BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF018G01

Length=686
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011092961.1|  PREDICTED: probable 26S proteasome non-ATPas...    284   2e-89   Sesamum indicum [beniseed]
ref|XP_004153753.1|  PREDICTED: probable 26S proteasome non-ATPas...    272   3e-89   
ref|XP_002312950.2|  26S proteasome regulatory subunit S3 family ...    283   4e-89   
emb|CDP19574.1|  unnamed protein product                                282   1e-88   Coffea canephora [robusta coffee]
ref|XP_008460112.1|  PREDICTED: probable 26S proteasome non-ATPas...    281   3e-88   Cucumis melo [Oriental melon]
ref|XP_011045871.1|  PREDICTED: probable 26S proteasome non-ATPas...    281   3e-88   Populus euphratica
gb|KDO68111.1|  hypothetical protein CISIN_1g011352mg                   278   1e-87   Citrus sinensis [apfelsine]
sp|P93768.1|PSMD3_TOBAC  RecName: Full=Probable 26S proteasome no...    279   1e-87   Nicotiana tabacum [American tobacco]
ref|XP_009628272.1|  PREDICTED: probable 26S proteasome non-ATPas...    279   2e-87   Nicotiana tomentosiformis
ref|XP_006422568.1|  hypothetical protein CICLE_v10028313mg             279   2e-87   Citrus clementina [clementine]
ref|XP_009773689.1|  PREDICTED: probable 26S proteasome non-ATPas...    279   2e-87   Nicotiana sylvestris
emb|CDO98056.1|  unnamed protein product                                278   2e-87   Coffea canephora [robusta coffee]
ref|XP_009623855.1|  PREDICTED: probable 26S proteasome non-ATPas...    278   3e-87   Nicotiana tomentosiformis
ref|XP_011088624.1|  PREDICTED: probable 26S proteasome non-ATPas...    277   1e-86   Sesamum indicum [beniseed]
ref|XP_004231054.1|  PREDICTED: probable 26S proteasome non-ATPas...    276   2e-86   
dbj|BAG94867.1|  unnamed protein product                                273   3e-86   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA48734.1|  TPA: hypothetical protein ZEAMMB73_878535              269   3e-86   
ref|XP_002521275.1|  26S proteasome regulatory subunit S3, putative     275   4e-86   Ricinus communis
ref|XP_004167007.1|  PREDICTED: probable 26S proteasome non-ATPas...    268   6e-86   
gb|EEC83998.1|  hypothetical protein OsI_30168                          270   6e-86   Oryza sativa Indica Group [Indian rice]
ref|XP_008447941.1|  PREDICTED: probable 26S proteasome non-ATPas...    274   7e-86   Cucumis melo [Oriental melon]
gb|AFK34954.1|  unknown                                                 264   8e-86   Lotus japonicus
ref|XP_002279715.1|  PREDICTED: probable 26S proteasome non-ATPas...    274   1e-85   Vitis vinifera
ref|XP_002306189.1|  26S proteasome regulatory subunit S3 family ...    274   1e-85   Populus trichocarpa [western balsam poplar]
ref|XP_009799469.1|  PREDICTED: probable 26S proteasome non-ATPas...    274   2e-85   Nicotiana sylvestris
gb|EAZ09931.1|  hypothetical protein OsI_32229                          274   2e-85   Oryza sativa Indica Group [Indian rice]
ref|NP_001063817.1|  Os09g0541900                                       273   2e-85   
ref|XP_010920092.1|  PREDICTED: probable 26S proteasome non-ATPas...    273   2e-85   Elaeis guineensis
ref|XP_004145004.1|  PREDICTED: probable 26S proteasome non-ATPas...    273   4e-85   Cucumis sativus [cucumbers]
ref|XP_011046661.1|  PREDICTED: probable 26S proteasome non-ATPas...    273   4e-85   Populus euphratica
ref|XP_010266036.1|  PREDICTED: probable 26S proteasome non-ATPas...    272   5e-85   Nelumbo nucifera [Indian lotus]
ref|XP_010933362.1|  PREDICTED: probable 26S proteasome non-ATPas...    272   6e-85   Elaeis guineensis
ref|XP_006660915.1|  PREDICTED: probable 26S proteasome non-ATPas...    269   7e-85   
