BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF018G02

Length=710
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009628597.1|  PREDICTED: ataxin-2 homolog                        136   4e-35   Nicotiana tomentosiformis
ref|XP_009628959.1|  PREDICTED: extensin-like                           130   1e-34   Nicotiana tomentosiformis
ref|XP_009782976.1|  PREDICTED: vacuolar protein sorting-associat...    133   7e-34   Nicotiana sylvestris
ref|XP_004248167.1|  PREDICTED: bromodomain-containing protein 4        127   1e-33   Solanum lycopersicum
ref|XP_006367642.1|  PREDICTED: adenylate cyclase, terminal-diffe...    127   4e-33   Solanum tuberosum [potatoes]
ref|XP_009782624.1|  PREDICTED: pollen-specific leucine-rich repe...    134   8e-33   Nicotiana sylvestris
ref|XP_004243351.1|  PREDICTED: bromodomain-containing protein 4-...    130   2e-31   Solanum lycopersicum
ref|XP_006357482.1|  PREDICTED: transcription factor SPT20 homolog      127   3e-30   Solanum tuberosum [potatoes]
ref|XP_010110218.1|  hypothetical protein L484_009824                   122   1e-28   Morus notabilis
emb|CDP14783.1|  unnamed protein product                                118   6e-28   Coffea canephora [robusta coffee]
ref|XP_002517918.1|  structural constituent of cell wall, putative      115   5e-26   Ricinus communis
ref|XP_007043595.1|  Structural constituent of cell wall                114   9e-26   
ref|XP_007132659.1|  hypothetical protein PHAVU_011G113900g             114   2e-25   Phaseolus vulgaris [French bean]
ref|XP_010689008.1|  PREDICTED: RNA polymerase II degradation fac...    112   4e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP24130.1|  hypothetical protein JCGZ_25787                         112   5e-25   Jatropha curcas
gb|KJB31694.1|  hypothetical protein B456_005G201600                    109   3e-24   Gossypium raimondii
ref|XP_010035753.1|  PREDICTED: RNA polymerase II degradation fac...    109   8e-24   Eucalyptus grandis [rose gum]
gb|KHN31988.1|  hypothetical protein glysoja_025822                     108   1e-23   Glycine soja [wild soybean]
gb|KHG27956.1|  S-adenosylmethionine synthase 1                         107   2e-23   Gossypium arboreum [tree cotton]
ref|XP_003539922.1|  PREDICTED: putative uncharacterized protein ...    107   2e-23   Glycine max [soybeans]
ref|XP_006592435.1|  PREDICTED: putative uncharacterized protein ...    107   3e-23   Glycine max [soybeans]
ref|XP_002272844.1|  PREDICTED: arginine-glutamic acid dipeptide ...    104   3e-23   Vitis vinifera
gb|KJB77271.1|  hypothetical protein B456_012G128800                    105   4e-23   Gossypium raimondii
gb|KJB77268.1|  hypothetical protein B456_012G128800                    105   4e-23   Gossypium raimondii
gb|KJB77274.1|  hypothetical protein B456_012G128800                    105   6e-23   Gossypium raimondii
ref|XP_007198900.1|  hypothetical protein PRUPE_ppa004117mg             104   9e-23   Prunus persica
gb|KJB77267.1|  hypothetical protein B456_012G128800                    104   1e-22   Gossypium raimondii
ref|XP_004506616.1|  PREDICTED: transcription factor SPT20 homolog      105   1e-22   Cicer arietinum [garbanzo]
gb|KJB77269.1|  hypothetical protein B456_012G128800                    103   3e-22   Gossypium raimondii
ref|XP_006582794.1|  PREDICTED: vacuolar protein sorting-associat...    104   3e-22   
ref|XP_008229158.1|  PREDICTED: mediator of RNA polymerase II tra...    104   4e-22   Prunus mume [ume]
ref|XP_008229157.1|  PREDICTED: mediator of RNA polymerase II tra...    104   4e-22   Prunus mume [ume]
gb|KHN35253.1|  hypothetical protein glysoja_042323                     104   5e-22   Glycine soja [wild soybean]
ref|XP_004303103.1|  PREDICTED: transcriptional regulator DEF1          103   1e-21   Fragaria vesca subsp. vesca
ref|XP_008337475.1|  PREDICTED: altered inheritance of mitochondr...    102   2e-21   
gb|KEH17617.1|  structural constituent of cell wall protein, puta...    101   3e-21   Medicago truncatula
ref|XP_009357856.1|  PREDICTED: putative uncharacterized protein ...    101   5e-21   Pyrus x bretschneideri [bai li]
gb|KCW89535.1|  hypothetical protein EUGRSUZ_A01820                   99.0    2e-20   Eucalyptus grandis [rose gum]
ref|XP_010051997.1|  PREDICTED: LOW QUALITY PROTEIN: bromodomain-...  99.4    2e-20   Eucalyptus grandis [rose gum]
ref|XP_008342910.1|  PREDICTED: extensin-like isoform X1              98.6    4e-20   
ref|XP_008342911.1|  PREDICTED: extensin-like isoform X2              98.6    4e-20   
gb|EYU28592.1|  hypothetical protein MIMGU_mgv1a004659mg              98.6    5e-20   Erythranthe guttata [common monkey flower]
gb|KEH39132.1|  structural constituent of cell wall protein, puta...  98.2    5e-20   Medicago truncatula
gb|KEH39131.1|  structural constituent of cell wall protein, puta...  98.2    6e-20   Medicago truncatula
ref|XP_006447363.1|  hypothetical protein CICLE_v10014791mg           97.1    9e-20   Citrus clementina [clementine]
ref|XP_006447362.1|  hypothetical protein CICLE_v10014791mg           97.1    9e-20   Citrus clementina [clementine]
ref|XP_011098021.1|  PREDICTED: extensin                              97.8    1e-19   Sesamum indicum [beniseed]
ref|XP_002325597.2|  hydroxyproline-rich glycoprotein                 97.8    1e-19   Populus trichocarpa [western balsam poplar]
gb|KDO51849.1|  hypothetical protein CISIN_1g008878mg                 96.7    1e-19   Citrus sinensis [apfelsine]
gb|KDO51850.1|  hypothetical protein CISIN_1g008878mg                 96.3    1e-19   Citrus sinensis [apfelsine]
ref|XP_011002849.1|  PREDICTED: calcium-binding protein P-like        97.1    2e-19   Populus euphratica
ref|XP_009341976.1|  PREDICTED: ATP-dependent helicase brm-like i...  97.1    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_009341977.1|  PREDICTED: ATP-dependent helicase brm-like i...  97.1    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_009336199.1|  PREDICTED: mediator of RNA polymerase II tra...  96.3    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_009336198.1|  PREDICTED: mediator of RNA polymerase II tra...  96.3    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_006376495.1|  hydroxyproline-rich glycoprotein                 96.3    4e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010242911.1|  PREDICTED: RNA polymerase II degradation fac...  89.0    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010924425.1|  PREDICTED: hepatocyte growth factor-regulate...  85.9    1e-15   Elaeis guineensis
ref|XP_010924426.1|  PREDICTED: putative cyclin-dependent serine/...  85.1    1e-15   
ref|XP_002869511.1|  hypothetical protein ARALYDRAFT_491942           85.5    1e-15   
ref|XP_003540363.1|  PREDICTED: integrator complex subunit 3 homo...  85.1    2e-15   Glycine max [soybeans]
ref|NP_974630.1|  uncharacterized protein                             84.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CAB79632.1|  predicted proline-rich protein                       84.3    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194559.2|  uncharacterized protein                             84.0    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137778.1|  PREDICTED: basic salivary proline-rich prote...  83.2    8e-15   Brassica rapa
ref|XP_006283593.1|  hypothetical protein CARUB_v10004649mg           83.2    9e-15   Capsella rubella
ref|XP_008455323.1|  PREDICTED: mediator of RNA polymerase II tra...  83.2    9e-15   Cucumis melo [Oriental melon]
ref|XP_009144355.1|  PREDICTED: protein transport protein SEC31-like  82.8    1e-14   Brassica rapa
emb|CDY67879.1|  BnaC07g50480D                                        82.8    1e-14   Brassica napus [oilseed rape]
gb|KFK35898.1|  hypothetical protein AALP_AA4G050800                  82.0    2e-14   Arabis alpina [alpine rockcress]
emb|CDX89188.1|  BnaA01g17050D                                        81.6    2e-14   
ref|XP_011037329.1|  PREDICTED: bromodomain-containing protein 4-...  81.6    2e-14   Populus euphratica
ref|XP_011037330.1|  PREDICTED: putative uncharacterized protein ...  81.6    3e-14   Populus euphratica
ref|XP_010438481.1|  PREDICTED: formin-like protein 5                 81.6    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010433239.1|  PREDICTED: bromodomain-containing protein 4-...  81.3    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010448000.1|  PREDICTED: vacuolar protein-sorting protein ...  81.3    3e-14   Camelina sativa [gold-of-pleasure]
emb|CDY18985.1|  BnaC01g20830D                                        80.9    5e-14   Brassica napus [oilseed rape]
ref|XP_006412973.1|  hypothetical protein EUTSA_v10024987mg           80.5    6e-14   Eutrema salsugineum [saltwater cress]
ref|XP_008455322.1|  PREDICTED: transcription factor SPT20 homolog    80.1    8e-14   Cucumis melo [Oriental melon]
emb|CDX97433.1|  BnaC08g12980D                                        80.1    8e-14   
ref|XP_004136824.1|  PREDICTED: uncharacterized protein LOC101206745  80.1    8e-14   Cucumis sativus [cucumbers]
ref|XP_004136823.1|  PREDICTED: uncharacterized protein LOC101206501  79.7    1e-13   Cucumis sativus [cucumbers]
emb|CDY25250.1|  BnaA02g22060D                                        79.3    1e-13   Brassica napus [oilseed rape]
emb|CDY14248.1|  BnaA08g13790D                                        79.0    2e-13   Brassica napus [oilseed rape]
ref|XP_008798248.1|  PREDICTED: putative cyclin-dependent serine/...  79.0    2e-13   Phoenix dactylifera
ref|XP_010540875.1|  PREDICTED: extensin                              78.6    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_009109102.1|  PREDICTED: formin-like protein 3                 78.6    2e-13   Brassica rapa
ref|XP_008810225.1|  PREDICTED: ataxin-2 homolog isoform X1           78.2    4e-13   Phoenix dactylifera
ref|XP_008810226.1|  PREDICTED: ataxin-2 homolog isoform X2           77.8    4e-13   Phoenix dactylifera
ref|XP_007149849.1|  hypothetical protein PHAVU_005G103700g           76.3    1e-12   Phaseolus vulgaris [French bean]
gb|EPS62243.1|  hypothetical protein M569_12549                       75.9    2e-12   Genlisea aurea
ref|XP_003543336.1|  PREDICTED: RNA polymerase II degradation fac...  74.3    8e-12   Glycine max [soybeans]
gb|EEC71500.1|  hypothetical protein OsI_03777                        74.3    9e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001044280.1|  Os01g0754500                                     74.3    9e-12   
gb|KHN36637.1|  hypothetical protein glysoja_001368                   71.6    6e-11   Glycine soja [wild soybean]
ref|XP_010919602.1|  PREDICTED: tyrosine-protein phosphatase non-...  71.2    6e-11   Elaeis guineensis
ref|XP_010919593.1|  PREDICTED: tyrosine-protein phosphatase non-...  71.2    6e-11   Elaeis guineensis
dbj|BAK01177.1|  predicted protein                                    71.2    7e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006644724.1|  PREDICTED: mediator of RNA polymerase II tra...  69.7    2e-10   Oryza brachyantha
ref|XP_006644725.1|  PREDICTED: mediator of RNA polymerase II tra...  69.7    3e-10   Oryza brachyantha
emb|CDM84126.1|  unnamed protein product                              69.3    3e-10   Triticum aestivum [Canadian hard winter wheat]
gb|EMT05386.1|  hypothetical protein F775_26441                       67.8    1e-09   
ref|XP_004969990.1|  PREDICTED: trithorax group protein osa-like      66.6    2e-09   Setaria italica
ref|XP_009395702.1|  PREDICTED: pollen-specific leucine-rich repe...  66.6    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002458505.1|  hypothetical protein SORBIDRAFT_03g034890        65.9    4e-09   Sorghum bicolor [broomcorn]
gb|EMS50510.1|  hypothetical protein TRIUR3_23019                     65.5    6e-09   Triticum urartu
ref|XP_008655245.1|  PREDICTED: uncharacterized protein LOC100383...  62.4    6e-08   Zea mays [maize]
ref|NP_001169238.1|  uncharacterized protein LOC100383096             62.4    7e-08   Zea mays [maize]
ref|XP_009396506.1|  PREDICTED: pinin-like                            59.3    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH24794.1|  DNA-binding protein, putative                         55.5    1e-05   Medicago truncatula
ref|XP_008795992.1|  PREDICTED: protein transport protein SEC31-like  54.3    3e-05   
ref|XP_006446566.1|  hypothetical protein CICLE_v10014743mg           52.8    9e-05   Citrus clementina [clementine]
ref|XP_006470271.1|  PREDICTED: COPII coat assembly protein sec16...  52.8    1e-04   Citrus sinensis [apfelsine]
ref|XP_006643803.1|  PREDICTED: vegetative cell wall protein gp1-...  52.8    1e-04   Oryza brachyantha
ref|XP_010940140.1|  PREDICTED: protein diaphanous homolog 1-like     52.8    1e-04   Elaeis guineensis
ref|XP_001784568.1|  predicted protein                                52.4    1e-04   
gb|KDO55180.1|  hypothetical protein CISIN_1g0084162mg                52.4    2e-04   Citrus sinensis [apfelsine]
ref|XP_001770189.1|  predicted protein                                52.0    2e-04   
gb|KDO55179.1|  hypothetical protein CISIN_1g0084162mg                52.0    2e-04   Citrus sinensis [apfelsine]
gb|KDO55178.1|  hypothetical protein CISIN_1g0084162mg                51.6    2e-04   Citrus sinensis [apfelsine]
emb|CAJ44247.1|  hypothetical protein                                 48.9    2e-04   Cocos nucifera
ref|XP_008801947.1|  PREDICTED: arginine-glutamic acid dipeptide ...  51.6    2e-04   Phoenix dactylifera
ref|XP_006655038.1|  PREDICTED: vegetative cell wall protein gp1-...  51.6    3e-04   Oryza brachyantha
ref|XP_011097415.1|  PREDICTED: protein enabled-like                  51.6    3e-04   Sesamum indicum [beniseed]
ref|XP_001758183.1|  predicted protein                                50.8    4e-04   
ref|XP_010108811.1|  hypothetical protein L484_020546                 50.4    6e-04   Morus notabilis
ref|XP_002300038.2|  hypothetical protein POPTR_0001s34990g           50.1    7e-04   
ref|XP_009388841.1|  PREDICTED: bromodomain-containing protein 4      50.1    8e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_009628597.1| PREDICTED: ataxin-2 homolog [Nicotiana tomentosiformis]
Length=535

