SGP  +E PKLI+RFPGSFKE S + MKQ QK+      HQN++G
Sbjct  576  VAARRSMFSEDRPDKSGPHKQEAPKLIARFPGSFKEVSHSAMKQEQKTHSLASSHQNEDG  635

Query  530  RSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnA  351
            R+S+NDPV+LGYGSKGNKIHYSGPLLVPS ++DQ+LKDHDRH+QEA RRARLDKAKA+  
Sbjct  636  RTSNNDPVLLGYGSKGNKIHYSGPLLVPSGKMDQMLKDHDRHVQEAVRRARLDKAKAKKI  695

Query  350  QVEKNQISTGSLVVSGR  300
            Q+E NQ+S  SL VSGR
Sbjct  696  QIEGNQLSANSLFVSGR  712



>ref|XP_009784583.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana sylvestris]
Length=712

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 112/137 (82%), Gaps = 4/137 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQK----SQVHQNDEG  531
            VAARRS+  E+  ++SGP  +E PKLI+RFPGSFKE S + MKQ QK    +  HQN++G
Sbjct  576  VAARRSMFSEDRPDKSGPHKQEVPKLIARFPGSFKEVSHSAMKQEQKNHSLASSHQNEDG  635

Query  530  RSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnA  351
            R+S+NDPV+LGYGSKGNKIHYSGPLLVPS ++DQ+LKDHDRH+QEA RRARLDKAKA+  
Sbjct  636  RTSNNDPVLLGYGSKGNKIHYSGPLLVPSGKMDQMLKDHDRHVQEAVRRARLDKAKAKKI  695

Query  350  QVEKNQISTGSLVVSGR  300
            Q+E NQ+S  SL VSGR
Sbjct  696  QIEGNQLSANSLFVSGR  712



>ref|XP_004244231.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Solanum lycopersicum]
Length=705

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 113/138 (82%), Gaps = 5/138 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV-----HQNDE  534
            VAARRS+  E+  ++SG   +E PKLI+RFPGS+KEAS +TMKQ QK+       HQN++
Sbjct  568  VAARRSMFSEDRPDKSGSHKQEVPKLIARFPGSYKEASHSTMKQEQKNHALASSHHQNED  627

Query  533  GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarn  354
            GR+S+NDPV+LGYGSKGNKIHYSGPLLVPS ++DQ+LKDHDRHIQEA RRARLDKAKA+ 
Sbjct  628  GRTSNNDPVLLGYGSKGNKIHYSGPLLVPSGKMDQVLKDHDRHIQEAVRRARLDKAKAKK  687

Query  353  AQVEKNQISTGSLVVSGR  300
             QVE N++S  SL VSGR
Sbjct  688  IQVEGNKLSANSLFVSGR  705



>ref|XP_006348252.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006348253.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Solanum tuberosum]
Length=705

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 113/138 (82%), Gaps = 5/138 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV-----HQNDE  534
            VAARRS+  E+ +++SG   +E PKLI+RFPGS+KE S +TMKQ QK+       HQN++
Sbjct  568  VAARRSMFSEDRSDKSGSHKQEVPKLIARFPGSYKEVSHSTMKQEQKNHALASSHHQNED  627

Query  533  GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarn  354
            GR+S+NDPV+LGYGSKGNKIHYSGPLLVPS ++DQ+LKDHDRHIQEA RRARLDKAKA+ 
Sbjct  628  GRTSNNDPVLLGYGSKGNKIHYSGPLLVPSGKMDQVLKDHDRHIQEAVRRARLDKAKAKK  687

Query  353  AQVEKNQISTGSLVVSGR  300
             QVE N++S  SL VSGR
Sbjct  688  IQVEGNKLSANSLFVSGR  705



>emb|CDP05922.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV----HQNDEG  531
            VAARRS+L E  +E+SGP+ +E PKLI+RFPGSFKE S+++MKQ+QK+QV    +QN++G
Sbjct  481  VAARRSVLSEERSEKSGPSQQEVPKLIARFPGSFKETSNSSMKQDQKNQVVTGSYQNEDG  540

Query  530  RSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnA  351
            R+S+NDPV++GYGSKGNKIHYSGP++VPS ++DQ++KDHDR +QEA RRARLDKAK R +
Sbjct  541  RTSNNDPVLIGYGSKGNKIHYSGPIIVPSGKMDQMMKDHDRQVQEAVRRARLDKAKLRKS  600

Query  350  QVEKNQISTGSLVVSGR  300
            Q + NQ+S  SL VSGR
Sbjct  601  QADGNQLSINSLFVSGR  617



>ref|XP_010060566.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Eucalyptus grandis]
 ref|XP_010060567.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Eucalyptus grandis]
 gb|KCW67346.1| hypothetical protein EUGRSUZ_F01130 [Eucalyptus grandis]
 gb|KCW67347.1| hypothetical protein EUGRSUZ_F01130 [Eucalyptus grandis]
Length=713

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 109/137 (80%), Gaps = 6/137 (4%)
 Frame = -3

Query  692  ARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH------QNDEG  531
            ARRSLL E+  E+SGP++ E PKLI RFPGSFKEAS+  ++Q+QK+ +H        ++G
Sbjct  577  ARRSLLSEDRRERSGPSHSEVPKLIGRFPGSFKEASECLIQQDQKNNIHGLSGSRHKEDG  636

Query  530  RSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnA  351
            R+S  DP++LGYGSKGNKIHYSGPLLVPS  +DQ+LKDHDRHIQEA+RRAR+DKAKAR  
Sbjct  637  RTSDKDPILLGYGSKGNKIHYSGPLLVPSGNMDQMLKDHDRHIQEASRRARIDKAKARKI  696

Query  350  QVEKNQISTGSLVVSGR  300
            QV+ NQI   SL VSGR
Sbjct  697  QVDGNQILASSLFVSGR  713



>gb|KJB81952.1| hypothetical protein B456_013G168700 [Gossypium raimondii]
Length=533

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = -3

Query  698  VAARRS-LLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSS  522
            VAARR+ L+ E+  E SG +  E PKL +RFPGSFKEAS++ ++ +Q+  V Q ++GRS 
Sbjct  400  VAARRNNLISEDHRESSGSSQSEAPKLFARFPGSFKEASESFIQHDQEHNVQQKEDGRSD  459

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
            +NDPV+LGYGSKGNKIHYSGPLLVPS  VDQ+LKDHDR IQEA RRARLDKAK R  Q+E
Sbjct  460  NNDPVLLGYGSKGNKIHYSGPLLVPSGNVDQMLKDHDRQIQEAVRRARLDKAKKRKVQLE  519

Query  341  KNQISTGSLVVSGR  300
             N +ST SL VSGR
Sbjct  520  ANHMSTTSLFVSGR  533



>gb|KDP27060.1| hypothetical protein JCGZ_20995 [Jatropha curcas]
Length=713

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 110/139 (79%), Gaps = 6/139 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            VAA+RSLL E+  E+SG + ++ PKL++RFPGSFKE+SD+ ++Q+QK         HQ +
Sbjct  575  VAAKRSLLSEDRRERSGTSQQDVPKLMARFPGSFKESSDSFVQQDQKHHCQGVAGSHQKE  634

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            +GR  +NDP+++GYGSKG+KIHYSGPLL+PS  VDQ+LKDHDR IQEA RRAR+DKAK R
Sbjct  635  DGRIGNNDPILVGYGSKGHKIHYSGPLLLPSGNVDQMLKDHDRQIQEAVRRARIDKAKVR  694

Query  356  nAQVEKNQISTGSLVVSGR  300
              QVE NQIST S+ VSGR
Sbjct  695  KVQVEGNQISTNSIFVSGR  713



>gb|KJB81951.1| hypothetical protein B456_013G168700 [Gossypium raimondii]
Length=703

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = -3

Query  698  VAARRS-LLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSS  522
            VAARR+ L+ E+  E SG +  E PKL +RFPGSFKEAS++ ++ +Q+  V Q ++GRS 
Sbjct  570  VAARRNNLISEDHRESSGSSQSEAPKLFARFPGSFKEASESFIQHDQEHNVQQKEDGRSD  629

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
            +NDPV+LGYGSKGNKIHYSGPLLVPS  VDQ+LKDHDR IQEA RRARLDKAK R  Q+E
Sbjct  630  NNDPVLLGYGSKGNKIHYSGPLLVPSGNVDQMLKDHDRQIQEAVRRARLDKAKKRKVQLE  689

Query  341  KNQISTGSLVVSGR  300
             N +ST SL VSGR
Sbjct  690  ANHMSTTSLFVSGR  703



>ref|XP_002285008.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
Length=713

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 108/139 (78%), Gaps = 6/139 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH------QND  537
            VAARRSLL E+  E+SG +  +  KLI RFPGSFKEAS++T++Q+QK Q+       Q +
Sbjct  575  VAARRSLLSEDRREKSGSSQPDVSKLIVRFPGSFKEASESTIQQDQKHQMQGAGRCTQKE  634

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            +GR +S DPV+LGYGSKG+KIHYSGPLLVPS +VDQ+LKDHDR IQ+A RRARLD+ K R
Sbjct  635  DGRMTSKDPVLLGYGSKGHKIHYSGPLLVPSGKVDQMLKDHDRQIQDAERRARLDREKLR  694

Query  356  nAQVEKNQISTGSLVVSGR  300
              QVE N+IS  SL VSGR
Sbjct  695  KVQVEGNKISANSLFVSGR  713



>emb|CBI20299.3| unnamed protein product [Vitis vinifera]
Length=712

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 108/139 (78%), Gaps = 6/139 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH------QND  537
            VAARRSLL E+  E+SG +  +  KLI RFPGSFKEAS++T++Q+QK Q+       Q +
Sbjct  574  VAARRSLLSEDRREKSGSSQPDVSKLIVRFPGSFKEASESTIQQDQKHQMQGAGRCTQKE  633

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            +GR +S DPV+LGYGSKG+KIHYSGPLLVPS +VDQ+LKDHDR IQ+A RRARLD+ K R
Sbjct  634  DGRMTSKDPVLLGYGSKGHKIHYSGPLLVPSGKVDQMLKDHDRQIQDAERRARLDREKLR  693

Query  356  nAQVEKNQISTGSLVVSGR  300
              QVE N+IS  SL VSGR
Sbjct  694  KVQVEGNKISANSLFVSGR  712



>ref|XP_006451848.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 ref|XP_006451849.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 ref|XP_006451850.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 gb|ESR65088.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 gb|ESR65089.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
 gb|ESR65090.1| hypothetical protein CICLE_v10007617mg [Citrus clementina]
Length=709

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 106/139 (76%), Gaps = 6/139 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            VAARRSLL E+  E+SG    E PKLI+RFPGSFKEAS++ ++ +QK         HQ +
Sbjct  571  VAARRSLLSEDRRERSGSAQPEVPKLIARFPGSFKEASESFIQHDQKHHAQGVAGSHQKE  630

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            +GR  + DP++LGYGSKG+KIHYSGPL+VPS  VDQ+LKDHDR IQEA RRAR+DKAK R
Sbjct  631  DGRIGNKDPILLGYGSKGHKIHYSGPLIVPSGNVDQMLKDHDRQIQEAVRRARVDKAKVR  690

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q+E NQ+ST SL VSGR
Sbjct  691  KVQMEGNQLSTNSLFVSGR  709



>ref|XP_006464753.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Citrus sinensis]
 gb|KDO62493.1| hypothetical protein CISIN_1g004999mg [Citrus sinensis]
 gb|KDO62494.1| hypothetical protein CISIN_1g004999mg [Citrus sinensis]
Length=709

 Score =   150 bits (378),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 105/139 (76%), Gaps = 6/139 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            VAARRSLL E+  E+SG    E PKLI+RFPGSFKEAS++ ++ +QK         HQ +
Sbjct  571  VAARRSLLSEDRRERSGSAQPEVPKLIARFPGSFKEASESFIQHDQKHHAQGVAGSHQKE  630

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            +GR  + DP++LGYGSKG+KIHYSGPL+VPS  VDQ+LKDHDR IQEA RRAR DKAK R
Sbjct  631  DGRIGNKDPILLGYGSKGHKIHYSGPLIVPSGNVDQMLKDHDRQIQEAVRRARFDKAKVR  690

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q+E NQ+ST SL VSGR
Sbjct  691  KVQMEGNQLSTNSLFVSGR  709



>ref|XP_007021485.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY13010.1| Kinase superfamily protein [Theobroma cacao]
Length=707

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = -3

Query  698  VAARRS-LLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSS  522
            VAARRS L+ E+  E+SG +  E PK I+RFPGSFKEAS++ ++Q+QK  + Q ++GRS+
Sbjct  575  VAARRSSLISEDRRERSGSSQSEAPK-IARFPGSFKEASESFIQQDQKHNLQQKEDGRSN  633

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
            S DPV+LGYGSKG+KIHYSGPL+VPS  +DQ+LKDHDR IQEA RRARLDKAK R  Q+E
Sbjct  634  SKDPVLLGYGSKGHKIHYSGPLIVPSGNMDQVLKDHDRQIQEAVRRARLDKAKMRKVQLE  693

Query  341  KNQISTGSLVVSGR  300
             NQIST SL VSGR
Sbjct  694  GNQISTNSLFVSGR  707



>gb|KDO62492.1| hypothetical protein CISIN_1g004999mg [Citrus sinensis]
Length=720

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 105/139 (76%), Gaps = 6/139 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            VAARRSLL E+  E+SG    E PKLI+RFPGSFKEAS++ ++ +QK         HQ +
Sbjct  582  VAARRSLLSEDRRERSGSAQPEVPKLIARFPGSFKEASESFIQHDQKHHAQGVAGSHQKE  641

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            +GR  + DP++LGYGSKG+KIHYSGPL+VPS  VDQ+LKDHDR IQEA RRAR DKAK R
Sbjct  642  DGRIGNKDPILLGYGSKGHKIHYSGPLIVPSGNVDQMLKDHDRQIQEAVRRARFDKAKVR  701

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q+E NQ+ST SL VSGR
Sbjct  702  KVQMEGNQLSTNSLFVSGR  720



>ref|XP_002316895.2| hypothetical protein POPTR_0011s12010g [Populus trichocarpa]
 gb|EEE97507.2| hypothetical protein POPTR_0011s12010g [Populus trichocarpa]
Length=631