 Score =   136 bits (343),  Expect(3) = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHI  411
            P QP F Q  YPPSSF   NP    + N+MVRPPQ +RN P YNEL+EKL SMGYR DH+
Sbjct  442  PPQPNFSQSGYPPSSFPPQNPQPTPSANLMVRPPQLVRNHP-YNELIEKLVSMGYRADHV  500

Query  410  INVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            +NVIQR+EESGQPVD NAVLDRLNGHSSGGSQ+GW
Sbjct  501  VNVIQRLEESGQPVDFNAVLDRLNGHSSGGSQRGW  535


 Score = 35.0 bits (79),  Expect(3) = 4e-35, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPRGH  595
            + +PGNAYVMYD EG RGH
Sbjct  422  TLSPGNAYVMYDGEGTRGH  440


 Score = 24.3 bits (51),  Expect(3) = 4e-35, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 10/15 (67%), Gaps = 0/15 (0%)
 Frame = -2

Query  685  GDGYGVSGPHPFVCP  641
            GDGY  SG HP + P
Sbjct  411  GDGYAASGAHPTLSP  425



>ref|XP_009628959.1| PREDICTED: extensin-like [Nicotiana tomentosiformis]
Length=534

 Score =   130 bits (328),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = -1

Query  587  QQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHII  408
            Q P FPQ  YPPSSF+  NP    + N+MVRPPQ +R  P YNEL+EK+ SMGYR DH++
Sbjct  442  QPPNFPQSGYPPSSFAPQNPQSTPSPNIMVRPPQLVRTHP-YNELIEKMVSMGYRGDHVV  500

Query  407  NVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            NVIQR+EESGQ VD NAVLDRLNGHSSG SQ+GW
Sbjct  501  NVIQRLEESGQTVDFNAVLDRLNGHSSGASQRGW  534


 Score = 37.0 bits (84),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPRGH  595
            S + GNAY+MYDSEGPRGH
Sbjct  421  SLSTGNAYLMYDSEGPRGH  439


 Score = 26.9 bits (58),  Expect(3) = 1e-34, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = -2

Query  697  FVPPGDGYGVSGPHPFVC  644
            F  PGDGY  SGPHP + 
Sbjct  406  FGAPGDGYAASGPHPSLS  423



>ref|XP_009782976.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Nicotiana sylvestris]
Length=535

 Score =   133 bits (334),  Expect(3) = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHI  411
            P QP F Q  YPPSSF   NP    + N+MVRPPQ +RN P + EL+EK+ SMGYR DH+
Sbjct  442  PPQPNFSQSGYPPSSFPPQNPQPTPSANLMVRPPQLVRNHP-FKELIEKMVSMGYRADHV  500

Query  410  INVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            INVIQR+EESGQPVD NAVLDRLNGHSSGGSQ+GW
Sbjct  501  INVIQRLEESGQPVDFNAVLDRLNGHSSGGSQRGW  535


 Score = 35.4 bits (80),  Expect(3) = 7e-34, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPRGH  595
            + +PGNAYVMYD EG RGH
Sbjct  422  TLSPGNAYVMYDGEGTRGH  440


 Score = 23.5 bits (49),  Expect(3) = 7e-34, Method: Compositional matrix adjust.
 Identities = 8/15 (53%), Positives = 10/15 (67%), Gaps = 0/15 (0%)
 Frame = -2

Query  685  GDGYGVSGPHPFVCP  641
            GDGY  +G HP + P
Sbjct  411  GDGYAANGAHPTLSP  425



>ref|XP_004248167.1| PREDICTED: bromodomain-containing protein 4 [Solanum lycopersicum]
Length=545

 Score =   127 bits (319),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 74/99 (75%), Gaps = 9/99 (9%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANT----NVMVRPPQGMRNPPPYNELVEKLASMGYR  423
            PQ P FPQ  YPPSSF    PPQ A +    N M RPPQ MR  P YNEL+EKLASMGYR
Sbjct  450  PQPPNFPQSGYPPSSF----PPQNAQSSPSPNHMFRPPQLMRTHP-YNELIEKLASMGYR  504

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
             DH++NVIQR+EESGQ VD N VLDRLNGHSSGG Q+GW
Sbjct  505  GDHVVNVIQRLEESGQTVDFNTVLDRLNGHSSGGPQRGW  543


 Score = 37.0 bits (84),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPRGH  595
            S + GNAY+MYDSEGPRGH
Sbjct  430  SLSAGNAYLMYDSEGPRGH  448


 Score = 26.9 bits (58),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = -2

Query  697  FVPPGDGYGVSGPHPFVC  644
            F  PGDGY  SGPHP + 
Sbjct  415  FGAPGDGYAASGPHPSLS  432



>ref|XP_006367642.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
[Solanum tuberosum]
Length=548

 Score =   127 bits (320),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 76/101 (75%), Gaps = 10/101 (10%)
 Frame = -1

Query  593  HPQQP-IFPQGAYPPSSFSLANPPQPANT----NVMVRPPQGMRNPPPYNELVEKLASMG  429
            HP QP  FPQ  YPPSSF    PPQ A +    N MVRPPQ MR  P YNEL+EKLASMG
Sbjct  451  HPSQPPNFPQSGYPPSSF----PPQNAQSSPSPNHMVRPPQLMRTHP-YNELIEKLASMG  505

Query  428  YRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            YR DH++NVIQR+EESGQ VD N VLDRLNGHSSGG Q+GW
Sbjct  506  YRGDHVVNVIQRLEESGQTVDFNTVLDRLNGHSSGGPQRGW  546


 Score = 34.7 bits (78),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPRGH  595
            S + GNAY+MYD EGPRGH
Sbjct  433  SLSAGNAYLMYDGEGPRGH  451


 Score = 26.9 bits (58),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 12/18 (67%), Gaps = 0/18 (0%)
 Frame = -2

Query  697  FVPPGDGYGVSGPHPFVC  644
            F  PGDGY  SGPHP + 
Sbjct  418  FGAPGDGYATSGPHPSLS  435



>ref|XP_009782624.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=539

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 88/136 (65%), Gaps = 4/136 (3%)
 Frame = -1

Query  710  LKPAFCAPRGWXRGKWTTPIRLPPEMLM*CMTVKDRGVIHPQQP-IFPQGAYPPSSFSLA  534
            LKP+F AP          P        +   +   RG  HP QP  FPQ  YPPSSF+  
Sbjct  407  LKPSFGAPGDSYAASGPHPSLSAGNAYLMYDSEGTRG--HPSQPPNFPQSGYPPSSFAPQ  464

Query  533  NPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAV  354
            NP    + N+MVRPPQ +R  P YNEL+EK+ SMGYR DH++NVIQR+EESGQ VD NAV
Sbjct  465  NPQSTPSPNIMVRPPQLVRTHP-YNELIEKMVSMGYRGDHVVNVIQRLEESGQTVDFNAV  523

Query  353  LDRLNGHSSGGSQKGW  306
            LDRLNGHSSG SQ+GW
Sbjct  524  LDRLNGHSSGASQRGW  539



>ref|XP_004243351.1| PREDICTED: bromodomain-containing protein 4-like [Solanum lycopersicum]
Length=537

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 90/137 (66%), Gaps = 6/137 (4%)
 Frame = -1

Query  710  LKPAFCAPRGWXRGKWTTPIRLPPEMLM*CMTVKDRGVIHPQ-QPIFPQGAYPPSSFSLA  534
            LKP+F AP          P   P    +  M   +    HP  QP F Q  YPPSSF   
Sbjct  405  LKPSFGAPGDGYAASGAHPTLSPGNAYV--MYDGEGTRAHPPPQPNFQQSGYPPSSFPPQ  462

Query  533  NPPQPA-NTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNA  357
            N  QPA + N+MVRPPQ +RN P YNEL+EKL SMGYR DH++NVIQR+EESGQPVD NA
Sbjct  463  NQ-QPAPSPNLMVRPPQQVRNHP-YNELIEKLVSMGYRGDHVVNVIQRLEESGQPVDFNA  520

Query  356  VLDRLNGHSSGGSQKGW  306
            +LDR+NGHSSGG Q+GW
Sbjct  521  ILDRMNGHSSGGPQRGW  537



>ref|XP_006357482.1| PREDICTED: transcription factor SPT20 homolog [Solanum tuberosum]
Length=537

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 86/136 (63%), Gaps = 4/136 (3%)
 Frame = -1

Query  710  LKPAFCAPRGWXRGKWTTPIRLPPEMLM*CMTVKDRGVIHPQ-QPIFPQGAYPPSSFSLA  534
            LKP+F AP          P   P    +  M   +    HP  QP F Q  YPPSSF   
Sbjct  405  LKPSFGAPGDGYAASGAHPTLSPGNAYV--MYDGEGTRTHPPPQPNFQQSRYPPSSFPPQ  462

Query  533  NPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAV  354
            N     + N+MVRP Q +RN P YNEL+EKL SMGYR DH++NVIQR+EESGQPVD NA+
Sbjct  463  NQQPTPSPNLMVRPTQQVRNHP-YNELIEKLVSMGYRGDHVVNVIQRLEESGQPVDFNAI  521

Query  353  LDRLNGHSSGGSQKGW  306
            LD +NGHSSGGSQ+GW
Sbjct  522  LDSMNGHSSGGSQRGW  537



>ref|XP_010110218.1| hypothetical protein L484_009824 [Morus notabilis]
 gb|EXC25515.1| hypothetical protein L484_009824 [Morus notabilis]
Length=527

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 75/107 (70%), Gaps = 3/107 (3%)
 Frame = -1

Query  620  MTVKDRGVIH--PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVE  447
            M   D G  H  PQ P F QG YPP+S SL N       NVMVR PQ MRN P Y EL+E
Sbjct  420  MYDSDGGRAHYPPQVPHFAQGGYPPTSASLPNQLPNVAPNVMVRNPQFMRNHP-YAELIE  478

Query  446  KLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            KLASMG+R DHI++VIQRMEESGQP+D N VLDRLN HSSG  Q+GW
Sbjct  479  KLASMGFRGDHIVSVIQRMEESGQPIDFNGVLDRLNVHSSGAPQRGW  525



>emb|CDP14783.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   118 bits (295),  Expect(3) = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 2/97 (2%)
 Frame = -1

Query  593  HP-QQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVD  417
            HP QQP FPQ  YPP++    N      +N++VRPPQ +RN P Y +L+EK+ SMGYR D
Sbjct  442  HPAQQPHFPQSPYPPTTMPPQNLQPNTGSNLVVRPPQFVRNHP-YGDLIEKVVSMGYRGD  500

Query  416  HIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            H+++ IQR+EESGQPVD NAVLDRLNGHS+GG Q+GW
Sbjct  501  HVVSAIQRLEESGQPVDFNAVLDRLNGHSAGGPQRGW  537


 Score = 28.1 bits (61),  Expect(3) = 6e-28, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 12/19 (63%), Gaps = 0/19 (0%)
 Frame = -2

Query  697  FVPPGDGYGVSGPHPFVCP  641
            +  P DGY  SGPHP + P
Sbjct  409  YASPADGYAASGPHPTLSP  427


 Score = 25.8 bits (55),  Expect(3) = 6e-28, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 11/15 (73%), Gaps = 0/15 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEG  607
            + +PGN YVMYD  G
Sbjct  424  TLSPGNTYVMYDEAG  438



>ref|XP_002517918.1| structural constituent of cell wall, putative [Ricinus communis]
 gb|EEF44436.1| structural constituent of cell wall, putative [Ricinus communis]
Length=536

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 5/98 (5%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQG---MRNPPPYNELVEKLASMGYRV  420
            PQQP F QG YPP++ SL NP     TN+M R P     +RN P Y+EL++KL SMG+R 
Sbjct  439  PQQPHFSQGGYPPTNLSLQNPQSAPGTNMMARNPSHANFVRNHP-YSELIDKLVSMGFRA  497

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            +HI+ VIQRMEESGQP+D NAVLDRL+ +SSGGSQ+GW
Sbjct  498  EHIVGVIQRMEESGQPLDFNAVLDRLS-NSSGGSQRGW  534



>ref|XP_007043595.1| Structural constituent of cell wall [Theobroma cacao]
 gb|EOX99426.1| Structural constituent of cell wall [Theobroma cacao]
Length=552

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 73/99 (74%), Gaps = 5/99 (5%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNPPPYNELVEKLASMGYRV  420
            PQQP F QG Y P++ SL  P      NVM+R     Q +R+ P Y++L+EKL SMG+RV
Sbjct  455  PQQPHFSQGGYSPANVSLQTPQTGTGPNVMIRNTSHSQFIRSHP-YSDLIEKLVSMGFRV  513

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            DH+ +VIQRMEESGQPVD NAVLDRLN HSSGGSQ+ GW
Sbjct  514  DHVASVIQRMEESGQPVDFNAVLDRLNVHSSGGSQRGGW  552



>ref|XP_007132659.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
 gb|ESW04653.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
Length=541

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 86/138 (62%), Gaps = 7/138 (5%)
 Frame = -1

Query  710  LKPAFCAPRGWXRGKWTTPIRLPPEMLM*CMTVKDRGVIHPQQPIFPQGAYPPSSFSLAN  531
            +K +F AP G   G   +   LPP         +     HP QP F Q  YPP+S SL N
Sbjct  406  MKSSFPAPPGEMYGPTGSLAALPPSSAYMMYEGEGGRTHHPPQPHFTQPGYPPTSASLQN  465

Query  530  PPQPANTNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXN  360
            PP   + N+MVR P   Q +RN P Y+EL+EKL SMG+R DH+++VIQRMEESGQ +D N
Sbjct  466  PP---SHNLMVRNPNQSQFVRNHP-YSELIEKLVSMGFRGDHVMSVIQRMEESGQAIDFN  521

Query  359  AVLDRLNGHSSGGSQKGW  306
            +VLDRLN HSS G  +GW
Sbjct  522  SVLDRLNVHSSVGPPRGW  539



>ref|XP_010689008.1| PREDICTED: RNA polymerase II degradation factor 1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 73/99 (74%), Gaps = 4/99 (4%)
 Frame = -1

Query  593  HPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNPPPYNELVEKLASMGYR  423
            H  Q  + QG YPP++ SL N P P +++ MVR   P Q +RN P YNEL++KL SMGYR
Sbjct  445  HSLQTHYSQGVYPPANPSLPNLPAPGSSSHMVRNPGPQQYVRNHP-YNELIDKLVSMGYR  503

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
             DH+++VIQR+EESG  VD NAVLDRLNGHSSG SQ+ W
Sbjct  504  SDHVVSVIQRLEESGLAVDFNAVLDRLNGHSSGSSQRSW  542



>gb|KDP24130.1| hypothetical protein JCGZ_25787 [Jatropha curcas]
Length=532

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 71/100 (71%), Gaps = 6/100 (6%)
 Frame = -1

Query  593  HPQQPI-FPQGAYPPSSFSLANPPQPANTNVMVRPPQG---MRNPPPYNELVEKLASMGY  426
            HP QP  FPQ  YPP S SL N    A  NV+ R P     +RN P YNEL+EKL +MG+
Sbjct  433  HPPQPSHFPQAGYPPGSLSLQNSQPAAGANVLARNPNHSHLVRNHP-YNELIEKLVNMGF  491

Query  425  RVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            R+DH+I VIQRMEESGQPVD NAVLDRLN H +G SQ+GW
Sbjct  492  RMDHVIGVIQRMEESGQPVDFNAVLDRLNVH-NGSSQRGW  530



>gb|KJB31694.1| hypothetical protein B456_005G201600 [Gossypium raimondii]
Length=546

 Score =   109 bits (272),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 75/102 (74%), Gaps = 8/102 (8%)
 Frame = -1

Query  593  HP-QQPIFPQGAYPPSS-FSLANPPQPANTNVMVR---PPQGMRNPPPYNELVEKLASMG  429
            HP QQP F QG YPP++  SL   P  A  NVMVR    PQ +RN P Y+EL+EKL SMG
Sbjct  447  HPSQQPNFSQGGYPPAANVSLQTQPG-AGPNVMVRNTNHPQFVRNHP-YSELIEKLVSMG  504

Query  428  YRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            +R DH+ +VIQRMEESGQP D NAVLDRLN HSSGGSQ+ GW
Sbjct  505  FRGDHVASVIQRMEESGQPPDFNAVLDRLNAHSSGGSQRGGW  546


 Score = 30.0 bits (66),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPRGH  595
            +F PG+AY++YDSEG R H
Sbjct  428  TFPPGSAYMVYDSEGGRTH  446



>ref|XP_010035753.1| PREDICTED: RNA polymerase II degradation factor 1-like [Eucalyptus 
grandis]
 gb|KCW47211.1| hypothetical protein EUGRSUZ_K01026 [Eucalyptus grandis]
Length=535

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 72/103 (70%), Gaps = 4/103 (4%)
 Frame = -1

Query  605  RGVIHPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---QGMRNPPPYNELVEKLAS  435
            R    PQQ  FPQGAYPP++  + NP      N++ R P   Q +RN P Y EL+EKL +
Sbjct  432  RAHHQPQQVHFPQGAYPPTNLPVQNPHPAPGGNLVGRNPSHSQFVRNHP-YGELIEKLVN  490

Query  434  MGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            MG+R DH+ +VIQR+EESGQPVD NAVLDRLN H SG SQ+GW
Sbjct  491  MGFRGDHVASVIQRLEESGQPVDFNAVLDRLNVHPSGNSQRGW  533



>gb|KHN31988.1| hypothetical protein glysoja_025822 [Glycine soja]
Length=505

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 72/100 (72%), Gaps = 7/100 (7%)
 Frame = -1

Query  593  HPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---QGMRNPPPYNELVEKLASMGYR  423
            HP QP F Q  YPP+S SL NPP     N+MVR P   Q +RN P YNEL+EKL SMG+R
Sbjct  407  HPPQPHFAQPGYPPTSASLQNPP--PGLNLMVRNPNQSQFIRNHP-YNELIEKLVSMGFR  463

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
             DH+ +VIQRMEESGQ +D N+VLDRLN HSS G Q+ GW
Sbjct  464  GDHVASVIQRMEESGQAIDFNSVLDRLNVHSSVGPQRGGW  503



>gb|KHG27956.1| S-adenosylmethionine synthase 1 [Gossypium arboreum]
Length=552

 Score =   107 bits (266),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 72/99 (73%), Gaps = 5/99 (5%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNPPPYNELVEKLASMGYRV  420
            PQQP F QG YPP++ SL  P    + NVM+R     Q +RN P Y++L+EKL SMG+R 
Sbjct  455  PQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVRNHP-YSDLIEKLVSMGFRG  513

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            DHI +VIQRMEESGQ VD NAVLDRLN  SSGG+Q+ GW
Sbjct  514  DHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  552


 Score = 29.6 bits (65),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = -3

Query  648  FAPGNAYVMYDSEGPRGH  595
              PG+AY+MYDSEG R H
Sbjct  435  LPPGSAYMMYDSEGGRAH  452



>ref|XP_003539922.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoformX1 [Glycine max]
Length=533

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 72/100 (72%), Gaps = 7/100 (7%)
 Frame = -1

Query  593  HPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---QGMRNPPPYNELVEKLASMGYR  423
            HP QP F Q  YPP+S SL NPP     N+MVR P   Q +RN P YNEL+EKL SMG+R
Sbjct  435  HPPQPHFAQPGYPPTSASLQNPP--PGLNLMVRNPNQSQFIRNHP-YNELIEKLVSMGFR  491

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
             DH+ +VIQRMEESGQ +D N+VLDRLN HSS G Q+ GW
Sbjct  492  GDHVASVIQRMEESGQAIDFNSVLDRLNVHSSVGPQRGGW  531



>ref|XP_006592435.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoform X2 [Glycine max]
Length=534

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 72/100 (72%), Gaps = 7/100 (7%)
 Frame = -1

Query  593  HPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---QGMRNPPPYNELVEKLASMGYR  423
            HP QP F Q  YPP+S SL NPP     N+MVR P   Q +RN P YNEL+EKL SMG+R
Sbjct  436  HPPQPHFAQPGYPPTSASLQNPP--PGLNLMVRNPNQSQFIRNHP-YNELIEKLVSMGFR  492

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
             DH+ +VIQRMEESGQ +D N+VLDRLN HSS G Q+ GW
Sbjct  493  GDHVASVIQRMEESGQAIDFNSVLDRLNVHSSVGPQRGGW  532



>ref|XP_002272844.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Vitis 
vinifera]
Length=550

 Score =   104 bits (259),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 65/92 (71%), Gaps = 9/92 (10%)
 Frame = -1

Query  566  GAYPPSSFSLANPPQPANTNVMVR-----PPQGMRNPPPYNELVEKLASMGYRVDHIINV  402
            G YPP S S  NP     +N+MVR     PP+      PYNE +EKL +MGYR DH++NV
Sbjct  461  GVYPPVSVSSQNPQPTVGSNLMVRNSGQPPPRNH----PYNEWIEKLMNMGYRGDHVVNV  516

Query  401  IQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            IQRMEESGQP+D N++LDRLN + SGGSQ+GW
Sbjct  517  IQRMEESGQPIDFNSLLDRLNANPSGGSQRGW  548