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 105/139 (76%), Gaps = 6/139 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQK------SQVHQND  537
            VAARRSLL E+  E+SG    E PKL++RFPGSFKE S++  +Q+ +      +  HQ +
Sbjct  493  VAARRSLLSEDRNERSGLAQPEVPKLMARFPGSFKETSESFTQQDPRHPSQGVAGFHQKE  552

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            +GR+SS DPV+LGYGSKG+KIHYSGPL+VPS  VDQ+LKDHDR IQEA RRARLDK K R
Sbjct  553  DGRNSSKDPVLLGYGSKGHKIHYSGPLIVPSGNVDQMLKDHDRQIQEAVRRARLDKEKVR  612

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q E NQIST SL VSGR
Sbjct  613  KVQAESNQISTNSLFVSGR  631



>ref|XP_011029485.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
Length=714

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 104/138 (75%), Gaps = 6/138 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQK------SQVHQND  537
            VAARRSLL E+  E+SGP   E PKL++RFPGSFKE S++  +Q+ +      +  HQ +
Sbjct  576  VAARRSLLSEDRNERSGPALPEVPKLMARFPGSFKETSESFTQQDPRHPSQGAAGFHQKE  635

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            +GR+SS DPV+LGYGSKG+KIHYSGPL+VPS  +DQ+L DHDR IQEA RRARLDK K R
Sbjct  636  DGRNSSKDPVLLGYGSKGHKIHYSGPLIVPSGNMDQMLNDHDRQIQEAVRRARLDKEKVR  695

Query  356  nAQVEKNQISTGSLVVSG  303
              Q E NQIST SL VSG
Sbjct  696  KVQAESNQISTNSLFVSG  713



>ref|XP_004487708.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Cicer arietinum]
Length=712

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH--QNDEGRS  525
            VAARRS+L ++  E SG +  E PKLI+RFPGSFKEAS++  +QNQK  VH  Q +EG+ 
Sbjct  579  VAARRSMLSDDRRECSGSSQVEAPKLITRFPGSFKEASESLTQQNQKHHVHASQKEEGKG  638

Query  524  SSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQV  345
            S+ DP ++GYGSKG KIHYSGPLLVPS+ +DQ+LKDHDR IQEA RRARLDKAK R  Q 
Sbjct  639  SNKDPNLVGYGSKGYKIHYSGPLLVPSSNMDQMLKDHDRQIQEAVRRARLDKAKMRRLQA  698

Query  344  EKNQISTGSLVVSGR  300
            E NQIS  SL VSGR
Sbjct  699  EGNQISN-SLFVSGR  712



>ref|XP_010694982.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=743

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 104/139 (75%), Gaps = 6/139 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            +AARRS L E+  E+S       PKL++RFPGSFKE S++  +++Q  Q+      HQN+
Sbjct  605  MAARRSFLSEDKREKSSSLQPGVPKLVARFPGSFKEKSESMSRRDQADQMQGLASSHQNE  664

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            +GRSS+ DPV+LGYGSKGNKIHYSGPL+VPS  +DQ+LKDHDR IQEA RRAR+DKAK R
Sbjct  665  DGRSSNKDPVLLGYGSKGNKIHYSGPLIVPSGNMDQMLKDHDRQIQEAVRRARIDKAKLR  724

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q E NQ+S  SL VSGR
Sbjct  725  KMQAEGNQVSNTSLFVSGR  743



>ref|XP_010694981.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=744

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 104/139 (75%), Gaps = 6/139 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            +AARRS L E+  E+S       PKL++RFPGSFKE S++  +++Q  Q+      HQN+
Sbjct  606  MAARRSFLSEDKREKSSSLQPGVPKLVARFPGSFKEKSESMSRRDQADQMQGLASSHQNE  665

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            +GRSS+ DPV+LGYGSKGNKIHYSGPL+VPS  +DQ+LKDHDR IQEA RRAR+DKAK R
Sbjct  666  DGRSSNKDPVLLGYGSKGNKIHYSGPLIVPSGNMDQMLKDHDRQIQEAVRRARIDKAKLR  725

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q E NQ+S  SL VSGR
Sbjct  726  KMQAEGNQVSNTSLFVSGR  744



>ref|XP_004146248.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Cucumis sativus]
 ref|XP_004170103.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Cucumis sativus]
 gb|KGN57623.1| hypothetical protein Csa_3G232950 [Cucumis sativus]
Length=707

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQ----NDEG  531
            VAARRS+L E+  E+S  +  E  KLI RFPGSFKE S+++M  +QK   H     +D+ 
Sbjct  571  VAARRSMLAEDCREKSDSSQGEVQKLIGRFPGSFKETSESSMLPDQKFSNHSIAGSHDKE  630

Query  530  RSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnA  351
            RSS+ DP+++GYGSKG+KIHYSGPLLVPS  +DQ+LKDHDRHIQEA RRARLDKAK R  
Sbjct  631  RSSTKDPIVVGYGSKGHKIHYSGPLLVPSGNMDQMLKDHDRHIQEAVRRARLDKAKVRKI  690

Query  350  QVEKNQISTGSLVVSGR  300
            Q +  QIST SL VSGR
Sbjct  691  QADGKQISTNSLFVSGR  707



>ref|XP_008456032.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Cucumis melo]
Length=707

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQ----NDEG  531
            VAARRS+L E+  E+S  +  E  KLI RFPGSFKE S+++M  +QK   H     +D+ 
Sbjct  571  VAARRSMLAEDCREKSDSSQGEVQKLIGRFPGSFKETSESSMLPDQKFSNHSIAGSHDKE  630

Query  530  RSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnA  351
            RSS+ DP+++GYGSKG+KIHYSGPLLVPS  +DQ+LKDHDRHIQEA RRARLDKAK R  
Sbjct  631  RSSTKDPIVVGYGSKGHKIHYSGPLLVPSGNMDQMLKDHDRHIQEAVRRARLDKAKVRKI  690

Query  350  QVEKNQISTGSLVVSGR  300
            Q +  Q+ST SL VSGR
Sbjct  691  QADGKQVSTNSLFVSGR  707



>gb|KHN36823.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=580

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH--QNDEGRS  525
            VAARRS+L ++  E SG +  E PKLISRFPGSFKEAS++ M+Q+QK   H  Q +EGR 
Sbjct  446  VAARRSMLSDDRREWSGSSQAEAPKLISRFPGSFKEASESMMQQDQKHHAHAPQKEEGRG  505

Query  524  SSN-DPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQ  348
            S N D  ++GYGSKG+KIHYSGPLLVPS+  DQ+LKDHDR IQEA RRARLDKAK R  Q
Sbjct  506  SRNKDSNLVGYGSKGHKIHYSGPLLVPSSNHDQMLKDHDRQIQEAVRRARLDKAKMRRLQ  565

Query  347  VEKNQISTGSLVVSGR  300
             E +QIS  SL VSGR
Sbjct  566  AEGSQISN-SLFVSGR  580



>gb|KJB45709.1| hypothetical protein B456_007G322800 [Gossypium raimondii]
Length=700

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            VA R SL  ++  E+SG    + PK+I+RFPGSFKE+S++ ++Q+ K+   + ++GR+++
Sbjct  568  VAPRTSLASDDCTEKSGFPQSKAPKMIARFPGSFKESSESGIQQDPKNNEQEKEDGRNNN  627

Query  518  NDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVEK  339
             DPV+LGYGSKG+KIHYSGPLLVPS  +DQ+LKDHDR IQEA RRAR+DKAK R   +E 
Sbjct  628  KDPVLLGYGSKGHKIHYSGPLLVPSGNMDQMLKDHDRQIQEAVRRARVDKAKMRKNLLEG  687

Query  338  NQISTGSLVVSGR  300
            NQIST SL VSGR
Sbjct  688  NQISTKSLFVSGR  700



>ref|XP_003543242.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
 ref|XP_006594767.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Glycine max]
Length=712

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH--QNDEGRS  525
            VAARRS+L ++  E SG +  E PKLISRFPGSFKEAS++ M+Q+QK   H  Q +EGR 
Sbjct  578  VAARRSMLSDDRREWSGSSQAEAPKLISRFPGSFKEASESMMQQDQKHHAHAPQKEEGRG  637

Query  524  SSN-DPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQ  348
            S N D  ++GYGSKG+KIHYSGPLLVPS+  DQ+LKDHDR IQEA RRARLDKAK R  Q
Sbjct  638  SRNKDSNLVGYGSKGHKIHYSGPLLVPSSNHDQMLKDHDRQIQEAVRRARLDKAKMRRLQ  697

Query  347  VEKNQISTGSLVVSGR  300
             E +QIS  SL VSGR
Sbjct  698  AEGSQISN-SLFVSGR  712



>ref|XP_007149459.1| hypothetical protein PHAVU_005G071900g [Phaseolus vulgaris]
 gb|ESW21453.1| hypothetical protein PHAVU_005G071900g [Phaseolus vulgaris]
Length=708

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 106/136 (78%), Gaps = 4/136 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH--QNDEGRS  525
            VAA RS+L ++  E+SG +  E  KLISRFPGSFKEAS++ ++Q+QK   H  Q +EGR+
Sbjct  574  VAASRSMLSDDRRERSGSSQAEAQKLISRFPGSFKEASESMLQQDQKHHAHAPQKEEGRA  633

Query  524  SSN-DPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQ  348
            SSN D  ++GYGSKG+KIHYSGPLLVPS+ +DQ+LKDHDR IQEA RR+RLDKAK R  Q
Sbjct  634  SSNKDSSLVGYGSKGHKIHYSGPLLVPSSNMDQMLKDHDRQIQEAVRRSRLDKAKMRRLQ  693

Query  347  VEKNQISTGSLVVSGR  300
             E NQI T SL VSGR
Sbjct  694  AEGNQI-TNSLFVSGR  708



>ref|XP_003540463.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Glycine max]
Length=708

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH--QNDEGRS  525
            VAARRS+L ++  E+SG +    PKLI+RFPGSFKEAS++ M+Q+QK   H  Q +EGR 
Sbjct  574  VAARRSMLSDDRRERSGSSQTVAPKLINRFPGSFKEASESMMQQDQKYHAHVPQKEEGRG  633

Query  524  SSN-DPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQ  348
            SSN D  ++GYGSKG+KIH+SGPLLVPS+  DQ+LKDHDR IQE  RRARLDKAK R  Q
Sbjct  634  SSNKDSNLVGYGSKGHKIHHSGPLLVPSSNHDQMLKDHDRQIQEVVRRARLDKAKMRRLQ  693

Query  347  VEKNQISTGSLVVSGR  300
             E NQI T SL VSGR
Sbjct  694  TEGNQI-TNSLFVSGR  708



>gb|KHN28061.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=708

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH--QNDEGRS  525
            VAARRS+L ++  E+SG +    PKLI+RFPGSFKEAS++ M+Q+QK   H  Q +EGR 
Sbjct  574  VAARRSMLSDDRRERSGSSQTVAPKLINRFPGSFKEASESMMQQDQKYHAHVPQKEEGRG  633

Query  524  SSN-DPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQ  348
            SSN D  ++GYGSKG+KIH+SGPLLVPS+  DQ+LKDHDR IQE  RRARLDKAK R  Q
Sbjct  634  SSNKDSNLVGYGSKGHKIHHSGPLLVPSSNHDQMLKDHDRQIQEVVRRARLDKAKMRRLQ  693

Query  347  VEKNQISTGSLVVSGR  300
             E NQI T SL VSGR
Sbjct  694  TEGNQI-TNSLFVSGR  708



>ref|XP_003596750.1| Serine/threonine protein kinase cdk9 [Medicago truncatula]
 gb|AES67001.1| cyclin-dependent kinase [Medicago truncatula]
Length=712

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 104/137 (76%), Gaps = 5/137 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQ--KSQVH--QNDEG  531
            VAARRS+L ++  E SG +  E PKLI+RFPGSFKEAS++ M+QNQ  K  VH  Q ++ 
Sbjct  577  VAARRSMLSDDRRESSGSSQVEAPKLITRFPGSFKEASESLMQQNQNQKHHVHASQKEDA  636

Query  530  RSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnA  351
            + S+ DP  +GYGSKG KIHYSGPLLVPS+ +DQ+LKDHDR IQEA RRARLDKAK R  
Sbjct  637  KGSNKDPNNVGYGSKGYKIHYSGPLLVPSSNMDQMLKDHDRQIQEAVRRARLDKAKMRRL  696

Query  350  QVEKNQISTGSLVVSGR  300
            Q E NQI+  SL VSGR
Sbjct  697  QAEGNQINN-SLFVSGR  712



>ref|XP_006370257.1| hypothetical protein POPTR_0001s41040g [Populus trichocarpa]
 gb|ERP66826.1| hypothetical protein POPTR_0001s41040g [Populus trichocarpa]
Length=713

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 102/138 (74%), Gaps = 6/138 (4%)
 Frame = -3

Query  695  AARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQK------SQVHQNDE  534
            AARRSLL E+  E+SG +  E PKL++RFPGSFKE S++  +Q+ +      +  HQ ++
Sbjct  576  AARRSLLSEDHRERSGLSQPEVPKLMARFPGSFKETSESFAQQDPQRLSQGVAGSHQKED  635

Query  533  GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarn  354
            GR++S DPV+LGYGSK +KIHYSGPL+VPS  +DQ+LKDHDR IQEA RRAR DKA+ R 
Sbjct  636  GRNNSKDPVLLGYGSKAHKIHYSGPLIVPSGNMDQMLKDHDRQIQEAVRRARFDKARVRK  695

Query  353  AQVEKNQISTGSLVVSGR  300
             Q E  QIS  SL VSGR
Sbjct  696  VQAESYQISANSLFVSGR  713



>gb|KHG22910.1| hypothetical protein F383_06618 [Gossypium arboreum]
Length=691

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            VA R +L+ E+  E+SG +  E PKL +RFPGSFKEAS++ ++Q+Q+  V Q ++GRS +
Sbjct  571  VARRNNLISEDHRERSGSSQSEAPKLFARFPGSFKEASESFIQQDQEHNVQQKEDGRSDN  630