 Score = 26.6 bits (57),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = -2

Query  688  PGDGYGVSGPHPFVCP  641
            PGD Y  SGPHP + P
Sbjct  421  PGDAYAASGPHPALHP  436


 Score = 25.0 bits (53),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = -3

Query  642  PGNAYVMYDSEG  607
            PGNAY+MYD+E 
Sbjct  436  PGNAYMMYDNEA  447



>gb|KJB77271.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77273.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=566

 Score =   105 bits (263),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNPPPYNELVEKLASMGYRV  420
            PQQP F QG YPP++ SL  P    + NVM+R     Q +RN P Y+ L+EK  SMG+R 
Sbjct  469  PQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVRNHP-YSYLIEKFVSMGFRA  527

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            DHI +VIQRMEESGQ VD NAVLDRLN  SSGG+Q+ GW
Sbjct  528  DHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  566


 Score = 29.6 bits (65),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = -3

Query  648  FAPGNAYVMYDSEGPRGH  595
              PG+AY+MYDSEG R H
Sbjct  449  LPPGSAYMMYDSEGGRAH  466



>gb|KJB77268.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77270.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77272.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=551

 Score =   105 bits (263),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNPPPYNELVEKLASMGYRV  420
            PQQP F QG YPP++ SL  P    + NVM+R     Q +RN P Y+ L+EK  SMG+R 
Sbjct  454  PQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVRNHP-YSYLIEKFVSMGFRA  512

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            DHI +VIQRMEESGQ VD NAVLDRLN  SSGG+Q+ GW
Sbjct  513  DHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  551


 Score = 29.6 bits (65),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = -3

Query  648  FAPGNAYVMYDSEGPRGH  595
              PG+AY+MYDSEG R H
Sbjct  434  LPPGSAYMMYDSEGGRAH  451



>gb|KJB77274.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=461

 Score =   105 bits (261),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNPPPYNELVEKLASMGYRV  420
            PQQP F QG YPP++ SL  P    + NVM+R     Q +RN P Y+ L+EK  SMG+R 
Sbjct  364  PQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVRNHP-YSYLIEKFVSMGFRA  422

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            DHI +VIQRMEESGQ VD NAVLDRLN  SSGG+Q+ GW
Sbjct  423  DHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  461


 Score = 29.6 bits (65),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = -3

Query  648  FAPGNAYVMYDSEGPRGH  595
              PG+AY+MYDSEG R H
Sbjct  344  LPPGSAYMMYDSEGGRAH  361



>ref|XP_007198900.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
 gb|EMJ00099.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
Length=529

 Score =   104 bits (260),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -1

Query  572  PQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQR  393
            P   YPP+S S   P      N+M R PQ +RN P Y+EL+EKLASMG+R DH+++VIQR
Sbjct  439  PHYGYPPTSASHQTPQPTTAPNLMARNPQFIRNHP-YSELIEKLASMGFRSDHVLSVIQR  497

Query  392  MEESGQPVDXNAVLDRL-NGHSSGGSQKGW  306
            MEE G+P+D NAV+DRL N HSSGG Q+GW
Sbjct  498  MEERGEPIDFNAVIDRLSNVHSSGGPQRGW  527


 Score = 25.8 bits (55),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPRGH  595
            +  PG+ Y+MYD EG R H
Sbjct  415  ALPPGSTYMMYDGEGGRTH  433


 Score = 23.9 bits (50),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 9/15 (60%), Positives = 11/15 (73%), Gaps = 0/15 (0%)
 Frame = -2

Query  685  GDGYGVSGPHPFVCP  641
            G+GY  SGPHP + P
Sbjct  404  GEGYAASGPHPALPP  418



>gb|KJB77267.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=419

 Score =   104 bits (259),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNPPPYNELVEKLASMGYRV  420
            PQQP F QG YPP++ SL  P    + NVM+R     Q +RN P Y+ L+EK  SMG+R 
Sbjct  322  PQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVRNHP-YSYLIEKFVSMGFRA  380

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            DHI +VIQRMEESGQ VD NAVLDRLN  SSGG+Q+ GW
Sbjct  381  DHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  419


 Score = 29.6 bits (65),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = -3

Query  648  FAPGNAYVMYDSEGPRGH  595
              PG+AY+MYDSEG R H
Sbjct  302  LPPGSAYMMYDSEGGRAH  319



>ref|XP_004506616.1| PREDICTED: transcription factor SPT20 homolog [Cicer arietinum]
Length=523

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 68/93 (73%), Gaps = 10/93 (11%)
 Frame = -1

Query  575  FPQGAYPPSSFSLANPPQPANTNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIIN  405
            F QG YPP+S SL NP      N+MVR P   Q +RN P YNEL+EKL +MG+R DH+ +
Sbjct  438  FAQGGYPPTSASLQNP------NLMVRNPSQSQFVRNHP-YNELIEKLVNMGFRGDHVAS  490

Query  404  VIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            VIQRMEESGQ +D N+VLDRLN H+S G Q+GW
Sbjct  491  VIQRMEESGQTIDFNSVLDRLNVHNSVGPQRGW  523



>gb|KJB77269.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=342

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 70/99 (71%), Gaps = 5/99 (5%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNPPPYNELVEKLASMGYRV  420
            PQQP F QG YPP++ SL  P    + NVM+R     Q +RN P Y+ L+EK  SMG+R 
Sbjct  245  PQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRNSSHSQYVRNHP-YSYLIEKFVSMGFRA  303

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            DHI +VIQRMEESGQ VD NAVLDRLN  SSGG+Q+ GW
Sbjct  304  DHIASVIQRMEESGQAVDFNAVLDRLNVQSSGGTQRGGW  342



>ref|XP_006582794.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Glycine max]
Length=486

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 85/139 (61%), Gaps = 11/139 (8%)
 Frame = -1

Query  710  LKPAFCAPRGWXRGKWTTPIRLPPEMLM*CMTVKDRGVIH--PQQPIFPQGAYPPSSFSL  537
            +K +F AP G   G   +   LPP      M   + G  H  PQ P F Q  YPP+S SL
Sbjct  350  MKSSFPAPPGEMYGPTGSLPALPPPSSAYMMYDGEGGRSHHPPQPPHFAQPGYPPTSASL  409

Query  536  ANPPQPANTNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVD  366
             NPPQ    N+MVR P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ VD
Sbjct  410  QNPPQ--GHNLMVRNPNQSQFVRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAVD  466

Query  365  XNAVLDRLNGHSSGGSQKG  309
             N+VLDRL   SS G Q+G
Sbjct  467  FNSVLDRL---SSVGPQRG  482



>ref|XP_008229158.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X2 [Prunus mume]
Length=529

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -1

Query  572  PQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQR  393
            P   YPP+S S   P      N+M R PQ +RN P Y+EL+EKLASMG+R DH+++VIQR
Sbjct  439  PHYGYPPTSASHQTPQPTTAPNLMARNPQFIRNHP-YSELIEKLASMGFRSDHVLSVIQR  497

Query  392  MEESGQPVDXNAVLDRL-NGHSSGGSQKGW  306
            MEE G+P+D NAV+DRL N HSSGG Q+GW
Sbjct  498  MEERGEPIDFNAVIDRLSNVHSSGGPQRGW  527



>ref|XP_008229157.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X1 [Prunus mume]
Length=530

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = -1

Query  572  PQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQR  393
            P   YPP+S S   P      N+M R PQ +RN P Y+EL+EKLASMG+R DH+++VIQR
Sbjct  440  PHYGYPPTSASHQTPQPTTAPNLMARNPQFIRNHP-YSELIEKLASMGFRSDHVLSVIQR  498

Query  392  MEESGQPVDXNAVLDRL-NGHSSGGSQKGW  306
            MEE G+P+D NAV+DRL N HSSGG Q+GW
Sbjct  499  MEERGEPIDFNAVIDRLSNVHSSGGPQRGW  528



>gb|KHN35253.1| hypothetical protein glysoja_042323 [Glycine soja]
Length=531

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 85/139 (61%), Gaps = 11/139 (8%)
 Frame = -1

Query  710  LKPAFCAPRGWXRGKWTTPIRLPPEMLM*CMTVKDRGVIH--PQQPIFPQGAYPPSSFSL  537
            +K +F AP G   G   +   LPP      M   + G  H  PQ P F Q  YPP+S SL
Sbjct  395  MKSSFPAPPGEMYGPTGSLPALPPPSSAYMMYDGEGGRSHHPPQPPHFAQPGYPPTSASL  454

Query  536  ANPPQPANTNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVD  366
             NPPQ    N+MVR P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ VD
Sbjct  455  QNPPQ--GHNLMVRNPNQSQFVRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAVD  511

Query  365  XNAVLDRLNGHSSGGSQKG  309
             N+VLDRL   SS G Q+G
Sbjct  512  FNSVLDRL---SSVGPQRG  527



>ref|XP_004303103.1| PREDICTED: transcriptional regulator DEF1 [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 82/138 (59%), Gaps = 6/138 (4%)
 Frame = -1

Query  710  LKPAFCAPRGWXRGKWTTPIRLPP-EMLM*CMTVKDRGVIHPQQPIFPQGAYPPSSFSLA  534
            +K AF A +G           LPP    M   +   R     Q P + QG YPP+S S  
Sbjct  404  IKGAFGAQQGDGYAAAGPHPALPPGSTYMMYDSEGGRNPYSAQVPHYSQGGYPPASGSQT  463

Query  533  NPPQPANT-NVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNA  357
              PQP    + MVR PQ +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +D NA
Sbjct  464  --PQPTTAPSHMVRNPQFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQTIDFNA  520

Query  356  VLDRLNGHSSGG-SQKGW  306
            V+DRLN HSSG   Q+GW
Sbjct  521  VIDRLNVHSSGAPPQRGW  538



>ref|XP_008337475.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
[Malus domestica]
Length=521

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -1

Query  563  AYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEE  384
             YPP+S S   P      NVM R PQ   N P YNEL+EKL  MG+R DH+++VIQRMEE
Sbjct  435  GYPPTSISHHMPQPTTAPNVMARNPQFPGNHP-YNELIEKLVPMGFRSDHVVSVIQRMEE  493

Query  383  SGQPVDXNAVLDRLNGHSSGGSQKGW  306
             GQPVD NAV+DRLN H SGG Q+GW
Sbjct  494  XGQPVDFNAVIDRLNAHPSGGPQRGW  519



>gb|KEH17617.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=527

 Score =   101 bits (251),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 68/98 (69%), Gaps = 10/98 (10%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---QGMRNPPPYNELVEKLASMGYRV  420
            PQ   F Q  YP +S SL NP      N++VR P   Q +RN P YNEL+EKL +MG+R 
Sbjct  435  PQPSHFAQSGYPQTSASLTNP------NLLVRNPSQSQFVRNHP-YNELIEKLVNMGFRG  487

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            DH+ +VIQRMEESGQ +D N+VLDRLN HSS G Q+GW
Sbjct  488  DHVASVIQRMEESGQTIDFNSVLDRLNVHSSVGPQRGW  525


 Score = 24.6 bits (52),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 13/17 (76%), Gaps = 1/17 (6%)
 Frame = -3

Query  642  PGNAYVMYD-SEGPRGH  595
            PGNAY+MYD  EG R H
Sbjct  415  PGNAYMMYDGGEGGRAH  431


 Score = 23.5 bits (49),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = -2

Query  688  PGDGYGVSGPHPFVCP  641
            PGD YG SG HP + P
Sbjct  398  PGDVYGASGTHPALPP  413



>ref|XP_009357856.1| PREDICTED: putative uncharacterized protein DDB_G0294196 [Pyrus 
x bretschneideri]
 ref|XP_009357877.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Pyrus x bretschneideri]
Length=521

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -1

Query  563  AYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEE  384
             YPP+S S   P      N+M R PQ   N P YNEL+EKL  MG+R DH+++VIQRMEE
Sbjct  435  GYPPTSISHHTPQPTTAPNLMARNPQFPHNHP-YNELIEKLVPMGFRSDHVVSVIQRMEE  493

Query  383  SGQPVDXNAVLDRLNGHSSGGSQKGW  306
            SGQPVD NAV+DRLN H SG  Q+GW
Sbjct  494  SGQPVDFNAVIDRLNAHPSGVPQRGW  519



>gb|KCW89535.1| hypothetical protein EUGRSUZ_A01820 [Eucalyptus grandis]
Length=471

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 73/106 (69%), Gaps = 7/106 (7%)
 Frame = -1

Query  608  DRGVIH--PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---QGMRNPPPYNELVEK  444
            + G +H  PQQP  PQGAYP ++ S  N  QP    + VR P   Q +R     NELV++
Sbjct  366  ESGRMHHVPQQPPLPQGAYPQTNISYQNL-QPTPPPIQVRNPAYPQFIRKHAD-NELVDR  423

Query  443  LASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            L SMG+RVDH+++VIQRMEESGQPVD N+VLDRL+G SSG  Q+ W
Sbjct  424  LVSMGFRVDHVLSVIQRMEESGQPVDFNSVLDRLSGPSSGNPQRAW  469



>ref|XP_010051997.1| PREDICTED: LOW QUALITY PROTEIN: bromodomain-containing protein 
4 [Eucalyptus grandis]
Length=513

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 73/106 (69%), Gaps = 7/106 (7%)
 Frame = -1

Query  608  DRGVIH--PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---QGMRNPPPYNELVEK  444
            + G +H  PQQP  PQGAYP ++ S  N  QP    + VR P   Q +R     NELV++
Sbjct  408  ESGRMHHVPQQPPLPQGAYPQTNISYQNL-QPTPPPIQVRNPAYPQFIRKHAD-NELVDR  465

Query  443  LASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            L SMG+RVDH+++VIQRMEESGQPVD N+VLDRL+G SSG  Q+ W
Sbjct  466  LVSMGFRVDHVLSVIQRMEESGQPVDFNSVLDRLSGPSSGNPQRAW  511



>ref|XP_008342910.1| PREDICTED: extensin-like isoform X1 [Malus domestica]
Length=522

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = -1

Query  563  AYPPSSFSLANPPQPANTNVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRM  390
             YPP S S   P      N+M R     + PP  PYNEL+EKL  MG+R DH+ +VIQRM
Sbjct  436  GYPPXSISHHTPQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRXDHVASVIQRM  492

Query  389  EESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            EESGQP+D NAV+DRLN H SGG Q+GW
Sbjct  493  EESGQPIDFNAVIDRLNSHPSGGPQRGW  520



>ref|XP_008342911.1| PREDICTED: extensin-like isoform X2 [Malus domestica]
Length=521

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 59/88 (67%), Gaps = 5/88 (6%)
 Frame = -1

Query  563  AYPPSSFSLANPPQPANTNVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRM  390
             YPP S S   P      N+M R     + PP  PYNEL+EKL  MG+R DH+ +VIQRM
Sbjct  435  GYPPXSISHHTPQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRXDHVASVIQRM  491

Query  389  EESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            EESGQP+D NAV+DRLN H SGG Q+GW
Sbjct  492  EESGQPIDFNAVIDRLNSHPSGGPQRGW  519



>gb|EYU28592.1| hypothetical protein MIMGU_mgv1a004659mg [Erythranthe guttata]
Length=516

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 8/88 (9%)
 Frame = -1

Query  566  GAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRME  387
            GAYPP    +  PP       MV P   MR+ P YNEL++KL +MGYR DH++ +IQRME
Sbjct  434  GAYPPGPQRMPGPPN------MVVPQSSMRSHP-YNELIDKLVAMGYRTDHVVGIIQRME  486

Query  386  ESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            ESGQ +D N+VLDRLNGHSSG SQ+ GW
Sbjct  487  ESGQTIDFNSVLDRLNGHSSGTSQRGGW  514



>gb|KEH39132.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=480

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 5/97 (5%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP--QGMRNPPPYNELVEKLASMGYRVD  417
            PQ   F QG YPP + SL NP   A  NV +R P  Q +    PYNEL+E L SMG R D
Sbjct  385  PQPSPFAQGGYPPQNASLQNP---APHNVTIRNPSQQKLMRSHPYNELIENLVSMGVRGD  441

Query  416  HIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
             ++++IQRMEE+GQPV+ N+VLDRLN HSS G Q+ W
Sbjct  442  LVVSIIQRMEETGQPVNFNSVLDRLNAHSSLGPQREW  478



>gb|KEH39131.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=500

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 66/102 (65%), Gaps = 5/102 (5%)
 Frame = -1

Query  605  RGVIHPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP--QGMRNPPPYNELVEKLASM  432
            R    PQ   F QG YPP + SL NP   A  NV +R P  Q +    PYNEL+E L SM
Sbjct  400  RASYPPQPSPFAQGGYPPQNASLQNP---APHNVTIRNPSQQKLMRSHPYNELIENLVSM  456

Query  431  GYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            G R D ++++IQRMEE+GQPV+ N+VLDRLN HSS G Q+ W
Sbjct  457  GVRGDLVVSIIQRMEETGQPVNFNSVLDRLNAHSSLGPQREW  498



>ref|XP_006447363.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60603.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=554

 Score = 97.1 bits (240),  Expect(3) = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 66/100 (66%), Gaps = 15/100 (15%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPAN-TNVMVR---PPQGMRNPPPYNELVEKLASMGYR  423
            PQQ  F QG YP          QP   +N++ R    PQ +RN   Y+EL+E L SMGYR
Sbjct  463  PQQSHFAQGGYPS---------QPTTGSNLLARNPSQPQFIRNHT-YSELIENLVSMGYR  512

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
             DH  +VIQRMEESGQPVD NAVLDRLN HSSGGSQ+ GW
Sbjct  513  GDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGGSQRGGW  552


 Score = 23.9 bits (50),  Expect(3) = 9e-20, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = -2

Query  688  PGDGYGVSGPHPFVCP  641
            PGDGY  +GP P + P
Sbjct  430  PGDGYAAAGPRPTLPP  445


 Score = 23.5 bits (49),  Expect(3) = 9e-20, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPR  601
            +  PG+ Y+MYDSE  R
Sbjct  442  TLPPGSGYMMYDSESGR  458



>ref|XP_006447362.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60602.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=553

 Score = 97.1 bits (240),  Expect(3) = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 66/100 (66%), Gaps = 15/100 (15%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPAN-TNVMVR---PPQGMRNPPPYNELVEKLASMGYR  423
            PQQ  F QG YP          QP   +N++ R    PQ +RN   Y+EL+E L SMGYR
Sbjct  462  PQQSHFAQGGYPS---------QPTTGSNLLARNPSQPQFIRNHT-YSELIENLVSMGYR  511

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
             DH  +VIQRMEESGQPVD NAVLDRLN HSSGGSQ+ GW
Sbjct  512  GDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGGSQRGGW  551


 Score = 23.9 bits (50),  Expect(3) = 9e-20, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = -2

Query  688  PGDGYGVSGPHPFVCP  641
            PGDGY  +GP P + P
Sbjct  429  PGDGYAAAGPRPTLPP  444


 Score = 23.5 bits (49),  Expect(3) = 9e-20, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPR  601
            +  PG+ Y+MYDSE  R
Sbjct  441  TLPPGSGYMMYDSESGR  457



>ref|XP_011098021.1| PREDICTED: extensin [Sesamum indicum]
Length=525

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 65/95 (68%), Gaps = 11/95 (12%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHI  411
            P QP F Q AYPP        P P   N++V  P  +R+ P YNEL+EKL  MGYR DH+
Sbjct  440  PPQPHFQQNAYPPQRM-----PSP---NMVV--PHSIRSHP-YNELIEKLVGMGYRGDHV  488

Query  410  INVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            + VIQR+EESGQ +D N+VLDRLNGH SGGSQ+ W
Sbjct  489  VGVIQRLEESGQTIDFNSVLDRLNGHPSGGSQRVW  523



>ref|XP_002325597.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE99978.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=537

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 65/100 (65%), Gaps = 15/100 (15%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMV----RPPQGMRNPPPYNELVEKLASMGYR  423
            PQQ  FPQG YPP         QPA    M+     P    RN P Y++L+EKL SMG+R
Sbjct  446  PQQSHFPQGGYPP---------QPAAGTGMLPRHSSPSHFFRNHP-YSDLIEKLVSMGFR  495

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
             DH  +VIQRMEESG+PVD NAVLDRLN  SSGGSQ+ GW
Sbjct  496  GDHAASVIQRMEESGEPVDFNAVLDRLNVQSSGGSQRGGW  535



>gb|KDO51849.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=549

 Score = 96.7 bits (239),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 66/100 (66%), Gaps = 15/100 (15%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPAN-TNVMVR---PPQGMRNPPPYNELVEKLASMGYR  423
            PQQ  F QG YP          QP   +N++ R    PQ +RN   Y+EL+E L SMGYR
Sbjct  458  PQQSHFAQGGYPS---------QPTTGSNLLARNPSQPQFIRNHT-YSELIENLVSMGYR  507

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
             DH  +VIQRMEESGQPVD NAVLDRLN HSSGGSQ+ GW
Sbjct  508  GDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGGSQRGGW  547


 Score = 23.9 bits (50),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = -2

Query  688  PGDGYGVSGPHPFVCP  641
            PGDGY  +GP P + P
Sbjct  425  PGDGYAAAGPRPTLPP  440


 Score = 23.1 bits (48),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPR  601
            +  PG+ Y+MYDSE  R
Sbjct  437  TLPPGSGYMMYDSESGR  453



>gb|KDO51850.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=550

 Score = 96.3 bits (238),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 66/100 (66%), Gaps = 15/100 (15%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPAN-TNVMVR---PPQGMRNPPPYNELVEKLASMGYR  423
            PQQ  F QG YP          QP   +N++ R    PQ +RN   Y+EL+E L SMGYR
Sbjct  459  PQQSHFAQGGYPS---------QPTTGSNLLARNPSQPQFIRNHT-YSELIENLVSMGYR  508

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
             DH  +VIQRMEESGQPVD NAVLDRLN HSSGGSQ+ GW
Sbjct  509  GDHAASVIQRMEESGQPVDFNAVLDRLNVHSSGGSQRGGW  548


 Score = 23.9 bits (50),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 11/16 (69%), Gaps = 0/16 (0%)
 Frame = -2

Query  688  PGDGYGVSGPHPFVCP  641
            PGDGY  +GP P + P
Sbjct  426  PGDGYAAAGPRPTLPP  441


 Score = 23.1 bits (48),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  651  SFAPGNAYVMYDSEGPR  601
            +  PG+ Y+MYDSE  R
Sbjct  438  TLPPGSGYMMYDSESGR  454



>ref|XP_011002849.1| PREDICTED: calcium-binding protein P-like [Populus euphratica]
Length=549

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 65/100 (65%), Gaps = 15/100 (15%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMV----RPPQGMRNPPPYNELVEKLASMGYR  423
            PQQ  FPQG YPP         QPA    M+     P    RN P Y++L+EKL SMG+R
Sbjct  458  PQQSHFPQGGYPP---------QPAAGTSMLPRHSSPSHFFRNHP-YSDLIEKLVSMGFR  507

Query  422  VDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
             DH  +VIQRMEESG+PVD NAVLDRLN  SSGGSQ+ GW
Sbjct  508  GDHAASVIQRMEESGEPVDFNAVLDRLNVLSSGGSQRGGW  547



>ref|XP_009341976.1| PREDICTED: ATP-dependent helicase brm-like isoform X1 [Pyrus 
x bretschneideri]
Length=522

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 59/87 (68%), Gaps = 5/87 (6%)
 Frame = -1

Query  560  YPPSSFSLANPPQPANTNVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRME  387
            YPP+S S   P      N+M R     + PP  PYNEL+EKL  MG+R DHI +VIQRME
Sbjct  437  YPPTSISHHTPQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRSDHIASVIQRME  493

Query  386  ESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            ESGQP+D NAV+DRLN H SG  Q+GW
Sbjct  494  ESGQPIDFNAVIDRLNAHPSGVPQRGW  520



>ref|XP_009341977.1| PREDICTED: ATP-dependent helicase brm-like isoform X2 [Pyrus 
x bretschneideri]
Length=521

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 59/87 (68%), Gaps = 5/87 (6%)
 Frame = -1

Query  560  YPPSSFSLANPPQPANTNVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRME  387
            YPP+S S   P      N+M R     + PP  PYNEL+EKL  MG+R DHI +VIQRME
Sbjct  436  YPPTSISHHTPQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRSDHIASVIQRME  492