Query  518  NDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             DPV+LGYGSKGNKIHYSGPLLVPS  VDQ+LKDHDR IQE
Sbjct  631  KDPVLLGYGSKGNKIHYSGPLLVPSGNVDQMLKDHDRQIQE  671



>gb|EYU26381.1| hypothetical protein MIMGU_mgv1a002080mg [Erythranthe guttata]
Length=718

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEAS-DTTMKQNQKSQVHQNDEGRSS  522
            VAARRS+L E   E+S  ++ E PKLISRFPGSFKEAS +++  Q+QK+ V   DE  S 
Sbjct  586  VAARRSMLSEERREKSY-SHHEVPKLISRFPGSFKEASSNSSTGQDQKNNVQYEDERASH  644

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
            +N+P  LG GS+G KIHYSGPLLVPS +VDQILKDHDR IQEA RRAR+DK + R  Q E
Sbjct  645  NNNPANLGKGSRGKKIHYSGPLLVPSGKVDQILKDHDRQIQEAVRRARMDKERMRKLQSE  704

Query  341  KNQISTGSLVVSGR  300
             N+IST SL VSGR
Sbjct  705  GNKISTNSLFVSGR  718



>ref|XP_011004643.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
 ref|XP_011004644.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
Length=713

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 101/138 (73%), Gaps = 6/138 (4%)
 Frame = -3

Query  695  AARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH------QNDE  534
            AARRSLL E+  E+SG +  E PKL++RFPGSFKE S++  +Q+ K          Q ++
Sbjct  576  AARRSLLSEDHRERSGLSQPEVPKLMARFPGSFKETSESFAQQDPKHLSQGVAGSLQKED  635

Query  533  GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarn  354
            GR++S DPV+LGYGSK +KIHYSGPL+VPS  +DQ+LKDHDR IQEA RRARLDKA+ R 
Sbjct  636  GRNNSKDPVLLGYGSKAHKIHYSGPLIVPSGNMDQMLKDHDRQIQEAVRRARLDKARVRK  695

Query  353  AQVEKNQISTGSLVVSGR  300
             Q E  QIS  SL VSGR
Sbjct  696  VQAESYQISANSLFVSGR  713



>ref|XP_011098308.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
 ref|XP_011098309.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
Length=708

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 103/134 (77%), Gaps = 4/134 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQN-QKSQVHQNDEGRSS  522
            VAARRS+L +   E+S  + +  PKLISRFPGSFKEAS++  +Q+ QK+   Q DE    
Sbjct  578  VAARRSMLSDEHREKSY-SQQGVPKLISRFPGSFKEASNSMTRQDHQKNNGLQEDE--KG  634

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
            +N+PV++G GSKGNKIHYSGPLLVPS +VDQ+LKDHDR IQEA RRARLDK + R  QVE
Sbjct  635  NNNPVLVGRGSKGNKIHYSGPLLVPSGKVDQMLKDHDRQIQEAVRRARLDKERMRKMQVE  694

Query  341  KNQISTGSLVVSGR  300
             NQ+ST SL VSGR
Sbjct  695  GNQLSTNSLFVSGR  708



>ref|XP_008226629.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Prunus mume]
Length=704

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV-HQNDEGRSS  522
            VAARRS+L E   ++S  +  E PK+I RFPGSFKEASD   K  +++ V  +  E   S
Sbjct  571  VAARRSMLSEERRKRSSSSQMEGPKVIGRFPGSFKEASDPLPKDQKQAVVGSRQKEDVRS  630

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
            + DP+I+GYGSKG+K+HYSGPLLVPS  +DQ+LKDHD  +QEA RRARL+KAK R  Q E
Sbjct  631  NKDPIIVGYGSKGHKMHYSGPLLVPSGNMDQMLKDHDLQVQEAVRRARLEKAKVRKFQAE  690

Query  341  KNQISTGSLVVSGR  300
             NQIST SL VSGR
Sbjct  691  GNQISTNSLFVSGR  704



>ref|XP_007214536.1| hypothetical protein PRUPE_ppa002182mg [Prunus persica]
 gb|EMJ15735.1| hypothetical protein PRUPE_ppa002182mg [Prunus persica]
Length=704

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV-HQNDEGRSS  522
            VAARRS+L E   ++S  +  E PK+I RFPGSFKEASD   K  +++ V  +  E   S
Sbjct  571  VAARRSMLSEERRKRSSSSQMEGPKVIGRFPGSFKEASDPLPKDQKQAVVGSRQKEDVRS  630

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
            + DP+I+GYGSKG+K+HYSGPLLVPS  +DQ+LKDHD  +QEA RRARL+KAK R  Q E
Sbjct  631  NKDPIIVGYGSKGHKMHYSGPLLVPSGNMDQMLKDHDLQVQEAVRRARLEKAKVRKFQAE  690

Query  341  KNQISTGSLVVSGR  300
             NQIST SL VSGR
Sbjct  691  GNQISTNSLFVSGR  704



>ref|XP_004296506.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Fragaria vesca subsp. vesca]
 ref|XP_011462384.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Fragaria vesca subsp. vesca]
Length=705

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            VAARRS+L E   ++S  +  + PK I RFPGSFKEA+D  +  +QK  V  N +    S
Sbjct  573  VAARRSMLTEERRKRSNSSQMDVPKAIGRFPGSFKEATDP-LPHDQKPIVPSNKKDDVRS  631

Query  518  N-DPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
            N DPVI+GYGSKG+KIHYSGPLLVPS  +DQ+LKDHD  +QEA RRAR+DKAK R  Q E
Sbjct  632  NKDPVIVGYGSKGHKIHYSGPLLVPSGNMDQMLKDHDFQVQEAVRRARIDKAKVRKYQAE  691

Query  341  KNQISTGSLVVSGR  300
             NQIST SL VSGR
Sbjct  692  SNQISTNSLFVSGR  705



>ref|XP_008386179.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=703

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 98/136 (72%), Gaps = 6/136 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV---HQNDEGR  528
            V ARRS+L E   ++S  +  E PK I RFPGSFKEASD  ++Q+QK  +   HQ D   
Sbjct  571  VVARRSMLSEERRKRSSSSQMEVPKAIGRFPGSFKEASD-PLQQDQKQVIEGSHQKDI--  627

Query  527  SSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQ  348
             S+ DP+I+GYGSKG+K+HYSGPLLVPS  VDQ+LKDHD  +QEA RRARLDKAK R   
Sbjct  628  RSNKDPIIVGYGSKGHKMHYSGPLLVPSGNVDQMLKDHDLQVQEAVRRARLDKAKVRKFH  687

Query  347  VEKNQISTGSLVVSGR  300
             E NQIST SL VSGR
Sbjct  688  AEANQISTNSLFVSGR  703



>ref|XP_009341042.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
Length=704

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 98/136 (72%), Gaps = 5/136 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV---HQNDEGR  528
            V ARRS+  E   ++S  +  E PK I  FPGSFKEASD  ++Q+QK  +   HQ ++ R
Sbjct  571  VVARRSMFSEERRKRSSSSQMEVPKAIGTFPGSFKEASDP-LQQDQKQVIAGSHQKEDIR  629

Query  527  SSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQ  348
            S+  DP+I+GYGS+G+K+HYSGPLLVPS  VDQ+LKDHD  +QEA RRARLDKAK R   
Sbjct  630  SN-KDPIIVGYGSRGHKMHYSGPLLVPSGNVDQMLKDHDLQVQEAVRRARLDKAKVRKFH  688

Query  347  VEKNQISTGSLVVSGR  300
             E NQIST SL VSGR
Sbjct  689  AEANQISTNSLFVSGR  704



>ref|XP_009356808.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
 ref|XP_009356809.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Pyrus x bretschneideri]
Length=704

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTM-KQNQKSQVHQNDEGRSS  522
            VAARRS+L E   ++S  +  E PK I RFPGSFKEASD     Q Q +      E   S
Sbjct  571  VAARRSMLSEERRKRSSSSQMEVPKAIGRFPGSFKEASDPLQHDQKQANAGSCQKEDIRS  630

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
            + DP+I+GYGSKG+K+HYSGPLLVPS   DQ+LKDHD  +QEA RRARLDKAK R    E
Sbjct  631  NKDPIIVGYGSKGHKMHYSGPLLVPSGNTDQMLKDHDLQVQEAVRRARLDKAKVRKFHAE  690

Query  341  KNQISTGSLVVSGR  300
             NQIST SL VSGR
Sbjct  691  ANQISTNSLFVSGR  704



>ref|XP_008366989.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
 ref|XP_008366997.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=704

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTM-KQNQKSQVHQNDEGRSS  522
            V ARRS+L E   ++S  +  E PK I RFPGSFKEASD     Q Q +   +  E   S
Sbjct  571  VVARRSMLSEERRKRSSSSQMEVPKAIGRFPGSFKEASDPLQHNQKQANAGSRQKEDIRS  630

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
            + DP+I+GYGSKG+K+HYSGPLLVPS   DQ+LKDHD  +QEA RRARLDKAK R    E
Sbjct  631  NKDPIIVGYGSKGHKMHYSGPLLVPSGNTDQMLKDHDLQVQEAVRRARLDKAKVRKFHAE  690

Query  341  KNQISTGSLVVSGR  300
             NQIST SL VSGR
Sbjct  691  ANQISTNSLFVSGR  704



>ref|XP_003527250.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
Length=710

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 100/139 (72%), Gaps = 9/139 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            + A RS+L ++  E+SG +  E  KL++RFPGSFK+ S+  +KQ+Q+  V       Q +
Sbjct  575  LVAARSMLSDDRRERSGSSQMEASKLMNRFPGSFKDISELLIKQDQRHHVPGQVGTSQKE  634

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            EGRSS+ D V++GYGSKG+KIHYSGPL   S+ +DQ+LKDHDR IQEA RRARLDKAK R
Sbjct  635  EGRSSNKDLVLVGYGSKGHKIHYSGPLT--SSNMDQVLKDHDRQIQEAVRRARLDKAKMR  692

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q E NQI T SL VSGR
Sbjct  693  RLQAEGNQI-TNSLFVSGR  710



>ref|XP_006582172.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Glycine max]
Length=711

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 100/139 (72%), Gaps = 9/139 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            + A RS+L ++  E+SG +  E  KL++RFPGSFK+ S+  +KQ+Q+  V       Q +
Sbjct  576  LVAARSMLSDDRRERSGSSQMEASKLMNRFPGSFKDISELLIKQDQRHHVPGQVGTSQKE  635

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            EGRSS+ D V++GYGSKG+KIHYSGPL   S+ +DQ+LKDHDR IQEA RRARLDKAK R
Sbjct  636  EGRSSNKDLVLVGYGSKGHKIHYSGPLT--SSNMDQVLKDHDRQIQEAVRRARLDKAKMR  693

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q E NQI T SL VSGR
Sbjct  694  RLQAEGNQI-TNSLFVSGR  711



>ref|XP_006582173.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X3 [Glycine max]
Length=710

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 100/139 (72%), Gaps = 9/139 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            + A RS+L ++  E+SG +  E  KL++RFPGSFK+ S+  +KQ+Q+  V       Q +
Sbjct  575  LVAARSMLSDDRRERSGSSQMEASKLMNRFPGSFKDISELLIKQDQRHHVPGQVGTSQKE  634

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            EGRSS+ D V++GYGSKG+KIHYSGPL   S+ +DQ+LKDHDR IQEA RRARLDKAK R
Sbjct  635  EGRSSNKDLVLVGYGSKGHKIHYSGPLT--SSNMDQVLKDHDRQIQEAVRRARLDKAKMR  692

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q E NQI T SL VSGR
Sbjct  693  RLQAEGNQI-TNSLFVSGR  710



>ref|XP_006582174.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X4 [Glycine max]
Length=709

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 100/139 (72%), Gaps = 9/139 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            + A RS+L ++  E+SG +  E  KL++RFPGSFK+ S+  +KQ+Q+  V       Q +
Sbjct  574  LVAARSMLSDDRRERSGSSQMEASKLMNRFPGSFKDISELLIKQDQRHHVPGQVGTSQKE  633

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            EGRSS+ D V++GYGSKG+KIHYSGPL   S+ +DQ+LKDHDR IQEA RRARLDKAK R
Sbjct  634  EGRSSNKDLVLVGYGSKGHKIHYSGPLT--SSNMDQVLKDHDRQIQEAVRRARLDKAKMR  691

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q E NQI T SL VSGR
Sbjct  692  RLQAEGNQI-TNSLFVSGR  709



>ref|XP_003540111.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X1 [Glycine max]
 gb|KHN44914.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=710

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 100/139 (72%), Gaps = 9/139 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH------QND  537
            + A RS+L ++  E+SG +  E  KL +RFPGSFK+ S++++KQ+Q+  V       Q +
Sbjct  575  LVAARSMLSDDRRERSGSSQTEASKLTNRFPGSFKDFSESSIKQDQRHHVQGQVGTSQKE  634

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            EGRSS+ D V++GYGS+G+KIHYSGPL   S+ +DQ+LKDHDR IQEA RRARLDKAK R
Sbjct  635  EGRSSNKDLVLVGYGSEGHKIHYSGPLT--SSNMDQVLKDHDRQIQEAVRRARLDKAKIR  692

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q E NQ+ T SL VS R
Sbjct  693  RLQAEGNQV-TNSLFVSKR  710



>ref|XP_006592612.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X3 [Glycine max]
Length=710

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 100/139 (72%), Gaps = 9/139 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH------QND  537
            + A RS+L ++  E+SG +  E  KL +RFPGSFK+ S++++KQ+Q+  V       Q +
Sbjct  575  LVAARSMLSDDRRERSGSSQTEASKLTNRFPGSFKDFSESSIKQDQRHHVQGQVGTSQKE  634

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            EGRSS+ D V++GYGS+G+KIHYSGPL   S+ +DQ+LKDHDR IQEA RRARLDKAK R
Sbjct  635  EGRSSNKDLVLVGYGSEGHKIHYSGPLT--SSNMDQVLKDHDRQIQEAVRRARLDKAKIR  692

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q E NQ+ T SL VS R
Sbjct  693  RLQAEGNQV-TNSLFVSKR  710



>ref|XP_006592611.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
isoform X2 [Glycine max]
Length=711