Query  386  ESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            ESGQP+D NAV+DRLN H SG  Q+GW
Sbjct  493  ESGQPIDFNAVIDRLNAHPSGVPQRGW  519



>ref|XP_009336199.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Pyrus x bretschneideri]
Length=521

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 5/87 (6%)
 Frame = -1

Query  560  YPPSSFSLANPPQPANTNVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRME  387
            YPP+S S   P      N+M R     + PP  PYNEL+EKL  MG+R DH+ +VIQRME
Sbjct  436  YPPTSISHHTPQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRSDHVASVIQRME  492

Query  386  ESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            ESGQP+D NAV+DRLN H SG  Q+GW
Sbjct  493  ESGQPIDFNAVIDRLNAHPSGVPQRGW  519



>ref|XP_009336198.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Pyrus x bretschneideri]
Length=522

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 5/87 (6%)
 Frame = -1

Query  560  YPPSSFSLANPPQPANTNVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRME  387
            YPP+S S   P      N+M R     + PP  PYNEL+EKL  MG+R DH+ +VIQRME
Sbjct  437  YPPTSISHHTPQPTTAPNLMAR---NQQFPPNHPYNELIEKLVPMGFRSDHVASVIQRME  493

Query  386  ESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            ESGQP+D NAV+DRLN H SG  Q+GW
Sbjct  494  ESGQPIDFNAVIDRLNAHPSGVPQRGW  520



>ref|XP_006376495.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|ERP54292.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=532

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 13/98 (13%)
 Frame = -1

Query  587  QQPIFPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNPPPYNELVEKLASMGYRVD  417
            QQP FPQG YPP         Q A   ++ R   P   +RN   YN+L+EKL +MG+R D
Sbjct  442  QQPHFPQGVYPPQ--------QAAGAGMLPRHSSPSHFVRNNF-YNDLIEKLVNMGFRGD  492

Query  416  HIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            H+++VIQRMEE G+PVD N+VLDRL  HSSGGSQ+ GW
Sbjct  493  HVVSVIQRMEEGGEPVDFNSVLDRLKVHSSGGSQRGGW  530



>ref|XP_010242911.1| PREDICTED: RNA polymerase II degradation factor 1 [Nelumbo nucifera]
Length=560

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = -1

Query  581  PIFPQGAYPPSSFSLANPPQPA-NTNVMVRP--PQGMRNPPPYNELVEKLASMGYRVDHI  411
            P + QG+Y P   SL NP  PA ++N+M RP  P  M     Y EL+EK  SMGY  +H+
Sbjct  464  PHYTQGSYTPGPVSLHNPQVPAGSSNIMPRPRSPSHMMRNHVYAELIEKAVSMGYVREHV  523

Query  410  INVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
             +VI R+EESGQPVD N+VLDRLN   S G Q+GW
Sbjct  524  ASVIHRLEESGQPVDFNSVLDRLNVQPSVGYQRGW  558



>ref|XP_010924425.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X1 [Elaeis guineensis]
Length=517

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = -1

Query  563  AYPPSSFSLANPPQ--PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRM  390
            +YPPS+ S A  PQ  P+N   +  P   + +  PY E++EK  SMGY  DH  +VIQRM
Sbjct  428  SYPPSNVSPAQNPQLPPSNVVRVHHPGLQLMHTQPYGEMIEKAVSMGYARDHAASVIQRM  487

Query  389  EESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            EESGQP+D N++LDRLNG + G S + W
Sbjct  488  EESGQPIDFNSLLDRLNGQAGGASSRPW  515



>ref|XP_010924426.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 isoform X2 [Elaeis guineensis]
Length=425

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = -1

Query  563  AYPPSSFSLANPPQ--PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRM  390
            +YPPS+ S A  PQ  P+N   +  P   + +  PY E++EK  SMGY  DH  +VIQRM
Sbjct  336  SYPPSNVSPAQNPQLPPSNVVRVHHPGLQLMHTQPYGEMIEKAVSMGYARDHAASVIQRM  395

Query  389  EESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            EESGQP+D N++LDRLNG + G S + W
Sbjct  396  EESGQPIDFNSLLDRLNGQAGGASSRPW  423



>ref|XP_002869511.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45770.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D NA+LDRL+G SSGG  +GW
Sbjct  442  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGW  494



>ref|XP_003540363.1| PREDICTED: integrator complex subunit 3 homolog isoform 1 [Glycine 
max]
 gb|KHN27890.1| hypothetical protein glysoja_007622 [Glycine soja]
Length=532

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 79/139 (57%), Gaps = 11/139 (8%)
 Frame = -1

Query  710  LKPAFCAPRGWXRGKWTTPIRLPPEMLM*CMTVKDRGVIHPQQPI-FPQGAYPPSSFSLA  534
            ++ +F A  G   G   T    PP         ++    +P +P  + Q  YPP+S SL 
Sbjct  399  MRGSFSAQPGDVYGNSGTHTMRPPASSYNVYDGENARAHYPPEPSHYAQAGYPPTSASLH  458

Query  533  NPPQPANTNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDX  363
            NP   A+ N+MV  P   Q +R+ P YN+L+EK  SMG+R +H+ ++IQRMEE+ QP+D 
Sbjct  459  NP---ASHNLMVPSPSQSQFIRSHP-YNDLIEKFVSMGFRGNHVASIIQRMEETQQPIDF  514

Query  362  NAVLDRLNGHSSGGSQKGW  306
            N+V DRLN H     Q+GW
Sbjct  515  NSVHDRLNVH---NPQRGW  530



>ref|NP_974630.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE85467.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=438

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D N +LDRL+G SSGG  +GW
Sbjct  386  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  438



>emb|CAB79632.1| predicted proline-rich protein [Arabidopsis thaliana]
Length=508

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D N +LDRL+G SSGG  +GW
Sbjct  456  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  508



>ref|NP_194559.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36251.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AAM20028.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AEE85466.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=496

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D N +LDRL+G SSGG  +GW
Sbjct  444  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  496



>ref|XP_009137778.1| PREDICTED: basic salivary proline-rich protein 1-like [Brassica 
rapa]
 emb|CDY29896.1| BnaA03g49170D [Brassica napus]
Length=487

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH+++VIQRMEESGQP+D NA+LDRL+  SSGG  +GW
Sbjct  435  YGELIEKLVSMGFRGDHVMSVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  487



>ref|XP_006283593.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
 gb|EOA16491.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
Length=497

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK-GW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D NA+LDRL+G SSGG  + GW
Sbjct  444  YGELIEKLVSMGFRADHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  497



>ref|XP_008455323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Cucumis melo]
Length=542

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 61/96 (64%), Gaps = 8/96 (8%)
 Frame = -1

Query  575  FPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNP---PPYNELVEKLASMGYRVDH  414
            F Q  YPP++ S+     P+  +V+ R    P  MRN     PY E+VEKL  MG+R DH
Sbjct  449  FNQSGYPPANGSIQISQHPSGPHVVARNPNHPHYMRNQNQNHPYGEIVEKLVGMGFRSDH  508

Query  413  IINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            + +VI RMEESGQPVD NAVLD L+  +SGG Q+ W
Sbjct  509  VASVIHRMEESGQPVDFNAVLDGLS--NSGGPQRVW  542



>ref|XP_009144355.1| PREDICTED: protein transport protein SEC31-like [Brassica rapa]
Length=476

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D NA+LDRL+  SSGG  +GW
Sbjct  424  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSAQSSGGPPRGW  476



>emb|CDY67879.1| BnaC07g50480D [Brassica napus]
Length=478

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D NA+LDRL+  SSGG  +GW
Sbjct  426  YGELIEKLVSMGFRGDHVMGVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  478



>gb|KFK35898.1| hypothetical protein AALP_AA4G050800 [Arabis alpina]
Length=484

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D NA+LDRL+  SSGG  +GW
Sbjct  432  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  484



>emb|CDX89188.1| BnaA01g17050D [Brassica napus]
Length=470

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 5/62 (8%)
 Frame = -1

Query  476  NPPP-----YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK  312
             PPP     Y EL+EKL SMG+R DH++ VIQRMEESGQ +D NA+LDRL+  SSGG  +
Sbjct  409  TPPPVSRSKYGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSAQSSGGPPR  468

Query  311  GW  306
            GW
Sbjct  469  GW  470



>ref|XP_011037329.1| PREDICTED: bromodomain-containing protein 4-like isoform X1 [Populus 
euphratica]
Length=527

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 59/94 (63%), Gaps = 14/94 (15%)
 Frame = -1

Query  587  QQPIFPQGAYPPSSFSLANPPQPANTNVMV----RPPQGMRNPPPYNELVEKLASMGYRV  420
            QQP FPQG YPP         QPA    M+     P    RN   YN+L+EKL +MG+R 
Sbjct  443  QQPHFPQGVYPP---------QPAAGAGMLPRHSSPSHFARNNF-YNDLIEKLVNMGFRG  492

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGS  318
            DH+++VIQRMEE G+PVD N+VLDRL   SSG S
Sbjct  493  DHVVSVIQRMEEVGEPVDFNSVLDRLKVPSSGWS  526



>ref|XP_011037330.1| PREDICTED: putative uncharacterized protein DDB_G0294196 isoform 
X2 [Populus euphratica]
Length=526

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 59/94 (63%), Gaps = 14/94 (15%)
 Frame = -1

Query  587  QQPIFPQGAYPPSSFSLANPPQPANTNVMV----RPPQGMRNPPPYNELVEKLASMGYRV  420
            QQP FPQG YPP         QPA    M+     P    RN   YN+L+EKL +MG+R 
Sbjct  442  QQPHFPQGVYPP---------QPAAGAGMLPRHSSPSHFARNNF-YNDLIEKLVNMGFRG  491

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGS  318
            DH+++VIQRMEE G+PVD N+VLDRL   SSG S
Sbjct  492  DHVVSVIQRMEEVGEPVDFNSVLDRLKVPSSGWS  525



>ref|XP_010438481.1| PREDICTED: formin-like protein 5 [Camelina sativa]
Length=497

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGG-SQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D NA+LDRL+G SSGG  + GW
Sbjct  444  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  497



>ref|XP_010433239.1| PREDICTED: bromodomain-containing protein 4-like [Camelina sativa]
Length=494

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGG-SQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D NA+LDRL+G SSGG  + GW
Sbjct  441  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  494



>ref|XP_010448000.1| PREDICTED: vacuolar protein-sorting protein BRO1-like [Camelina 
sativa]
Length=495

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGG-SQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D NA+LDRL+G SSGG  + GW
Sbjct  442  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  495



>emb|CDY18985.1| BnaC01g20830D [Brassica napus]
Length=479

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -1

Query  476  NPPP-----YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQK  312
             PPP     Y EL+EKL SMG+R DH+I VIQRMEESGQP++ NA+LD+L+  SSGG  +
Sbjct  418  TPPPVLRTKYGELIEKLMSMGFRGDHVIAVIQRMEESGQPIEFNALLDKLSVQSSGGPPR  477

Query  311  GW  306
            GW
Sbjct  478  GW  479



>ref|XP_006412973.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
 gb|ESQ54426.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
Length=499

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+D NA+LDRL+  SSGG  +GW
Sbjct  447  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSVPSSGGPPRGW  499



>ref|XP_008455322.1| PREDICTED: transcription factor SPT20 homolog [Cucumis melo]
Length=514

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 59/96 (61%), Gaps = 8/96 (8%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQ-PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDH  414
            PQQ  F Q  YP ++     PPQ PA  +V  R P        ++ L+EKL  MG+R DH
Sbjct  426  PQQAHFNQSGYPLANAPHQVPPQAPAGPHVSARNPS-------HSHLIEKLVGMGFRGDH  478

Query  413  IINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            + ++IQRME+SGQPVD NAVLDRL+  S  G Q+ W
Sbjct  479  VASIIQRMEDSGQPVDFNAVLDRLSSPSGPGPQRAW  514



>emb|CDX97433.1| BnaC08g12980D [Brassica napus]
Length=492

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +D NA+LDRL+  SSGG  +GW
Sbjct  440  YGELIEKLVSMGFRGDHVMTVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  492



>ref|XP_004136824.1| PREDICTED: uncharacterized protein LOC101206745 [Cucumis sativus]
 ref|XP_004155474.1| PREDICTED: uncharacterized protein LOC101231079 [Cucumis sativus]
 gb|KGN43616.1| hypothetical protein Csa_7G048000 [Cucumis sativus]
Length=515

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 59/96 (61%), Gaps = 8/96 (8%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQ-PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDH  414
            PQQ  F Q  YP ++     PPQ PA  +V  R P        ++ L+EKL  MG+R DH
Sbjct  427  PQQTHFNQSGYPLANAPHQVPPQAPAGPHVSARNPS-------HSHLIEKLVGMGFRGDH  479

Query  413  IINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            + ++IQRME+SGQPVD NAVLDRL+  S  G Q+ W
Sbjct  480  VASIIQRMEDSGQPVDFNAVLDRLSSPSGPGPQRAW  515



>ref|XP_004136823.1| PREDICTED: uncharacterized protein LOC101206501 [Cucumis sativus]
 ref|XP_004155475.1| PREDICTED: uncharacterized protein LOC101231301 [Cucumis sativus]
 gb|KGN43615.1| Structural constituent of cell wall [Cucumis sativus]
Length=545

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 60/98 (61%), Gaps = 10/98 (10%)
 Frame = -1

Query  575  FPQGAYPPSSFSLANPPQPANTNVMVR---PPQGMRNP-----PPYNELVEKLASMGYRV  420
            F Q  Y P++ SL     P+  +V+ R    P  MRN       PY E+VEKL  MG+R 
Sbjct  450  FNQSGYSPANGSLQISQHPSGPHVVARNPNHPHYMRNQNPNQNHPYGEIVEKLVGMGFRS  509

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            DH+ ++I RMEESGQPVD NAVLD L+  +SGG Q+ W
Sbjct  510  DHVASIIHRMEESGQPVDFNAVLDGLS--NSGGPQRVW  545



>emb|CDY25250.1| BnaA02g22060D [Brassica napus]
Length=492

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +D NA+LDRL+  SSGG  +GW
Sbjct  440  YGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  492



>emb|CDY14248.1| BnaA08g13790D [Brassica napus]
Length=491

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +D NA+LDRL+  SSGG  +GW
Sbjct  439  YGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  491



>ref|XP_008798248.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 [Phoenix dactylifera]
Length=514

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = -1

Query  563  AYPPSSFSLANPPQPANTNVMVRPPQGMRNPP--PYNELVEKLASMGYRVDHIINVIQRM  390
            +YPPS  S A  PQ  ++NV      G++  P  PY E++EK  SMGY  DH  + IQRM
Sbjct  425  SYPPSIVSAAQNPQLPSSNVGGVHHPGLQLMPAQPYGEMIEKAVSMGYARDHAASAIQRM  484

Query  389  EESGQPVDXNAVLDRLNGHSSGGSQKGW  306
             ESGQP+D N++LDRLNG + G S + W
Sbjct  485  GESGQPIDFNSLLDRLNGQAGGASPRIW  512



>ref|XP_010540875.1| PREDICTED: extensin [Tarenaya hassleriana]
Length=492

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 53/95 (56%), Gaps = 19/95 (20%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHI  411
            PQQ  FP G Y P                     Q +R    Y EL+EKL SMG+R DH+
Sbjct  417  PQQTHFPPGGYAPQQGGR----------------QFLRASSAYGELIEKLVSMGFRGDHV  460

Query  410  INVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            + VIQRMEESGQP+D NAVLDRL+  S    Q+GW
Sbjct  461  MAVIQRMEESGQPIDFNAVLDRLSVQS---PQRGW  492



>ref|XP_009109102.1| PREDICTED: formin-like protein 3 [Brassica rapa]
Length=500

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  464  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +D NA+LDRL+  SSGG  +GW
Sbjct  448  YGELIEKLMSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  500



>ref|XP_008810225.1| PREDICTED: ataxin-2 homolog isoform X1 [Phoenix dactylifera]
Length=516

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = -1

Query  560  YPPSSFSLANPPQ--PANTNVMVRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRM  390
            YPPS+ S A   Q  P N   +  P PQ MR+ P Y E++EK  SMGY  DH+ +VIQR+
Sbjct  428  YPPSNVSAAQNQQLPPGNVVGVHHPGPQLMRSHP-YGEMIEKAVSMGYARDHVASVIQRV  486

Query  389  EESGQPVDXNAVLDRLNGHSSGGSQKGW  306
             ESGQP+D N++LD LNG  +GGS + W
Sbjct  487  GESGQPMDFNSLLDMLNGRVTGGSTRVW  514



>ref|XP_008810226.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
 ref|XP_008810227.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
Length=493

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = -1

Query  560  YPPSSFSLANPPQ--PANTNVMVRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRM  390
            YPPS+ S A   Q  P N   +  P PQ MR+ P Y E++EK  SMGY  DH+ +VIQR+
Sbjct  405  YPPSNVSAAQNQQLPPGNVVGVHHPGPQLMRSHP-YGEMIEKAVSMGYARDHVASVIQRV  463

Query  389  EESGQPVDXNAVLDRLNGHSSGGSQKGW  306
             ESGQP+D N++LD LNG  +GGS + W
Sbjct  464  GESGQPMDFNSLLDMLNGRVTGGSTRVW  491



>ref|XP_007149849.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
 gb|ESW21843.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
Length=513

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 57/97 (59%), Gaps = 12/97 (12%)
 Frame = -1

Query  593  HPQQPIFP-QGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVD  417
            +P QP    QG YPP+S SL N    + +              P NEL+EK  SMG+R D
Sbjct  426  YPSQPSHTTQGGYPPTSASLHNTAPHSQSQ--------FNRINPNNELIEKFVSMGFRGD  477

Query  416  HIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            H+++ IQRM+E+ QP+D N+VLDRLN H     Q+GW
Sbjct  478  HVVSTIQRMQETEQPIDFNSVLDRLNVH---NLQRGW  511



>gb|EPS62243.1| hypothetical protein M569_12549, partial [Genlisea aurea]
Length=512

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLN-GHSSGGSQKGW  306
            PYNEL+EKL  MGYR +H++ VIQR+EESGQ VD N+VLDRLN G   GGSQ+GW
Sbjct  457  PYNELIEKLIGMGYRGEHVVGVIQRLEESGQAVDFNSVLDRLNGGGGGGGSQRGW  511



>ref|XP_003543336.1| PREDICTED: RNA polymerase II degradation factor 1-like [Glycine 
max]
Length=537

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 10/98 (10%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP---QGMRNPPPYNELVEKLASMGYRV  420
            PQ   + Q  YPP+S S  N    A  N+MV  P   Q +R+   YN+L+EK  SMG+R 
Sbjct  445  PQPSHYAQAGYPPTSASHQNH---APHNLMVGSPSQSQFIRSHL-YNDLIEKFVSMGFRG  500

Query  419  DHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            DH+ N+IQRMEE+  P+D N+V DRL+ H+    Q+GW
Sbjct  501  DHVANIIQRMEETQLPIDFNSVHDRLDVHN---PQRGW  535



>gb|EEC71500.1| hypothetical protein OsI_03777 [Oryza sativa Indica Group]
Length=595

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = -1

Query  560  YPPSSFSLANPPQ--PANTNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQ  396
            YPPS  S A  PQ  PA  NV +  P   Q MR  P Y E++EK  +MGY  + ++NVIQ
Sbjct  507  YPPSGPSAAQAPQMPPAPGNVGMSHPGSHQMMRGHP-YGEMIEKAITMGYPREQVMNVIQ  565

Query  395  RMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            RM ESGQP+D N +LDRLN   SG   + W
Sbjct  566  RMTESGQPMDFNTLLDRLNEAGSGAPPRAW  595



>ref|NP_001044280.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAD87289.1| putative calcium-binding protein [Oryza sativa Japonica Group]
 dbj|BAF06194.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAG93651.1| unnamed protein product [Oryza sativa Japonica Group]
Length=594

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = -1

Query  560  YPPSSFSLANPPQ--PANTNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQ  396
            YPPS  S A  PQ  PA  NV +  P   Q MR  P Y E++EK  +MGY  + ++NVIQ
Sbjct  506  YPPSGPSAAQAPQMPPAPGNVGMSHPGSHQMMRGHP-YGEMIEKAITMGYPREQVMNVIQ  564

Query  395  RMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            RM ESGQP+D N +LDRLN   SG   + W
Sbjct  565  RMTESGQPMDFNTLLDRLNEAGSGAPPRAW  594



>gb|KHN36637.1| hypothetical protein glysoja_001368 [Glycine soja]
Length=537

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = -1

Query  590  PQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHI  411
            PQ   + Q  YPP+S S  N   P N  V             YN+L+EK  SMG+R DH+
Sbjct  445  PQPSHYAQAGYPPTSASHQNHA-PHNLMVGSTSQSQFIRSHLYNDLIEKFVSMGFRGDHV  503

Query  410  INVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
             N+IQRMEE+  P+D N+V DRL+ H+    Q+GW
Sbjct  504  ANIIQRMEETQLPIDFNSVNDRLDVHN---PQRGW  535



>ref|XP_010919602.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X2 [Elaeis guineensis]
Length=488

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = -1

Query  563  AYPPSSFSLANPPQ-PANTNVMVRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRM  390
            +YPPS+ S A   Q P    V V P PQ +R+ P Y E++EK   MGY  +H+ +VIQRM
Sbjct  400  SYPPSNASAAQNQQLPPGNVVGVHPGPQLVRSHP-YGEMIEKAVGMGYAREHVASVIQRM  458

Query  389  EESGQPVDXNAVLDRLNGHSSGGSQKGW  306
             E+GQP+D N++LD LNG ++  S + W
Sbjct  459  GETGQPMDFNSLLDMLNGRATSASARVW  486



>ref|XP_010919593.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X1 [Elaeis guineensis]
Length=515

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = -1

Query  563  AYPPSSFSLANPPQ-PANTNVMVRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRM  390
            +YPPS+ S A   Q P    V V P PQ +R+ P Y E++EK   MGY  +H+ +VIQRM
Sbjct  427  SYPPSNASAAQNQQLPPGNVVGVHPGPQLVRSHP-YGEMIEKAVGMGYAREHVASVIQRM  485

Query  389  EESGQPVDXNAVLDRLNGHSSGGSQKGW  306
             E+GQP+D N++LD LNG ++  S + W
Sbjct  486  GETGQPMDFNSLLDMLNGRATSASARVW  513



>dbj|BAK01177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 52/93 (56%), Gaps = 4/93 (4%)
 Frame = -1

Query  572  PQGAYPPSSFSLANPPQ--PANTNVMVRPP--QGMRNPPPYNELVEKLASMGYRVDHIIN  405
            P G YPPS  S A  PQ  P    V    P    M    PY +++EK  +MGY  D ++N
Sbjct  511  PYGGYPPSGPSAAQAPQMPPGGGGVSHPGPSHHHMMRGHPYGDMIEKAITMGYPRDQVLN  570

Query  404  VIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            VIQRM ESGQ +D NA+LDRLN   SG   + W
Sbjct  571  VIQRMTESGQQIDFNALLDRLNESGSGAPPRAW  603



>ref|XP_006644724.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Oryza brachyantha]
Length=587

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 51/87 (59%), Gaps = 8/87 (9%)
 Frame = -1

Query  560  YPPSSFSLANPPQ--PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRME  387
            YPPS  S    PQ  PA       P Q MR  P Y E++EK  +MGY  + ++NVIQRM 
Sbjct  507  YPPSGPSAGQAPQMPPAPG-----PHQMMRGHP-YGEMIEKAITMGYPREQVLNVIQRMT  560

Query  386  ESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            ESGQP+D N +LDRLN   SG   + W
Sbjct  561  ESGQPMDFNTLLDRLNEAGSGAHPRAW  587



>ref|XP_006644725.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Oryza brachyantha]
Length=586

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 51/87 (59%), Gaps = 8/87 (9%)
 Frame = -1

Query  560  YPPSSFSLANPPQ--PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRME  387
            YPPS  S    PQ  PA       P Q MR  P Y E++EK  +MGY  + ++NVIQRM 
Sbjct  506  YPPSGPSAGQAPQMPPAPG-----PHQMMRGHP-YGEMIEKAITMGYPREQVLNVIQRMT  559