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 100/139 (72%), Gaps = 9/139 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH------QND  537
            + A RS+L ++  E+SG +  E  KL +RFPGSFK+ S++++KQ+Q+  V       Q +
Sbjct  576  LVAARSMLSDDRRERSGSSQTEASKLTNRFPGSFKDFSESSIKQDQRHHVQGQVGTSQKE  635

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            EGRSS+ D V++GYGS+G+KIHYSGPL   S+ +DQ+LKDHDR IQEA RRARLDKAK R
Sbjct  636  EGRSSNKDLVLVGYGSEGHKIHYSGPLT--SSNMDQVLKDHDRQIQEAVRRARLDKAKIR  693

Query  356  nAQVEKNQISTGSLVVSGR  300
              Q E NQ+ T SL VS R
Sbjct  694  RLQAEGNQV-TNSLFVSKR  711



>ref|XP_010272444.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nelumbo nucifera]
 ref|XP_010272445.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nelumbo nucifera]
 ref|XP_010272446.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nelumbo nucifera]
Length=708

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 7/107 (7%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQK--SQV----HQND  537
            + A R+LL ++  E+SGP+  +   LIS+ PGSF EAS+++ K+++K  +QV    HQ +
Sbjct  573  LVAARNLLSDDRREKSGPSQLDVTNLISKLPGSFNEASESSAKEDRKLHTQVFVGSHQKE  632

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            +GR+S N   +LGYGSKGNKIHYSGPLLVPS  VDQ+LKDHDR IQE
Sbjct  633  DGRAS-NKEQLLGYGSKGNKIHYSGPLLVPSGNVDQMLKDHDRQIQE  678



>ref|XP_010112974.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXC35133.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=897

 Score =   111 bits (277),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 78/106 (74%), Gaps = 6/106 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV-----HQNDE  534
            V ARRSLL E+  ++S     E  K+ +RFP +FKE +D++ +Q+QK  +     +Q ++
Sbjct  573  VVARRSLLAEDHRDRSSSLQPEVSKVTARFPSAFKETTDSS-RQDQKPHIQVIGPNQKED  631

Query  533  GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            GR SS DP+ +GYGSKG+KIHYSGPLLVPS+ +DQ+LKDHDR +QE
Sbjct  632  GRHSSKDPIPIGYGSKGHKIHYSGPLLVPSSNMDQMLKDHDRQVQE  677



>ref|XP_010260204.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nelumbo nucifera]
Length=714

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 6/138 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQK--SQV----HQND  537
            + A R+LL ++  E+SGP+  E   L+SR PGSF EAS++  KQ++K  +QV    HQ +
Sbjct  573  LVAARNLLSDDRREKSGPSQSEMTSLLSRLPGSFNEASESNRKQDRKHHAQVLVGSHQKE  632

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            + R+S+ + ++ GYGSKG+KIHYSGPLL+PS  VDQ+LKDHDR +QE  RR +LDKAK R
Sbjct  633  DERTSNKEKILQGYGSKGHKIHYSGPLLLPSDNVDQMLKDHDRQLQEVVRRKKLDKAKLR  692

Query  356  nAQVEKNQISTGSLVVSG  303
              Q   N I    +  SG
Sbjct  693  KLQAAGNPIFGNPMSTSG  710



>ref|XP_010260205.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Nelumbo nucifera]
Length=713

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 93/138 (67%), Gaps = 7/138 (5%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQK--SQV----HQND  537
            + A R+LL ++  E+SGP+  E   L+SR PGSF EAS++  KQ++K  +QV    HQ +
Sbjct  573  LVAARNLLSDDRREKSGPSQSEMTSLLSRLPGSFNEASESNRKQDRKHHAQVLVGSHQKE  632

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
            + R+S N   ILGYGSKG+KIHYSGPLL+PS  VDQ+LKDHDR +QE  RR +LDKAK R
Sbjct  633  DERTS-NKEKILGYGSKGHKIHYSGPLLLPSDNVDQMLKDHDRQLQEVVRRKKLDKAKLR  691

Query  356  nAQVEKNQISTGSLVVSG  303
              Q   N I    +  SG
Sbjct  692  KLQAAGNPIFGNPMSTSG  709



>ref|XP_006392837.1| hypothetical protein EUTSA_v10011275mg [Eutrema salsugineum]
 gb|ESQ30123.1| hypothetical protein EUTSA_v10011275mg [Eutrema salsugineum]
Length=700

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 70/101 (69%), Gaps = 9/101 (9%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            VAA  S +    A ++G + +E  + ++R PGSFKE SD T         +Q + GRS+ 
Sbjct  573  VAADYSAMPGFAATRTGASQQETCRGMTRLPGSFKETSDET---------NQEENGRSNK  623

Query  518  NDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             DP++LGYGSKG+KIHYSGPL+VPS  +DQ+LKDHDRHIQE
Sbjct  624  KDPILLGYGSKGHKIHYSGPLVVPSGNMDQVLKDHDRHIQE  664



>ref|NP_175713.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAF87863.1|AC022520_7 similar to cdc2 protein kinase [Arabidopsis thaliana]
 gb|AEE32884.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=694

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 64/89 (72%), Gaps = 9/89 (10%)
 Frame = -3

Query  662  AEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKG  483
            A ++G   +E  + ++R PGSFKE S+         + +Q + GRS+  DP++LGYGSKG
Sbjct  579  ATRTGAPQQETCRGMTRLPGSFKETSE---------EANQEENGRSNKKDPILLGYGSKG  629

Query  482  NKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            +KIHYSGPL+VPS  +DQ+LKDHDRHIQE
Sbjct  630  HKIHYSGPLVVPSGNMDQVLKDHDRHIQE  658



>gb|AAO42182.1| putative cell division-related protein [Arabidopsis thaliana]
Length=694

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 64/89 (72%), Gaps = 9/89 (10%)
 Frame = -3

Query  662  AEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKG  483
            A ++G   +E  + ++R PGSFKE S+         + +Q + GRS+  DP++LGYGSKG
Sbjct  579  ATRTGAPQQETCRGMTRLPGSFKETSE---------EANQEENGRSNKKDPILLGYGSKG  629

Query  482  NKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            +KIHYSGPL+VPS  +DQ+LKDHDRHIQE
Sbjct  630  HKIHYSGPLVVPSGNMDQVLKDHDRHIQE  658



>emb|CDY25738.1| BnaC03g69370D [Brassica napus]
Length=659

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 76/102 (75%), Gaps = 12/102 (12%)
 Frame = -3

Query  620  ISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSA  441
            ++R PGSFKE S+         + +Q + GRS+  DP++LGYGSKG+KIHYSGPL+VPS 
Sbjct  558  MTRLPGSFKEVSE---------EANQEENGRSNKKDPILLGYGSKGHKIHYSGPLVVPSG  608

Query  440  RVDQILKDHDRHIQEaarrarldkakarnAQVEKN---QIST  324
             +DQ+LKDHDRHIQEA RRAR+DKA+ R  Q E++   Q+ST
Sbjct  609  NMDQVLKDHDRHIQEAVRRARIDKARVRKHQAEEDSSQQVST  650



>emb|CDY02525.1| BnaA08g01320D [Brassica napus]
Length=660

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 57/75 (76%), Gaps = 9/75 (12%)
 Frame = -3

Query  620  ISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSA  441
            ++R PGSFKE S+         + +Q + GRS+  DP++LGYGSKG+KIHYSGPL+VPS 
Sbjct  559  MTRLPGSFKEVSE---------EANQEENGRSNKKDPILLGYGSKGHKIHYSGPLVVPSG  609

Query  440  RVDQILKDHDRHIQE  396
             +DQ+LKDHDRHIQE
Sbjct  610  NMDQVLKDHDRHIQE  624



>ref|XP_010479840.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=689

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 9/87 (10%)
 Frame = -3

Query  656  QSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNK  477
            ++G   +E  + ++R PGSFKE S+         + +Q + GR++  DP++LGYGSKG+K
Sbjct  575  RTGAPQQETCRGMTRLPGSFKETSE---------EANQEENGRNNKKDPILLGYGSKGHK  625

Query  476  IHYSGPLLVPSARVDQILKDHDRHIQE  396
            IHYSGPL+VPS  +DQ+LKDHDRHIQE
Sbjct  626  IHYSGPLVVPSGNMDQVLKDHDRHIQE  652



>ref|XP_009107008.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brassica rapa]
Length=673

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 57/75 (76%), Gaps = 9/75 (12%)
 Frame = -3

Query  620  ISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSA  441
            ++R PGSFKE S+         + +Q + GRS+  DP++LGYGSKG+KIHYSGPL+VPS 
Sbjct  572  MTRLPGSFKEVSE---------EANQEENGRSNKKDPILLGYGSKGHKIHYSGPLVVPSG  622

Query  440  RVDQILKDHDRHIQE  396
             +DQ+LKDHDRHIQE
Sbjct  623  NMDQVLKDHDRHIQE  637



>ref|XP_010462163.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=691

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 9/87 (10%)
 Frame = -3

Query  656  QSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNK  477
            ++G   +E  + ++R PGSFKE S+         + +Q + GR++  DP++LGYGSKG+K
Sbjct  577  RTGVPQQETCRGMTRLPGSFKETSE---------EANQEENGRNNKKDPILLGYGSKGHK  627

Query  476  IHYSGPLLVPSARVDQILKDHDRHIQE  396
            IHYSGPL+VPS  +DQ+LKDHDRHIQE
Sbjct  628  IHYSGPLVVPSGNMDQVLKDHDRHIQE  654



>ref|XP_010545831.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
 ref|XP_010545832.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
Length=679

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 79/108 (73%), Gaps = 7/108 (6%)
 Frame = -3

Query  620  ISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSA  441
            ++R  GSFK A + + + NQ+      ++GRS+  DP+++GYGSKG KIHYSGPL+VPS 
Sbjct  578  MARLSGSFKGAVEISAESNQR------NDGRSNKQDPILMGYGSKGYKIHYSGPLVVPSG  631

Query  440  RVDQILKDHDRHIQEaarrarldkakarnAQV-EKNQISTGSLVVSGR  300
             +DQ+LK+HDRH+QEA RRAR+DKA+ R  Q  E +Q+ T  L VSGR
Sbjct  632  NMDQMLKEHDRHVQEAVRRARIDKARVRKVQADETSQVPTNPLSVSGR  679



>ref|XP_009144802.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brassica rapa]
 emb|CDY25881.1| BnaA05g14720D [Brassica napus]
Length=682

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 9/89 (10%)
 Frame = -3

Query  662  AEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKG  483
            A ++  + +E  + ++R PGSFKE S+         + +Q + GRS+  D V+LGYGSKG
Sbjct  567  ATRTSASQQETCRGMTRLPGSFKETSE---------EANQEENGRSNKKDSVLLGYGSKG  617

Query  482  NKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            +KIHYSGPL+VPS  +DQ+LKDHDRHIQE
Sbjct  618  HKIHYSGPLVVPSGNMDQVLKDHDRHIQE  646



>ref|XP_006303920.1| hypothetical protein CARUB_v10008475mg [Capsella rubella]
 ref|XP_006303921.1| hypothetical protein CARUB_v10008475mg [Capsella rubella]
 gb|EOA36818.1| hypothetical protein CARUB_v10008475mg [Capsella rubella]
 gb|EOA36819.1| hypothetical protein CARUB_v10008475mg [Capsella rubella]
Length=694

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 61/87 (70%), Gaps = 9/87 (10%)
 Frame = -3

Query  656  QSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNK  477
            ++G   +E  + ++R PGSFKE S+         + +Q + GRS+  DP++LGYGSKG+ 
Sbjct  581  RTGAPQQETCRGMTRLPGSFKETSE---------EANQEENGRSNKKDPILLGYGSKGHT  631

Query  476  IHYSGPLLVPSARVDQILKDHDRHIQE  396
            IHYSGPL+ PS  +DQ+LKDHDRHIQE
Sbjct  632  IHYSGPLVAPSGNMDQVLKDHDRHIQE  658



>gb|KFK35750.1| hypothetical protein AALP_AA4G031500 [Arabis alpina]
Length=702

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 9/75 (12%)
 Frame = -3

Query  620  ISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSA  441
            ++R PGSFKE S+ T         +Q + GR++  DP++LGYGSKG+KIHYSGPL+VPS 
Sbjct  601  MTRLPGSFKETSEET---------NQEENGRTNKKDPILLGYGSKGHKIHYSGPLVVPSG  651

Query  440  RVDQILKDHDRHIQE  396
             +DQ+LKDHD HIQE
Sbjct  652  NMDQVLKDHDLHIQE  666



>ref|XP_010500934.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Camelina sativa]
Length=696

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 62/87 (71%), Gaps = 9/87 (10%)
 Frame = -3

Query  656  QSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNK  477
            ++G   +E  + ++R  GSFKE S+         + +Q + GR++  DP++LGYGSKG+K
Sbjct  582  RTGAPQQETCRGMTRLSGSFKETSE---------EANQEENGRNNKKDPILLGYGSKGHK  632

Query  476  IHYSGPLLVPSARVDQILKDHDRHIQE  396
            IHYSGPL+VPS  +DQ+LKDHDRHIQE
Sbjct  633  IHYSGPLVVPSGNMDQVLKDHDRHIQE  659



>ref|XP_010535099.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
 ref|XP_010535100.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Tarenaya hassleriana]
Length=677

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 7/75 (9%)
 Frame = -3

Query  617  SRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSN-DPVILGYGSKGNKIHYSGPLLVPSA  441
            +R  GSFKEA++ + + NQ+      DEGRS+   DP++LGYGSKG+KIHYSGPL+VPS 
Sbjct  578  TRLSGSFKEAAEISAEPNQR------DEGRSNKKKDPILLGYGSKGHKIHYSGPLVVPSG  631

Query  440  RVDQILKDHDRHIQE  396
             ++Q+LKDHDRHIQE
Sbjct  632  NMEQMLKDHDRHIQE  646



>emb|CDY50511.1| BnaC06g10110D [Brassica napus]
Length=691

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 9/83 (11%)
 Frame = -3

Query  644  TNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYS  465
            + +E  + +SR PGSFKE S+         + +Q + GR +  D V+LGYGSKG+KIHYS
Sbjct  582  SQQETCRGMSRLPGSFKETSE---------EANQEENGRRNKQDSVLLGYGSKGHKIHYS  632

Query  464  GPLLVPSARVDQILKDHDRHIQE  396
            GPL+VPS  +DQ+LKDHDRHIQE
Sbjct  633  GPLVVPSGNMDQVLKDHDRHIQE  655



>ref|XP_002274225.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
 ref|XP_010656972.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
 ref|XP_010656973.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Vitis vinifera]
Length=710

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQK--SQVHQNDEGRS  525
            VA R S   E+  E+ GP+  EP   +SRFPGS  E+     K + K     +  ++G+ 
Sbjct  569  VATRTS--SEDRREKPGPSKLEPRNQMSRFPGSMNESGKHDRKHHNKFSEDSYLTEDGKG  626

Query  524  SSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            S+ +P++    S  NK+++SGPLLV S  VDQ+LKDHDR +QE
Sbjct  627  STKEPILQSNRSNTNKMYFSGPLLVTSNNVDQMLKDHDRKVQE  669



>ref|XP_010035763.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Eucalyptus grandis]
 gb|KCW47225.1| hypothetical protein EUGRSUZ_K01034 [Eucalyptus grandis]
Length=709

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 58/94 (62%), Gaps = 7/94 (7%)
 Frame = -3

Query  659  EQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQN------DEGRSSSNDPVILG  498
            ++SGP   E     SR+ G  +E  +   KQ+++S V  N      ++G SS+ +P + G
Sbjct  585  QKSGPLVSESANQASRYSGPIREM-EPARKQDRRSHVRTNIDYRSREDGNSSTKEPALYG  643

Query  497  YGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             GS GNKI+ SGPLLV S  VDQ+LK+HDR IQE
Sbjct  644  RGSAGNKIYVSGPLLVSSNNVDQMLKEHDRRIQE  677



>emb|CBI21859.3| unnamed protein product [Vitis vinifera]
Length=1442

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQK--SQVHQNDEGRS  525
            VA R S   E+  E+ GP+  EP   +SRFPGS  E+     K + K     +  ++G+ 
Sbjct  504  VATRTS--SEDRREKPGPSKLEPRNQMSRFPGSMNESGKHDRKHHNKFSEDSYLTEDGKG  561

Query  524  SSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            S+ +P++    S  NK+++SGPLLV S  VDQ+LKDHDR +QE
Sbjct  562  STKEPILQSNRSNTNKMYFSGPLLVTSNNVDQMLKDHDRKVQE  604



>ref|XP_007043608.1| ATP binding protein, putative [Theobroma cacao]
 gb|EOX99439.1| ATP binding protein, putative [Theobroma cacao]
Length=728

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 78/137 (57%), Gaps = 7/137 (5%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDE-----  534
            + A R+L  E+  E+ GP   E    + R   SF E  ++  KQN +  + +  E     
Sbjct  588  LVATRTLASEDHREKPGPLTLEAVNQVGRSQRSFNEL-ESAGKQNVRRHMPKTAESPQTG  646

Query  533  -GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakar  357
             GR+   +  + G GS+GNKI+ SGPLL PS  VDQ+LK+HDR IQE ARRARLDK K  
Sbjct  647  GGRACIKESSLHGRGSRGNKIYVSGPLLAPSDNVDQMLKEHDRKIQEFARRARLDKTKLG  706

Query  356  nAQVEKNQISTGSLVVS  306
              Q +  Q++  SL +S
Sbjct  707  KLQAQGKQVTENSLFLS  723



>ref|XP_010915425.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X4 [Elaeis guineensis]
Length=738

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 72/125 (58%), Gaps = 3/125 (2%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            VA  R+LL ++  E  G    +      R   S  E SD   K +Q    H  ++ RSS+
Sbjct  587  VAGSRNLLSDDGGEIIG-AQLKALAPAGRLSESGNEPSDAITKYDQ--IYHGKEDERSSN  643

Query  518  NDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVEK  339
             D  I   GSKGNKIHYSGPLL PS  VDQ+LKDHDR IQE  RRARLDK+K R  Q + 
Sbjct  644  MDQSIQSCGSKGNKIHYSGPLLRPSGNVDQMLKDHDRQIQEVFRRARLDKSKLRKVQGDG  703

Query  338  NQIST  324
            NQI  
Sbjct  704  NQIGA  708



>ref|XP_010915422.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Elaeis guineensis]
Length=746

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 72/125 (58%), Gaps = 3/125 (2%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            VA  R+LL ++  E  G    +      R   S  E SD   K +Q    H  ++ RSS+
Sbjct  595  VAGSRNLLSDDGGEIIG-AQLKALAPAGRLSESGNEPSDAITKYDQ--IYHGKEDERSSN  651

Query  518  NDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVEK  339
             D  I   GSKGNKIHYSGPLL PS  VDQ+LKDHDR IQE  RRARLDK+K R  Q + 
Sbjct  652  MDQSIQSCGSKGNKIHYSGPLLRPSGNVDQMLKDHDRQIQEVFRRARLDKSKLRKVQGDG  711

Query  338  NQIST  324
            NQI  
Sbjct  712  NQIGA  716



>ref|NP_001042320.2| Os01g0201000 [Oryza sativa Japonica Group]
 dbj|BAF04234.2| Os01g0201000, partial [Oryza sativa Japonica Group]
Length=127

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  554  QVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            QV Q  + RSS  D  I GYGSKGNKIH+SGPL+ PS  VDQ+LK++DR IQE
Sbjct  25   QVFQQKDDRSSRVDGAI-GYGSKGNKIHHSGPLICPSGNVDQMLKENDRQIQE  76



>ref|XP_008791729.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Phoenix dactylifera]
Length=736

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 72/123 (59%), Gaps = 3/123 (2%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            +A RR+LL ++ +E  G    +      R   S  E SD   K +Q    H  ++ RSS+
Sbjct  585  MAGRRNLLSDDGSEIIG-AQLKAIAPAGRLSESGNEPSDAITKYDQ--IYHGKEDDRSSN  641

Query  518  NDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVEK  339
             D  I   G+KG KIHYSGPLL PS  VDQ+LKDHDR IQE  RRARLDK+K R  Q   
Sbjct  642  MDQSIQSCGTKGTKIHYSGPLLRPSGNVDQMLKDHDRQIQEVFRRARLDKSKVRKVQGNG  701

Query  338  NQI  330
            NQI
Sbjct  702  NQI  704



>ref|XP_008794126.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Phoenix dactylifera]
Length=735

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 60/97 (62%), Gaps = 2/97 (2%)
 Frame = -3

Query  620  ISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSA  441
            I R   S  E SD T K  Q    H+ ++ R+S+ D     YG KGNKIHYSGPL  PS 
Sbjct  609  IGRLSESSNEPSDATRKYAQI--YHRKEDERNSNMDQYTQSYGPKGNKIHYSGPLPRPSG  666

Query  440  RVDQILKDHDRHIQEaarrarldkakarnAQVEKNQI  330
             +DQ+LKDHDR IQE  RRARLDK+K R  Q   NQI
Sbjct  667  NIDQMLKDHDRQIQEVFRRARLDKSKVRKVQGNGNQI  703



>gb|KHG29152.1| hypothetical protein F383_15438 [Gossypium arboreum]
Length=727

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 77/138 (56%), Gaps = 8/138 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEAS-----DTTMKQNQKSQVHQNDE  534
            + A R+L  E+  ++SGP   EP     R   SF E       D      + ++  Q   
Sbjct  590  LVATRTLAPED--QRSGPLTSEPVNQAGRSRRSFHELESAGKRDVRHHMPKTTESPQTAG  647

Query  533  GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarn  354
            GR+   +P + G G +GNKI+ SGPLL PS  VDQ+LK+HDR IQE ARRARLDK KA  
Sbjct  648  GRACIKEP-MHGCGPRGNKIYVSGPLLTPSENVDQLLKEHDRKIQEFARRARLDKIKAGK  706

Query  353  AQVEKNQISTGSLVVSGR  300
             Q +  Q++  SL V+ R
Sbjct  707  LQAQAKQVTENSLFVTAR  724



>ref|XP_002533553.1| Cell division protein kinase, putative [Ricinus communis]
 gb|EEF28833.1| Cell division protein kinase, putative [Ricinus communis]
Length=649

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 5/69 (7%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQ----VHQNDEG  531
            VAARRSLL E+  E+SG +  E PKL+SRFPGSFKE S++ + Q+QK Q     HQ D G
Sbjct  575  VAARRSLLSEDRRERSGSSQPEVPKLMSRFPGSFKEVSESFVHQDQKLQGVASSHQKD-G  633

Query  530  RSSSNDPVI  504
            R S+NDPV+
Sbjct  634  RISNNDPVL  642



>ref|XP_008229000.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Prunus mume]
Length=707

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 5/102 (5%)
 Frame = -3

Query  686  RSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTT----MKQNQK-SQVHQNDEGRSS  522
            R+ L E+  E+ GP+  E  K +   PGSF     T     M+ +Q+ ++  Q ++ ++ 
Sbjct  580  RTALSEDQQEKPGPSGPETTKQVGGVPGSFDVEESTKNQERMRYSQRIARSRQMEDEKAC  639

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
              +P + G G KGNKI+ SGPLLV S  VD++LK+HDR IQE
Sbjct  640  IKEPNMHGRGPKGNKIYVSGPLLVSSNNVDKMLKEHDRQIQE  681



>ref|XP_011037349.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Populus euphratica]
Length=717

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 61/107 (57%), Gaps = 7/107 (7%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH------QND  537
            + A R++L  +  E+ G    E    + R  GS     +++ K NQ  Q+       Q  
Sbjct  581  LVATRTILPGDHQEKPGVPQPEVVNQVGRLQGSL-NGLESSRKVNQNCQIKKMGDSPQAG  639

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             G+SS+ +P + G+G KGNKI+ SGPLL PS  V+Q+LK+HDR IQE
Sbjct  640  AGKSSNKEPSLHGHGPKGNKIYVSGPLLAPSNNVEQMLKEHDRQIQE  686



>ref|XP_010915426.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X5 [Elaeis guineensis]
Length=652

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 72/126 (57%), Gaps = 4/126 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            VA  R+LL ++  E  G    +      R   S  E SD   K +Q    H  ++ RSS+
Sbjct  500  VAGSRNLLSDDGGEIIG-AQLKALAPAGRLSESGNEPSDAITKYDQI--YHGKEDERSSN  556

Query  518  NDPVIL-GYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
             D  I    GSKGNKIHYSGPLL PS  VDQ+LKDHDR IQE  RRARLDK+K R  Q +
Sbjct  557  MDQSIQQSCGSKGNKIHYSGPLLRPSGNVDQMLKDHDRQIQEVFRRARLDKSKLRKVQGD  616

Query  341  KNQIST  324
             NQI  
Sbjct  617  GNQIGA  622



>ref|XP_010915423.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X3 [Elaeis guineensis]
Length=739

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 72/126 (57%), Gaps = 4/126 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            VA  R+LL ++  E  G    +      R   S  E SD   K +Q    H  ++ RSS+
Sbjct  587  VAGSRNLLSDDGGEIIG-AQLKALAPAGRLSESGNEPSDAITKYDQI--YHGKEDERSSN  643

Query  518  NDPVIL-GYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
             D  I    GSKGNKIHYSGPLL PS  VDQ+LKDHDR IQE  RRARLDK+K R  Q +
Sbjct  644  MDQSIQQSCGSKGNKIHYSGPLLRPSGNVDQMLKDHDRQIQEVFRRARLDKSKLRKVQGD  703

Query  341  KNQIST  324
             NQI  
Sbjct  704  GNQIGA  709



>ref|XP_009341988.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Pyrus x bretschneideri]
Length=710

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 5/102 (5%)
 Frame = -3

Query  686  RSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDT----TMKQNQK-SQVHQNDEGRSS  522
            R+ + +N  E+ GP+  E  K + RFPGSF +         M   Q+ +   Q ++  +S
Sbjct  580  RTAMSDNQQEKPGPSGPETIKPVGRFPGSFDQEESAKKQEWMHYTQRVTSSRQMEDETAS  639

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
              +P + G G KGNKI+ SGPL   S  VD++LK+HDR IQE
Sbjct  640  IKEPNMHGRGPKGNKIYMSGPLFASSNNVDRMLKEHDRQIQE  681



>ref|XP_010915421.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Elaeis guineensis]
Length=747

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 72/126 (57%), Gaps = 4/126 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            VA  R+LL ++  E  G    +      R   S  E SD   K +Q    H  ++ RSS+
Sbjct  595  VAGSRNLLSDDGGEIIG-AQLKALAPAGRLSESGNEPSDAITKYDQI--YHGKEDERSSN  651

Query  518  NDPVIL-GYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
             D  I    GSKGNKIHYSGPLL PS  VDQ+LKDHDR IQE  RRARLDK+K R  Q +
Sbjct  652  MDQSIQQSCGSKGNKIHYSGPLLRPSGNVDQMLKDHDRQIQEVFRRARLDKSKLRKVQGD  711

Query  341  KNQIST  324
             NQI  
Sbjct  712  GNQIGA  717



>ref|XP_009336211.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Pyrus x bretschneideri]
Length=710

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 5/102 (5%)
 Frame = -3

Query  686  RSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTT----MKQNQK-SQVHQNDEGRSS  522
            R+ + +N  E+ GP+  E  K + RFPGSF +         M   Q+ +   Q ++  +S
Sbjct  580  RTAMSDNQQEKPGPSGPETIKPVGRFPGSFDQEESAKKQERMHYTQRVTSSRQMEDETAS  639

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
              +P + G G KGNKI+ SGPL   S  VD++LK+HDR IQE
Sbjct  640  IKEPNMHGRGPKGNKIYMSGPLFASSNNVDRMLKEHDRQIQE  681



>gb|KJB77258.1| hypothetical protein B456_012G128100 [Gossypium raimondii]
Length=662

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 75/138 (54%), Gaps = 8/138 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEAS-----DTTMKQNQKSQVHQNDE  534
            + A R+L  E+   +SGP   EP     R   SF E       D      + ++  Q   
Sbjct  525  LVATRTLAPED--HRSGPLTSEPVNQAGRSRRSFHELESAGKLDVRHHMPKTTESPQTAG  582