Query  386  ESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            ESGQP+D N +LDRLN   SG   + W
Sbjct  560  ESGQPMDFNTLLDRLNEAGSGAHPRAW  586



>emb|CDM84126.1| unnamed protein product [Triticum aestivum]
Length=603

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 54/100 (54%), Gaps = 4/100 (4%)
 Frame = -1

Query  593  HPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP----QGMRNPPPYNELVEKLASMGY  426
            HPQ      G YPP+  S A  PQ     V V  P      M    PY +++EK  +MGY
Sbjct  504  HPQGYNTSYGGYPPNDPSAAQAPQMPPGGVGVSHPGSSHHHMMRGHPYGDMIEKAITMGY  563

Query  425  RVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
              D ++NVIQRM +SGQ +D NA+LDRLN   SG   + W
Sbjct  564  PRDQVLNVIQRMTDSGQQIDFNALLDRLNESGSGAPPRPW  603



>gb|EMT05386.1| hypothetical protein F775_26441 [Aegilops tauschii]
Length=606

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 50/91 (55%), Gaps = 4/91 (4%)
 Frame = -1

Query  566  GAYPPSSFSLANPPQPANTNVMVRPP----QGMRNPPPYNELVEKLASMGYRVDHIINVI  399
            G YPP+  S A  PQ       V  P      M    PY +++EK  +MGY  D ++NVI
Sbjct  516  GGYPPNGPSAAQAPQMPPGGAGVSHPGSSHHHMMRGHPYGDMIEKANTMGYPRDQVLNVI  575

Query  398  QRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            QRM ESGQ +D NA+LDRLN   SG   + W
Sbjct  576  QRMTESGQQIDFNALLDRLNESGSGAPPRPW  606



>ref|XP_004969990.1| PREDICTED: trithorax group protein osa-like [Setaria italica]
Length=590

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            PY E++EK  +MGY  + ++NV QRM ESGQP+D N +LDRLN   SG   + W
Sbjct  537  PYGEMIEKAITMGYPREQVLNVTQRMAESGQPMDFNTLLDRLNEAGSGAPPRAW  590



>ref|XP_009395702.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Musa acuminata subsp. malaccensis]
Length=581

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = -1

Query  584  QPIFPQGAYPPSSFSLANPPQ--PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHI  411
            Q   P   YPPS+   +   Q  P+N        + MRN P Y +++EK   MGY  + +
Sbjct  488  QAYHPAYNYPPSNLQASRNQQGPPSNGPAPHYETRLMRNHP-YGDMIEKAIGMGYDGNQV  546

Query  410  INVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            ++++QRM E+GQP+D N++LDRLNG ++G + + W
Sbjct  547  MSLVQRMAETGQPMDFNSLLDRLNGQAAGATPRAW  581



>ref|XP_002458505.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
 gb|EES03625.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
Length=587

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -1

Query  563  AYPPSSFSLANPPQ-PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRME  387
            AYPPS      P Q P     M  P   M    PY E++EK  +MGY  D ++NV QRM 
Sbjct  500  AYPPSGPPAVQPQQMPPGGVGMSHPGSHMMRGHPYGEMMEKAITMGYPRDQVLNVTQRMA  559

Query  386  ESGQPVDXNAVLDRLNGHSSGG  321
            ESGQP+D N +LDRLN   SG 
Sbjct  560  ESGQPMDFNTLLDRLNEAGSGA  581



>gb|EMS50510.1| hypothetical protein TRIUR3_23019 [Triticum urartu]
Length=606

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 12/100 (12%)
 Frame = -1

Query  593  HPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP----QGMRNPPPYNELVEKLASMGY  426
            HPQ      G+YPPS         P+       PP      M    PY +++EK  +MGY
Sbjct  515  HPQGYNTSYGSYPPSG--------PSAVQAAQMPPGSSQHHMMRGHPYGDMIEKAITMGY  566

Query  425  RVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
              + ++NVIQRM ESGQ +D NA+LDRLN   SG   + W
Sbjct  567  PREQVLNVIQRMTESGQQIDFNALLDRLNESGSGAPPRPW  606



>ref|XP_008655245.1| PREDICTED: uncharacterized protein LOC100383096 isoform X1 [Zea 
mays]
 gb|AFW85062.1| putative DUF1421 domain family protein [Zea mays]
Length=584

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = -1

Query  563  AYPPSSFSLANPPQ-PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRME  387
            AYPP+      P Q P     M  P   M    PY E++EK  +MGY  D ++NV QRM 
Sbjct  497  AYPPNGPPAVQPQQMPPGGVGMSHPASHMMRGHPYGEMMEKAITMGYPRDQVLNVTQRMA  556

Query  386  ESGQPVDXNAVLDRLNGHSSGG  321
            ESGQ +D N +LDRLN   SG 
Sbjct  557  ESGQSMDFNTLLDRLNEAGSGA  578



>ref|NP_001169238.1| uncharacterized protein LOC100383096 [Zea mays]
 gb|ACN32051.1| unknown [Zea mays]
Length=507

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = -1

Query  563  AYPPSSFSLANPPQ-PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRME  387
            AYPP+      P Q P     M  P   M    PY E++EK  +MGY  D ++NV QRM 
Sbjct  420  AYPPNGPPAVQPQQMPPGGVGMSHPASHMMRGHPYGEMMEKAITMGYPRDQVLNVTQRMA  479

Query  386  ESGQPVDXNAVLDRLNGHSSGG  321
            ESGQ +D N +LDRLN   SG 
Sbjct  480  ESGQSMDFNTLLDRLNEAGSGA  501



>ref|XP_009396506.1| PREDICTED: pinin-like [Musa acuminata subsp. malaccensis]
Length=512

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = -1

Query  566  GAYPPSS-FSLANPPQ--PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQ  396
             +YPP++ F +A   Q  P+N+  +    +  RN   Y E++EK   MGY  + II  +Q
Sbjct  424  SSYPPNNNFPVARNQQIPPSNSAALPYDSRLTRNHS-YGEMIEKAVGMGYDRNQIIGAVQ  482

Query  395  RMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            RM ESGQP+D +++LDRLNG ++    + W
Sbjct  483  RMVESGQPMDFHSLLDRLNGQAAAAPARAW  512



>gb|KEH24794.1| DNA-binding protein, putative [Medicago truncatula]
Length=565

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGS---QKGW  306
            P +++VEK+A+MG+  DH+   ++++ E+GQ VD N VLD+L     GG    Q+GW
Sbjct  506  PVDDIVEKVATMGFPRDHVRATVRKLTENGQAVDLNTVLDKLMNEGGGGDMQQQRGW  562



>ref|XP_008795992.1| PREDICTED: protein transport protein SEC31-like [Phoenix dactylifera]
Length=553

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  479  RNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            +N  P +++VEK+A+MG+  D +   ++++ ESGQ VD N VLD+L        QKGW
Sbjct  493  KNRLPIDDVVEKVATMGFSRDQVRATVRKLTESGQSVDLNVVLDKLMNDEEIQPQKGW  550



>ref|XP_006446566.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
 gb|ESR59806.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
Length=574

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            P +++V+K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  518  PIDDVVDKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  571



>ref|XP_006470271.1| PREDICTED: COPII coat assembly protein sec16-like [Citrus sinensis]
Length=574

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            P +++V+K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  518  PIDDVVDKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  571



>ref|XP_006643803.1| PREDICTED: vegetative cell wall protein gp1-like [Oryza brachyantha]
Length=573

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            P +++VEK+A+MG+  + +   ++R+ E+GQ VD N VLD+L   S    QKGW
Sbjct  517  PVDDVVEKVATMGFSREQVRATVRRLTENGQNVDLNVVLDKLMNDSDVQPQKGW  570



>ref|XP_010940140.1| PREDICTED: protein diaphanous homolog 1-like [Elaeis guineensis]
Length=549

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  479  RNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            +N  P +++VEK+A+MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  489  KNRLPIDDVVEKVATMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  546



>ref|XP_001784568.1| predicted protein [Physcomitrella patens]
 gb|EDQ50633.1| predicted protein [Physcomitrella patens]
Length=378

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 6/58 (10%)
 Frame = -1

Query  461  NELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRL-NGHSSGGSQ-----KGW  306
            +E+++K+ASMG+  D +  +++++ E+G  VD N VLD+L NG SSGG++     KGW
Sbjct  318  DEVIDKVASMGFGRDQVRAIVRKLMENGTTVDLNVVLDKLMNGDSSGGNEGQQPAKGW  375



>gb|KDO55180.1| hypothetical protein CISIN_1g0084162mg, partial [Citrus sinensis]
Length=462

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  406  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  459



>ref|XP_001770189.1| predicted protein [Physcomitrella patens]
 gb|EDQ65023.1| predicted protein [Physcomitrella patens]
Length=403

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 6/60 (10%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRL-NGHSSGGSQ-----KGW  306
            P +E+++K+ASMG+  D +   ++++ E+G  VD N VLD+L NG SSG ++     KGW
Sbjct  341  PVDEVIDKVASMGFGRDQVRATVRKLTENGTSVDLNVVLDKLMNGDSSGRNESQQPAKGW  400



>gb|KDO55179.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=566

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  510  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  563



>gb|KDO55178.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=564

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  508  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  561



>emb|CAJ44247.1| hypothetical protein [Cocos nucifera]
Length=120

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -1

Query  476  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            N  P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  56   NRMPIDDVVDKVVTMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  112



>ref|XP_008801947.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Phoenix 
dactylifera]
Length=539

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            P +++V+K+A+MG+  D +   ++R+ E+GQ VD N VLD+L        QKGW
Sbjct  483  PIDDVVDKVATMGFSRDQVRAAVRRLTENGQSVDLNVVLDKLMNDGEIQPQKGW  536



>ref|XP_006655038.1| PREDICTED: vegetative cell wall protein gp1-like, partial [Oryza 
brachyantha]
Length=495

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRL-NGHSSGGSQKGW  306
            P +++V+K+A+MG+  + +   ++++ ESGQ VD N VLD+L NG S    Q+GW
Sbjct  438  PIDDVVDKVATMGFSREEVRAAVRQLTESGQNVDLNVVLDKLMNGSSDAQPQRGW  492



>ref|XP_011097415.1| PREDICTED: protein enabled-like [Sesamum indicum]
Length=543

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L     G +Q+GW
Sbjct  487  PIDDVVDKVTNMGFPRDQVRATVRKLTENGQSVDLNIVLDKLMNDGDGQAQRGW  540



>ref|XP_001758183.1| predicted protein [Physcomitrella patens]
 gb|EDQ77005.1| predicted protein [Physcomitrella patens]
Length=437

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 5/55 (9%)
 Frame = -1

Query  461  NELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRL-NGHSSGGSQ--KGW  306
            +E+++K+A MG+  D +  V++R+ E+GQ VD N VLD+L NG   GG+Q  KGW
Sbjct  381  DEVIDKVAVMGFSKDQVRAVVRRLTENGQSVDLNVVLDKLMNG--DGGAQPPKGW  433



>ref|XP_010108811.1| hypothetical protein L484_020546 [Morus notabilis]
 gb|EXC20326.1| hypothetical protein L484_020546 [Morus notabilis]
Length=591

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            P +++++K+ +MG+  DH+   ++++ E+GQ VD N VLD+L     G   +GW
Sbjct  535  PIDDVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNEGEGQLPRGW  588



>ref|XP_002300038.2| hypothetical protein POPTR_0001s34990g [Populus trichocarpa]
 gb|EEE84843.2| hypothetical protein POPTR_0001s34990g [Populus trichocarpa]
Length=337

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            P +++V+K+ SMG+  +H+   ++++ E+GQ VD N VLD+L        Q+GW
Sbjct  281  PLDDVVDKVTSMGFPREHVEATVRKLTENGQSVDLNIVLDKLMNDGDVQPQRGW  334



>ref|XP_009388841.1| PREDICTED: bromodomain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=538

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -1

Query  461  NELVEKLASMGYRVDHIINVIQRMEESGQPVDXNAVLDRLNGHSSGGSQKGW  306
            +++VEK+A+MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  484  DDVVEKVATMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  535



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365