Query  533  GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarn  354
            GR+   +P + G G +GNKI+ SGPLL PS  VDQ+LK+HDR IQE ARRARLDK KA  
Sbjct  583  GRACIKEP-MHGRGPRGNKIYVSGPLLAPSENVDQLLKEHDRKIQEFARRARLDKTKAGK  641

Query  353  AQVEKNQISTGSLVVSGR  300
             Q +  Q +  SL V+ R
Sbjct  642  LQAQAKQATENSLFVTAR  659



>gb|KJB77257.1| hypothetical protein B456_012G128100 [Gossypium raimondii]
Length=595

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 75/138 (54%), Gaps = 8/138 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEAS-----DTTMKQNQKSQVHQNDE  534
            + A R+L  E+   +SGP   EP     R   SF E       D      + ++  Q   
Sbjct  458  LVATRTLAPED--HRSGPLTSEPVNQAGRSRRSFHELESAGKLDVRHHMPKTTESPQTAG  515

Query  533  GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarn  354
            GR+   +P + G G +GNKI+ SGPLL PS  VDQ+LK+HDR IQE ARRARLDK KA  
Sbjct  516  GRACIKEP-MHGRGPRGNKIYVSGPLLAPSENVDQLLKEHDRKIQEFARRARLDKTKAGK  574

Query  353  AQVEKNQISTGSLVVSGR  300
             Q +  Q +  SL V+ R
Sbjct  575  LQAQAKQATENSLFVTAR  592



>gb|KJB77256.1| hypothetical protein B456_012G128100 [Gossypium raimondii]
Length=727

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 75/138 (54%), Gaps = 8/138 (6%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEAS-----DTTMKQNQKSQVHQNDE  534
            + A R+L  E+   +SGP   EP     R   SF E       D      + ++  Q   
Sbjct  590  LVATRTLAPED--HRSGPLTSEPVNQAGRSRRSFHELESAGKLDVRHHMPKTTESPQTAG  647

Query  533  GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarn  354
            GR+   +P + G G +GNKI+ SGPLL PS  VDQ+LK+HDR IQE ARRARLDK KA  
Sbjct  648  GRACIKEP-MHGRGPRGNKIYVSGPLLAPSENVDQLLKEHDRKIQEFARRARLDKTKAGK  706

Query  353  AQVEKNQISTGSLVVSGR  300
             Q +  Q +  SL V+ R
Sbjct  707  LQAQAKQATENSLFVTAR  724



>gb|EEE54064.1| hypothetical protein OsJ_00765 [Oryza sativa Japonica Group]
Length=633

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  554  QVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            QV Q  + RSS  D  I GYGSKGNKIH+SGPL+ PS  VDQ+LK++DR IQE
Sbjct  531  QVFQQKDDRSSRVDGAI-GYGSKGNKIHHSGPLICPSGNVDQMLKENDRQIQE  582



>gb|EEC70121.1| hypothetical protein OsI_00791 [Oryza sativa Indica Group]
Length=633

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  554  QVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            QV Q  + RSS  D  I GYGSKGNKIH+SGPL+ PS  VDQ+LK++DR IQE
Sbjct  531  QVFQQKDDRSSRVDGAI-GYGSKGNKIHHSGPLICPSGNVDQMLKENDRQIQE  582



>ref|XP_007198826.1| hypothetical protein PRUPE_ppa002174mg [Prunus persica]
 gb|EMJ00025.1| hypothetical protein PRUPE_ppa002174mg [Prunus persica]
Length=706

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 5/102 (5%)
 Frame = -3

Query  686  RSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTT----MKQNQK-SQVHQNDEGRSS  522
            R+ L E+  E+ GP+  E  K +   PGSF     T     M   Q+ ++  Q ++ ++ 
Sbjct  579  RTALSEDQQEKPGPSGPETTKQVGGVPGSFDVVESTKNQERMHYAQRIARSRQMEDEKAC  638

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
              +P + G G KGNKI+ SGPLLV S  VD++LK+HDR IQE
Sbjct  639  IKEPNMHGRGPKGNKIYVSGPLLVSSNNVDKMLKEHDRRIQE  680



>ref|XP_008791720.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Phoenix dactylifera]
Length=737

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 72/124 (58%), Gaps = 4/124 (3%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            +A RR+LL ++ +E  G    +      R   S  E SD   K +Q    H  ++ RSS+
Sbjct  585  MAGRRNLLSDDGSEIIG-AQLKAIAPAGRLSESGNEPSDAITKYDQI--YHGKEDDRSSN  641

Query  518  NDPVIL-GYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVE  342
             D  I    G+KG KIHYSGPLL PS  VDQ+LKDHDR IQE  RRARLDK+K R  Q  
Sbjct  642  MDQSIQQSCGTKGTKIHYSGPLLRPSGNVDQMLKDHDRQIQEVFRRARLDKSKVRKVQGN  701

Query  341  KNQI  330
             NQI
Sbjct  702  GNQI  705



>ref|XP_008337487.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=704

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 55/103 (53%), Gaps = 7/103 (7%)
 Frame = -3

Query  686  RSLLYENLAEQSGPTNREPPKLISRFPGSF------KEASDTTMKQNQKSQVHQNDEGRS  525
            R+ L ++  E+ GP+ +E  K +  FPGS       K+       Q   S     DE   
Sbjct  580  RTALSDDQQEKPGPSGQETIKPVGGFPGSXDQEESAKKXEXMHYTQRVASSCQMEDEN-G  638

Query  524  SSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            S  +P + G G KGNKI+ SGPLLV S  VDQ+LKDHD  IQE
Sbjct  639  SIKEPNMHGRGPKGNKIYVSGPLLVSSNNVDQMLKDHDHRIQE  681



>ref|XP_008794127.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X3 [Phoenix dactylifera]
Length=535

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = -3

Query  620  ISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVIL-GYGSKGNKIHYSGPLLVPS  444
            I R   S  E SD T K  Q    H+ ++ R+S+ D      YG KGNKIHYSGPL  PS
Sbjct  408  IGRLSESSNEPSDATRKYAQI--YHRKEDERNSNMDQYTQQSYGPKGNKIHYSGPLPRPS  465

Query  443  ARVDQILKDHDRHIQEaarrarldkakarnAQVEKNQI  330
              +DQ+LKDHDR IQE  RRARLDK+K R  Q   NQI
Sbjct  466  GNIDQMLKDHDRQIQEVFRRARLDKSKVRKVQGNGNQI  503



>ref|XP_004303108.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Fragaria vesca subsp. vesca]
Length=703

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 57/102 (56%), Gaps = 2/102 (2%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            V AR +   E+  E+ G +  E  + + RF GSF +  D T KQ+Q     +        
Sbjct  577  VLARTTAPSEDQKERPGTSRPEITRQVGRFQGSF-DGEDFTKKQDQMRHTQRIPSSHQIE  635

Query  518  NDPVIL-GYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            ++   L G G KGNKI+ SGPLLV S  VDQ+LK+HDR IQE
Sbjct  636  DEKANLSGRGPKGNKIYVSGPLLVSSNNVDQMLKEHDRRIQE  677



>ref|XP_008794125.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Phoenix dactylifera]
Length=736

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = -3

Query  620  ISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVIL-GYGSKGNKIHYSGPLLVPS  444
            I R   S  E SD T K  Q    H+ ++ R+S+ D      YG KGNKIHYSGPL  PS
Sbjct  609  IGRLSESSNEPSDATRKYAQI--YHRKEDERNSNMDQYTQQSYGPKGNKIHYSGPLPRPS  666

Query  443  ARVDQILKDHDRHIQEaarrarldkakarnAQVEKNQI  330
              +DQ+LKDHDR IQE  RRARLDK+K R  Q   NQI
Sbjct  667  GNIDQMLKDHDRQIQEVFRRARLDKSKVRKVQGNGNQI  704



>ref|XP_010925563.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Elaeis guineensis]
Length=736

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = -3

Query  614  RFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVIL-GYGSKGNKIHYSGPLLVPSAR  438
            R   S  E SD T K  Q    H  ++ R+S+ D  I   YG KG KIHYSGPLL PS  
Sbjct  611  RLSESGNEPSDATRKYAQI--YHGKEDERNSNMDQYIQQSYGPKGTKIHYSGPLLRPSGN  668

Query  437  VDQILKDHDRHIQEaarrarldkakarnAQVEKNQIST  324
             DQ+LKDHDR IQE  RRARLDK+KAR  Q + NQI  
Sbjct  669  FDQMLKDHDRQIQEVFRRARLDKSKARKVQGDGNQIGA  706



>ref|XP_006859032.1| hypothetical protein AMTR_s00068p00177220 [Amborella trichopoda]
 gb|ERN20499.1| hypothetical protein AMTR_s00068p00177220 [Amborella trichopoda]
Length=699

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -3

Query  548  HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            HQ  + +    D  +LG+G KGNKIHYSGPLL PS  +DQ+LKDH+RHIQE
Sbjct  631  HQKRDKKVGDKDK-LLGHGLKGNKIHYSGPLLPPSGNMDQMLKDHERHIQE  680



>ref|XP_009336210.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Pyrus x bretschneideri]
Length=711

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = -3

Query  686  RSLLYENLAEQSGPTNREPPKLISRFPGSF------KEASDTTMKQNQKSQVHQNDEGRS  525
            R+ + +N  E+ GP+  E  K + RFPGSF      K+       Q   S     DE  S
Sbjct  580  RTAMSDNQQEKPGPSGPETIKPVGRFPGSFDQEESAKKQERMHYTQRVTSSRQMEDETAS  639

Query  524  SSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
                 +  G G KGNKI+ SGPL   S  VD++LK+HDR IQE
Sbjct  640  IKEPNMQHGRGPKGNKIYMSGPLFASSNNVDRMLKEHDRQIQE  682



>ref|XP_006376478.1| hypothetical protein POPTR_0013s13360g [Populus trichocarpa]
 gb|ERP54275.1| hypothetical protein POPTR_0013s13360g [Populus trichocarpa]
Length=726

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 7/107 (7%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVH------QND  537
            + A R++L  +  ++ G    E    + R  GS     +++ K +Q  Q+       Q  
Sbjct  587  LVATRTILPGDHQKKPGVPQPEVVNQVGRLQGSL-NGLESSRKVDQNCQIKKMGDSPQAG  645

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             G+SS+ +P + G+G KGNKI+ SGPLL PS  V+Q+LK+HDR IQE
Sbjct  646  AGKSSNKEPSLHGHGPKGNKIYVSGPLLAPSNNVEQMLKEHDRQIQE  692



>ref|XP_009341987.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Pyrus x bretschneideri]
Length=711

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = -3

Query  686  RSLLYENLAEQSGPTNREPPKLISRFPGSF------KEASDTTMKQNQKSQVHQNDEGRS  525
            R+ + +N  E+ GP+  E  K + RFPGSF      K+       Q   S     DE  S
Sbjct  580  RTAMSDNQQEKPGPSGPETIKPVGRFPGSFDQEESAKKQEWMHYTQRVTSSRQMEDETAS  639

Query  524  SSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
                 +  G G KGNKI+ SGPL   S  VD++LK+HDR IQE
Sbjct  640  IKEPNMQHGRGPKGNKIYMSGPLFASSNNVDRMLKEHDRQIQE  682



>ref|XP_006643878.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Oryza brachyantha]
Length=519

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -3

Query  554  QVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            QV Q  + RSS  D  I GYGSKGNKIH+SGPL  PS  VDQ+LK++DR IQE
Sbjct  417  QVFQQKDERSSRVDGAI-GYGSKGNKIHHSGPLNCPSGNVDQMLKENDRQIQE  468



>ref|XP_009421283.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Musa acuminata subsp. malaccensis]
Length=731

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -3

Query  605  GSFKEASDTTMKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQI  426
            G   E+ + +  +      HQ ++ RS+   P    +G KGNKIHYSGPLL PS  VDQ+
Sbjct  610  GRLSESGNESDGKKCDQMCHQREDERSNIGQPT--DHGPKGNKIHYSGPLLRPSGNVDQM  667

Query  425  LKDHDRHIQEaarrarldkakarnAQVEKNQIST  324
            LK+HDR IQE  RRAR++K+K R  Q + NQ+  
Sbjct  668  LKEHDRQIQEVFRRARINKSKIRKVQGDGNQLGV  701



>ref|XP_010327074.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X2 [Solanum lycopersicum]
Length=533

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -3

Query  575  MKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             KQN  S  HQ + GR+ + +  +  +  KGNKIHYSG LLV S +VDQ+LKD DRHIQE
Sbjct  449  FKQNFASS-HQFESGRTCTKEANLHDHSDKGNKIHYSGSLLVASNKVDQMLKDRDRHIQE  507



>ref|XP_004248172.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Solanum lycopersicum]
Length=680

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -3

Query  575  MKQNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             KQN  S  HQ + GR+ + +  +  +  KGNKIHYSG LLV S +VDQ+LKD DRHIQE
Sbjct  596  FKQNFASS-HQFESGRTCTKEANLHDHSDKGNKIHYSGSLLVASNKVDQMLKDRDRHIQE  654



>ref|XP_008342901.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Malus domestica]
Length=710

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 5/102 (5%)
 Frame = -3

Query  686  RSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTT----MKQNQK-SQVHQNDEGRSS  522
            R+ + ++  E+ GP+  E  K +  FPGSF +         M   Q+ +   Q ++  +S
Sbjct  580  RTAMSDDQQEKPGPSGPETIKPVGGFPGSFDQEESAKKQERMHYTQRVASSRQMEDETAS  639

Query  521  SNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
              +P + G G KGNKI+ SGPL   S  VD++LK+HDR IQE
Sbjct  640  IKEPNMHGRGPKGNKIYMSGPLFASSNNVDRMLKEHDRQIQE  681



>ref|XP_009618925.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Nicotiana tomentosiformis]
Length=293

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -3

Query  545  QNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldka  366
            Q D GR+S  +  + G+G K N+IH+SGPLLV   +VDQ+LK+HDR IQEAARRARL+KA
Sbjct  209  QFDNGRASVKESNLHGHGHKANQIHFSGPLLVQPNKVDQMLKEHDRRIQEAARRARLEKA  268

Query  365  karnAQVEKNQISTGSLVVS  306
            +A   Q +  Q +  S+ V+
Sbjct  269  RAGKGQAQGMQRTNNSIYVT  288



>ref|XP_009802541.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Nicotiana sylvestris]
Length=714

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 6/95 (6%)
 Frame = -3

Query  572  KQNQKSQVH------QNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHD  411
            KQ+QK  +       Q D GR+S  +  + G+G K N+IH+SGPLLV   +VDQ+LK+HD
Sbjct  615  KQDQKRHMQNPAGSRQFDNGRASVKESNLHGHGHKANQIHFSGPLLVQPNKVDQMLKEHD  674

Query  410  RHIQEaarrarldkakarnAQVEKNQISTGSLVVS  306
            R IQEAARRARL+KA+A   Q +  Q +  S+ V+
Sbjct  675  RRIQEAARRARLEKARAGKGQAQGMQRTNNSIYVT  709



>ref|XP_004971749.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Setaria italica]
Length=614

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -3

Query  554  QVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            QV    + RSS  D  I GYGSKGNKIH+SGPL  PS  VD++LK++DR IQE
Sbjct  517  QVFPKKDDRSSRVDGAI-GYGSKGNKIHHSGPLTCPSGNVDEMLKENDRQIQE  568



>gb|KJB45710.1| hypothetical protein B456_007G322800 [Gossypium raimondii]
Length=663

 Score = 60.8 bits (146),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            VA R SL  ++  E+SG    + PK+I+RFPGSFKE+S++ ++Q+ K+   + ++GR+++
Sbjct  568  VAPRTSLASDDCTEKSGFPQSKAPKMIARFPGSFKESSESGIQQDPKNNEQEKEDGRNNN  627

Query  518  NDPVILGY  495
             DPV++ +
Sbjct  628  KDPVLVTW  635


 Score = 23.5 bits (49),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 8/13 (62%), Positives = 10/13 (77%), Gaps = 0/13 (0%)
 Frame = -2

Query  498  LWIKGQQDSLLWT  460
            LW KG Q+SL W+
Sbjct  636  LWFKGTQNSLFWS  648



>ref|XP_002457168.1| hypothetical protein SORBIDRAFT_03g002610 [Sorghum bicolor]
 gb|EES02288.1| hypothetical protein SORBIDRAFT_03g002610 [Sorghum bicolor]
Length=692

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -3

Query  554  QVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            QV    + R+S  D  I GYGSKGNKIH+SGPL  PS  VD++LK++DR IQE
Sbjct  595  QVFPKKDERNSRADGAI-GYGSKGNKIHHSGPLTCPSGNVDEMLKENDRQIQE  646



>ref|XP_009757169.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X3 [Nicotiana sylvestris]
Length=653

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  548  HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            HQ + GR+S  +  + G+  +GNKI++SG LLV S++VDQ+LKDHDR IQE
Sbjct  583  HQFESGRTSLKEANMNGHDYEGNKIYFSGSLLVQSSKVDQMLKDHDRQIQE  633



>ref|XP_009757170.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X4 [Nicotiana sylvestris]
Length=587

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  548  HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            HQ + GR+S  +  + G+  +GNKI++SG LLV S++VDQ+LKDHDR IQE
Sbjct  517  HQFESGRTSLKEANMNGHDYEGNKIYFSGSLLVQSSKVDQMLKDHDRQIQE  567



>ref|XP_009757168.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Nicotiana sylvestris]
Length=679

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  548  HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            HQ + GR+S  +  + G+  +GNKI++SG LLV S++VDQ+LKDHDR IQE
Sbjct  609  HQFESGRTSLKEANMNGHDYEGNKIYFSGSLLVQSSKVDQMLKDHDRQIQE  659



>ref|XP_009757166.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009757167.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana sylvestris]
Length=680

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  548  HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            HQ + GR+S  +  + G+  +GNKI++SG LLV S++VDQ+LKDHDR IQE
Sbjct  610  HQFESGRTSLKEANMNGHDYEGNKIYFSGSLLVQSSKVDQMLKDHDRQIQE  660



>ref|XP_009588481.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X3 [Nicotiana tomentosiformis]
Length=653

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  548  HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            HQ + GR+S  +  +  +G  GNKI++SG LLV S++VDQ+LKDHDR IQE
Sbjct  583  HQFESGRTSLKEANMNDHGYDGNKIYFSGSLLVQSSKVDQMLKDHDRQIQE  633



>ref|XP_009588477.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588478.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588479.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Nicotiana tomentosiformis]
Length=680

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  548  HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            HQ + GR+S  +  +  +G  GNKI++SG LLV S++VDQ+LKDHDR IQE
Sbjct  610  HQFESGRTSLKEANMNDHGYDGNKIYFSGSLLVQSSKVDQMLKDHDRQIQE  660



>ref|XP_009588480.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Nicotiana tomentosiformis]
Length=679

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  548  HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            HQ + GR+S  +  +  +G  GNKI++SG LLV S++VDQ+LKDHDR IQE
Sbjct  609  HQFESGRTSLKEANMNDHGYDGNKIYFSGSLLVQSSKVDQMLKDHDRQIQE  659



>ref|XP_009588482.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
isoform X4 [Nicotiana tomentosiformis]
Length=587

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  548  HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            HQ + GR+S  +  +  +G  GNKI++SG LLV S++VDQ+LKDHDR IQE
Sbjct  517  HQFESGRTSLKEANMNDHGYDGNKIYFSGSLLVQSSKVDQMLKDHDRQIQE  567



>gb|EMT17795.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=631

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -3

Query  551  VHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLL-VPSARVDQILKDHDRHIQE  396
             HQ D+  +   D   +GYGSKGNKIH+SGPL   PS  VD+ILK++DR IQE
Sbjct  534  FHQKDDKSAGRVDGGAIGYGSKGNKIHHSGPLTSCPSGNVDEILKENDRQIQE  586



>ref|XP_006367646.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Solanum tuberosum]
Length=674

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  548  HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            HQ + GR+ + +  +     KG+KIHYSG LLV S +VDQ+LKD DRHIQE
Sbjct  600  HQFESGRTCTKEANLHDPCDKGDKIHYSGSLLVASNKVDQMLKDRDRHIQE  650



>ref|XP_002517906.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF44424.1| ATP binding protein, putative [Ricinus communis]
Length=734

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 61/110 (55%), Gaps = 13/110 (12%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPP--KLISRFPGSFKEASDTTMKQNQKSQV------HQ  543
            VA R SL  +   E   P+  +P   K +  F GS      TT KQ Q  QV      H+
Sbjct  593  VATRTSLPDDRQGE---PSTSQPEVVKQVGVFQGSSNGLEPTT-KQGQSHQVRKPAESHE  648

Query  542  NDEGRSSSNDPVILGYGSKG-NKIHYSGPLLVPSARVDQILKDHDRHIQE  396
               G+S++ +  + G G +G +KI+ SGPLLVPS  V+Q+LK+HDR IQE
Sbjct  649  AGGGKSTTREASLYGRGPRGGSKIYVSGPLLVPSNNVEQMLKEHDRKIQE  698



>gb|EYU24917.1| hypothetical protein MIMGU_mgv1a002276mg [Erythranthe guttata]
Length=692

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 8/78 (10%)
 Frame = -3

Query  605  GSFKEASDTTMKQN--QKSQVH------QNDEGRSSSNDPVILGYGSKGNKIHYSGPLLV  450
             +F E+    MK+N  ++ Q+H      Q+D GR S  +PV+  +  K   IH+SGPL+ 
Sbjct  578  ANFSESFGDRMKRNDNRRPQMHLYSGSQQSDIGRMSMKEPVMDSHNQKERTIHFSGPLIA  637

Query  449  PSARVDQILKDHDRHIQE  396
            PS  ++Q+LK+H+R IQE
Sbjct  638  PSNNIEQVLKEHERRIQE  655



>ref|XP_006357474.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Solanum tuberosum]
Length=716

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 62/97 (64%), Gaps = 8/97 (8%)
 Frame = -3

Query  572  KQNQKSQVH------QNDEGRSSSNDPVILGY--GSKGNKIHYSGPLLVPSARVDQILKD  417
            KQ+ K Q+       Q D GR+S  +  + G+  G KGN IH+SGPLLV   +VDQ+LK+
Sbjct  615  KQDWKRQMQNHASSRQFDNGRASIKEQNLHGHTHGHKGNTIHFSGPLLVQPNKVDQMLKE  674

Query  416  HDRHIQEaarrarldkakarnAQVEKNQISTGSLVVS  306
            HDR IQEAARRARL+KA+A   Q +    +T S  V+
Sbjct  675  HDRRIQEAARRARLEKARAGKGQAQGMPRTTNSFYVT  711



>ref|XP_004243358.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Solanum lycopersicum]
Length=716

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 62/97 (64%), Gaps = 8/97 (8%)
 Frame = -3

Query  572  KQNQKSQVH------QNDEGRSSSNDPVILGY--GSKGNKIHYSGPLLVPSARVDQILKD  417
            KQ+ K Q+       Q D GR+S  +  + G+  G KGN IH+SGPLLV   +VDQ+LK+
Sbjct  615  KQDWKRQMQNHASSRQLDNGRASIKEQHLRGHAHGHKGNSIHFSGPLLVQPNKVDQMLKE  674

Query  416  HDRHIQEaarrarldkakarnAQVEKNQISTGSLVVS  306
            HDR IQEAARRARL+KA+A   Q +    +T S  V+
Sbjct  675  HDRRIQEAARRARLEKARAGKGQAQVMPRTTNSFYVT  711



>gb|KDO53901.1| hypothetical protein CISIN_1g005111mg [Citrus sinensis]
Length=714

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 9/100 (9%)
 Frame = -3

Query  695  AARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSN  516
             A R++L E+  E+SGP+     K +     S+K+   +T KQ+ +  + +  E      
Sbjct  607  VASRTVLPEDHREKSGPSYVGVGKQVGGSQRSYKDLV-STGKQDCRQNIQKTAE------  659

Query  515  DPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             P + G G +GNKI  SGPLL P+  VDQ+LK+HD+HIQE
Sbjct  660  -PSLHGGGPRGNKIFVSGPLL-PTNNVDQLLKEHDQHIQE  697



>ref|XP_006447296.1| hypothetical protein CICLE_v10014434mg [Citrus clementina]
 ref|XP_006494946.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Citrus sinensis]
 gb|ESR60536.1| hypothetical protein CICLE_v10014434mg [Citrus clementina]
Length=714

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 9/100 (9%)
 Frame = -3

Query  695  AARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSSN  516
             A R++L E+  E+SGP+     K +     S+K+   +T KQ+ +  + +  E      
Sbjct  607  VASRTVLPEDHREKSGPSYVGVGKQVGGSQRSYKDLV-STGKQDCRQNIQKTAE------  659

Query  515  DPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             P + G G +GNKI  SGPLL P+  VDQ+LK+HD+HIQE
Sbjct  660  -PSLHGGGPRGNKIFVSGPLL-PTNNVDQLLKEHDQHIQE  697



>ref|XP_010089557.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB38003.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=708

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 7/81 (9%)
 Frame = -3

Query  620  ISRFPGSFKEASDTTMKQNQKSQVHQNDEGRS------SSNDPVILGYGSKGNKIHYSGP  459
            + RF GS  EA    M Q++K +  + +  R        + +  + G+G K NKI+ SGP
Sbjct  600  LGRFRGSMNEAESARM-QDRKHRSKKVEYSRPPADETPCTKESSLHGHGPKTNKIYVSGP  658

Query  458  LLVPSARVDQILKDHDRHIQE  396
            LLV S  VDQ+LK+HDR IQE
Sbjct  659  LLVSSNSVDQMLKEHDRRIQE  679



>gb|KDP24118.1| hypothetical protein JCGZ_25775 [Jatropha curcas]
Length=722

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 60/109 (55%), Gaps = 14/109 (13%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREP--PKLISRFPGSFKEASDTTMKQNQKSQVH------Q  543
            VA R SL  +    Q  P+  +P   K +S +  S      TT KQ QK  V       Q
Sbjct  592  VATRTSLPDD---RQGKPSTSQPEIAKQVSGYQESLNRLEATT-KQCQKHYVRKPADSPQ  647

Query  542  NDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             + G+S   +  + G G +G+KI++SGPLLVPS  VDQ+LK+HD+ IQE
Sbjct  648  ANGGKSGEAN--LHGRGPRGSKIYFSGPLLVPSNNVDQMLKEHDQKIQE  694



>dbj|BAK06871.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = -3

Query  503  LGYGSKGNKIHYSGPLL-VPSARVDQILKDHDRHIQE  396
            +GYGSKGNKIH+SGPL   PS  VD++LK++DR IQE
Sbjct  184  IGYGSKGNKIHHSGPLTSCPSGNVDEMLKENDRQIQE  220



>emb|CDP14791.1| unnamed protein product [Coffea canephora]
Length=699

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 59/107 (55%), Gaps = 11/107 (10%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQV------HQND  537
            + A R+L  E+  E+ G    E   + ++   S   + +   K +QK ++      H  +
Sbjct  563  LVASRTLPSEDSREKYGSQQVE---IANQVKESLNLSGEPMKKHDQKHRMENLASSHHLE  619

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             GR++     +LG+ SK  KIH+SGPL VP  +VDQ+LK+HDR +QE
Sbjct  620  TGRATKGP--VLGHPSKATKIHFSGPLGVPPNKVDQMLKEHDRQLQE  664



>gb|KGN46735.1| hypothetical protein Csa_6G127470 [Cucumis sativus]
Length=647

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 60/107 (56%), Gaps = 11/107 (10%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEG----  531
            + A RS + +N  ++ GP+  E    + R P  F   S++T KQ++    H+  +     
Sbjct  514  LVATRSNISDNPHDRPGPSRSE----VGRLP-DFVRDSESTRKQDRIFYTHRVADSYRVE  568

Query  530  --RSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
              ++ + +  +L YG+  NK++ SGP+L PS  +D+ILK+ DR IQE
Sbjct  569  NEKACAKEQSLLAYGTDMNKLYTSGPILGPSNNLDRILKERDRQIQE  615



>ref|XP_004140036.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Cucumis sativus]
 ref|XP_004154599.1| PREDICTED: probable serine/threonine-protein kinase At1g54610-like 
[Cucumis sativus]
Length=745

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 60/107 (56%), Gaps = 11/107 (10%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEG----  531
            + A RS + +N  ++ GP+  E    + R P  F   S++T KQ++    H+  +     
Sbjct  612  LVATRSNISDNPHDRPGPSRSE----VGRLP-DFVRDSESTRKQDRIFYTHRVADSYRVE  666

Query  530  --RSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
              ++ + +  +L YG+  NK++ SGP+L PS  +D+ILK+ DR IQE
Sbjct  667  NEKACAKEQSLLAYGTDMNKLYTSGPILGPSNNLDRILKERDRQIQE  713



>ref|XP_008655744.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Zea mays]
 gb|AFW80340.1| putative protein kinase superfamily protein [Zea mays]
Length=694

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -3

Query  554  QVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSAR-VDQILKDHDRHIQE  396
            QV    + R++      +GYGSKGNKIH+SGPL  PS   VD++LK++DR IQE
Sbjct  595  QVFPKKDDRNTIRADGAIGYGSKGNKIHHSGPLTCPSGSVVDEMLKENDRQIQE  648



>dbj|BAK06672.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  551  VHQNDEGRSSSNDPV-ILGYGSKGNKIHYSGPLL-VPSARVDQILKDHDRHIQE  396
             HQ D+  +   D    +GYGSKGNKIH+SGPL   PS  VD++LK++DR IQE
Sbjct  586  FHQKDDKSAGRVDGGGAIGYGSKGNKIHHSGPLTSCPSGNVDEMLKENDRQIQE  639



>ref|XP_004505575.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Cicer arietinum]
Length=556

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  500  GYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            G+GS GNKI+ SGPLLV S  +DQ+LKDHDR IQE
Sbjct  507  GHGSSGNKIYLSGPLLVSSNNMDQMLKDHDRKIQE  541



>ref|XP_010230587.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Brachypodium distachyon]
Length=690

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  554  QVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLL-VPSARVDQILKDHDRHIQE  396
            QV    + +S   D  I GYGSKGNKIH+SGPL   P+  VD++LK++DR IQE
Sbjct  589  QVFNQKDEKSGRMDGAI-GYGSKGNKIHHSGPLTSCPAGNVDEMLKENDRQIQE  641



>gb|ACL54761.1| unknown [Zea mays]
 tpg|DAA52937.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=215

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = -3

Query  503  LGYGSKGNKIHYSGPLLVPS-ARVDQILKDHDRHIQE  396
            +GYGSKG+KIH+SGPL  PS + VD++LK++DR IQE
Sbjct  133  IGYGSKGSKIHHSGPLTCPSGSNVDEMLKENDRQIQE  169



>ref|XP_010930474.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Elaeis guineensis]
Length=714

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = -3

Query  566  NQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            ++    H+ D G     D  ++GYG+K  +IHYSGPL+ P   ++ +LK+H+R IQ+
Sbjct  643  DRPCSTHKKDYG-VGGKDSTVMGYGTKNKRIHYSGPLVPPGGNIEDMLKEHERQIQQ  698



>ref|XP_008448297.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Cucumis melo]
 ref|XP_008448298.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Cucumis melo]
 ref|XP_008448299.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X1 [Cucumis melo]
Length=724

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 19/115 (17%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            + A RS + ++  ++ GP+  E    + R P  F   S++T KQ++    H+  +     
Sbjct  583  LVATRSNISDHPHDRPGPSRSE----VGRLP-DFVRDSESTRKQDRIFYTHRVADSYRVE  637

Query  518  ND--------------PVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            N+              P++L YG+  NK++ SGP+L PS  +D+ILK+ DR IQE
Sbjct  638  NEKACAKEQSLVGSIFPLVLAYGTDMNKLYTSGPILGPSNNLDRILKERDRQIQE  692



>ref|XP_008786562.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Phoenix dactylifera]
Length=713

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = -3

Query  551  VHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             H+ D G     D + +GYG+K  +IHYSGPL+ P   ++ +LK+H+R IQ+
Sbjct  647  THKKDYG-VGGKDSIAMGYGTKNKRIHYSGPLMPPGGNIEDMLKEHERQIQQ  697



>ref|XP_011100264.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Sesamum indicum]
Length=700

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = -3

Query  644  TNREPPKLISRFPGSFKEASDTTMKQNQKSQV--HQNDEGRSSSNDPVILGYGSKGNKIH  471
            +N E    + R   SF    + T K++++ Q+    + +   +  +P + G G K   IH
Sbjct  594  SNVEDTNQVGRLLESF---GNPTRKKDRRRQMPNFSSSQHAETGGEPAMDGRGHKDRTIH  650

Query  470  YSGPLLVPSARVDQILKDHDRHIQE  396
            +SGP+LVPS  ++Q+LK+HDR IQE
Sbjct  651  FSGPILVPSNNIEQVLKEHDRRIQE  675



>ref|XP_008448301.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X3 [Cucumis melo]
Length=708

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 57/101 (56%), Gaps = 7/101 (7%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEGRSSS  519
            + A RS + ++  ++ GP+  E    + R P  F   S++T KQ++    H+  +     
Sbjct  583  LVATRSNISDHPHDRPGPSRSE----VGRLP-DFVRDSESTRKQDRIFYTHRVADSYRVE  637

Query  518  NDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            N+   L YG+  NK++ SGP+L PS  +D+ILK+ DR IQE
Sbjct  638  NEK--LAYGTDMNKLYTSGPILGPSNNLDRILKERDRQIQE  676



>ref|XP_008448300.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
isoform X2 [Cucumis melo]
Length=716

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 60/107 (56%), Gaps = 11/107 (10%)
 Frame = -3

Query  698  VAARRSLLYENLAEQSGPTNREPPKLISRFPGSFKEASDTTMKQNQKSQVHQNDEG----  531
            + A RS + ++  ++ GP+  E    + R P  F   S++T KQ++    H+  +     
Sbjct  583  LVATRSNISDHPHDRPGPSRSE----VGRLP-DFVRDSESTRKQDRIFYTHRVADSYRVE  637

Query  530  --RSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
              ++ + +  +L YG+  NK++ SGP+L PS  +D+ILK+ DR IQE
Sbjct  638  NEKACAKEQSLLAYGTDMNKLYTSGPILGPSNNLDRILKERDRQIQE  684



>ref|XP_011095772.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Sesamum indicum]
 ref|XP_011095778.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Sesamum indicum]
 ref|XP_011095785.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Sesamum indicum]
Length=647

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 12/66 (18%)
 Frame = -3

Query  563  QKSQVHQN----------DEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDH  414
            Q SQV Q+          D GR+S+ND V  GY  K N+I +SGPL+ P   +D +LK+H
Sbjct  572  QSSQVRQSVADISDYQLKDVGRTSNNDSV--GYAPKRNRILFSGPLVPPGGNMDDMLKEH  629

Query  413  DRHIQE  396
            +R IQE
Sbjct  630  ERQIQE  635



>gb|KHG15886.1| hypothetical protein F383_23532 [Gossypium arboreum]
Length=703

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  500  GYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            G G +GNKI+ SGPLL PS  VDQ+LK+HDR IQE
Sbjct  656  GGGPRGNKIYVSGPLLAPSDNVDQMLKEHDRKIQE  690



>ref|XP_010062385.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Eucalyptus grandis]
 gb|KCW69527.1| hypothetical protein EUGRSUZ_F02965 [Eucalyptus grandis]
Length=649

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = -3

Query  557  SQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            + + +NDEG   +   ++ GY  K N+IHYSGPL+ P A +D +LK+H+R IQ+
Sbjct  580  ASLKKNDEG---APKELVQGYVPKKNRIHYSGPLMPPGANIDDMLKEHERQIQQ  630



>tpg|DAA52935.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=694

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 1/37 (3%)
 Frame = -3

Query  503  LGYGSKGNKIHYSGPLLVPS-ARVDQILKDHDRHIQE  396
            +GYGSKG+KIH+SGPL  PS + VD++LK++DR IQE
Sbjct  612  IGYGSKGSKIHHSGPLTCPSGSNVDEMLKENDRQIQE  648



>ref|XP_006836804.1| hypothetical protein AMTR_s00099p00026630 [Amborella trichopoda]
 gb|ERM99657.1| hypothetical protein AMTR_s00099p00026630 [Amborella trichopoda]
Length=730

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = -3

Query  500  GYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQEaarrarldkakarnAQVEKNQISTG  321
            GY  K N+IHYSGPLL PS  +D +LK+H+R IQ A R+ARLDK K +  Q E  Q+   
Sbjct  660  GYAPKKNRIHYSGPLLPPSGNIDDLLKEHERQIQHAVRKARLDKVKTKKHQGEMTQLE--  717

Query  320  SLVVSGR  300
            +L+  GR
Sbjct  718  ALLFPGR  724



>ref|XP_010912690.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Elaeis guineensis]
Length=694

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = -3

Query  557  SQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            S  ++ D G     D   +GYGSK  +IHYSGPL+ P   ++ +LK+H+R IQ+
Sbjct  626  SSTYKKDYG-VGGKDSTAIGYGSKNKRIHYSGPLVPPGGNIEDMLKEHERQIQQ  678



>ref|XP_003526281.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Glycine max]
 gb|KHN35249.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=696

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = -3

Query  590  ASDTTMKQNQKSQV--HQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKD  417
             S++  +Q+QK  V  +Q +  R ++      G  S GNKI+ SGPL+V S+ +DQ+LKD
Sbjct  608  GSESRRRQDQKRIVDLNQIESRRVAAEKSTPGGRESMGNKIYLSGPLMVSSSNMDQMLKD  667

Query  416  HDRHIQE  396
            HDR IQE
Sbjct  668  HDRKIQE  674



>ref|XP_008806997.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g54610 [Phoenix dactylifera]
Length=749

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  500  GYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            GYG+K N+IHYSGPL+ P   ++++LK+H+R IQ+
Sbjct  680  GYGTKKNRIHYSGPLMPPGGNIEEMLKEHERQIQQ  714



>ref|XP_008795313.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Phoenix dactylifera]
Length=701

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = -3

Query  566  NQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            ++ S  ++ D G     D   +GYG+K  +IHYSGPL+ P   ++ +LK+H+R IQ+
Sbjct  631  DRPSSTYRKDYG-VGGKDSTAMGYGAKNKRIHYSGPLVPPGGNIEDMLKEHERQIQQ  686



>dbj|BAF98226.1| CM0545.690.nc [Lotus japonicus]
Length=91

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  494  GSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
             S GNKI+ SGPLLV S  +DQ+LK+HDR IQE
Sbjct  37   ASGGNKIYMSGPLLVSSNNMDQMLKEHDRKIQE  69



>ref|XP_010910391.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Elaeis guineensis]
Length=748

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -3

Query  536  EGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            +GR++S +    GY +K N+IHYSGPL+ P   +++IL++H+R IQ+
Sbjct  668  DGRAASKESTA-GYSTKKNRIHYSGPLMPPGGNIEEILREHERQIQQ  713



>gb|KJB31671.1| hypothetical protein B456_005G200800 [Gossypium raimondii]
Length=703

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  533  GRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            G + S +    G G +GNKI+ SGPLL PS  V+Q+LK+HDR IQE
Sbjct  645  GGACSTETSPHGGGPRGNKIYVSGPLLAPSDNVNQMLKEHDRKIQE  690



>ref|XP_009385619.1| PREDICTED: probable serine/threonine-protein kinase At1g09600 
[Musa acuminata subsp. malaccensis]
Length=493

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  557  SQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            + VH+ D GR  + D  +  YG++  +IHYSGPL+ P   ++ +LK+H+R IQE
Sbjct  426  ASVHKKD-GRIVTKDSTV-DYGTRNKRIHYSGPLMPPGGNIEDMLKEHERQIQE  477



>ref|XP_004972482.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Setaria italica]
Length=752

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = -3

Query  569  QNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            Q + S  H+ D+   ++ +P ++  G+K N+IHYSGPL+ P   +D+IL++H+R IQ+
Sbjct  662  QERPSSSHRKDDA-VANKEPTVVN-GTKKNRIHYSGPLMPPGVNMDEILREHERQIQQ  717



>gb|EEC82802.1| hypothetical protein OsI_27571 [Oryza sativa Indica Group]
Length=748

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = -3

Query  569  QNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            Q + S  H+ D+G +++ +P ++  G+K ++IHYSGPL+ P   +++IL++H+R IQ+
Sbjct  660  QERPSSSHRKDDG-AANKEPTVVN-GAKKSRIHYSGPLMPPGVNMEEILREHERQIQQ  715



>ref|NP_001060831.1| Os08g0112500 [Oryza sativa Japonica Group]
 dbj|BAD09509.1| putative CRK1 protein [Oryza sativa Japonica Group]
 dbj|BAF22745.1| Os08g0112500 [Oryza sativa Japonica Group]
 gb|EEE67924.1| hypothetical protein OsJ_25796 [Oryza sativa Japonica Group]
Length=748

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = -3

Query  569  QNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            Q + S  H+ D+G +++ +P ++  G+K ++IHYSGPL+ P   +++IL++H+R IQ+
Sbjct  660  QERPSSSHRKDDG-AANKEPTVVN-GAKKSRIHYSGPLMPPGVNMEEILREHERQIQQ  715



>ref|XP_006659052.1| PREDICTED: probable serine/threonine-protein kinase At1g09600-like 
[Oryza brachyantha]
Length=743

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = -3

Query  569  QNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            Q + S  H+ D+G +++ +P ++  G+K ++IHYSGPL+ P   +++IL++H+R IQ+
Sbjct  655  QERPSSSHRKDDG-AANKEPTVVN-GAKKSRIHYSGPLMPPGVNMEEILREHERQIQQ  710



>ref|XP_008678323.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 
[Zea mays]
Length=753

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = -3

Query  569  QNQKSQVHQNDEGRSSSNDPVILGYGSKGNKIHYSGPLLVPSARVDQILKDHDRHIQE  396
            Q + S  H+ D+  ++    V+   G+K N+IHYSGPL+ P   +D+IL++H+R IQ+
Sbjct  663  QERPSSSHRKDDAVANKEHTVV--NGTKKNRIHYSGPLMPPGVNMDEILREHERQIQQ  718



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320