ref|XP_004500920.1|  PREDICTED: probable 26S proteasome non-ATPas...    272   8e-85   Cicer arietinum [garbanzo]
ref|XP_007136115.1|  hypothetical protein PHAVU_009G019100g             272   9e-85   Phaseolus vulgaris [French bean]
ref|XP_004957510.1|  PREDICTED: probable 26S proteasome non-ATPas...    272   9e-85   Setaria italica
gb|KEH36262.1|  26S proteasome non-ATPase regulatory subunit 3          270   9e-85   Medicago truncatula
ref|XP_010063310.1|  PREDICTED: probable 26S proteasome non-ATPas...    271   1e-84   Eucalyptus grandis [rose gum]
gb|KDP29682.1|  hypothetical protein JCGZ_18844                         271   1e-84   Jatropha curcas
gb|EYU37968.1|  hypothetical protein MIMGU_mgv1a005284mg                271   2e-84   Erythranthe guttata [common monkey flower]
ref|XP_006416422.1|  hypothetical protein EUTSA_v10007479mg             271   2e-84   Eutrema salsugineum [saltwater cress]
ref|XP_004974153.1|  PREDICTED: probable 26S proteasome non-ATPas...    271   2e-84   Setaria italica
ref|XP_003527532.1|  PREDICTED: probable 26S proteasome non-ATPas...    271   2e-84   Glycine max [soybeans]
ref|XP_003603813.1|  26S proteasome non-ATPase regulatory subunit       271   2e-84   Medicago truncatula
dbj|BAG87837.1|  unnamed protein product                                268   2e-84   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002444618.1|  hypothetical protein SORBIDRAFT_07g024800          271   2e-84   Sorghum bicolor [broomcorn]
ref|XP_003523322.1|  PREDICTED: probable 26S proteasome non-ATPas...    270   3e-84   Glycine max [soybeans]
gb|KEH36263.1|  26S proteasome non-ATPase regulatory subunit 3          270   3e-84   Medicago truncatula
ref|XP_010229049.1|  PREDICTED: probable 26S proteasome non-ATPas...    270   4e-84   
dbj|BAB78499.1|  26S proteasome regulatory particle non-ATPase su...    268   4e-84   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010107643.1|  putative 26S proteasome non-ATPase regulator...    270   5e-84   Morus notabilis
ref|NP_001149380.1|  LOC100283005                                       270   8e-84   Zea mays [maize]
ref|XP_006660365.1|  PREDICTED: probable 26S proteasome non-ATPas...    269   8e-84   Oryza brachyantha
gb|EEE69116.1|  hypothetical protein OsJ_28197                          269   8e-84   Oryza sativa Japonica Group [Japonica rice]
gb|ACF84535.1|  unknown                                                 269   9e-84   Zea mays [maize]
gb|ACN28097.1|  unknown                                                 269   9e-84   Zea mays [maize]
gb|ACG34075.1|  26S proteasome non-ATPase regulatory subunit 3          269   1e-83   Zea mays [maize]
ref|XP_004144854.1|  PREDICTED: probable 26S proteasome non-ATPas...    269   1e-83   Cucumis sativus [cucumbers]
ref|XP_010266868.1|  PREDICTED: probable 26S proteasome non-ATPas...    269   1e-83   Nelumbo nucifera [Indian lotus]
gb|KHN09062.1|  Putative 26S proteasome non-ATPase regulatory sub...    269   1e-83   Glycine soja [wild soybean]
ref|NP_001149170.1|  26S proteasome non-ATPase regulatory subunit 3     269   1e-83   Zea mays [maize]
ref|XP_007017882.1|  PAM domain (PCI/PINT associated module) prot...    269   1e-83   
gb|EYU22574.1|  hypothetical protein MIMGU_mgv1a005362mg                269   1e-83   Erythranthe guttata [common monkey flower]
ref|NP_001062444.1|  Os08g0550100                                       268   1e-83   
gb|KHN45952.1|  Putative 26S proteasome non-ATPase regulatory sub...    268   2e-83   Glycine soja [wild soybean]
gb|KFK42036.1|  hypothetical protein AALP_AA2G203500                    268   2e-83   Arabis alpina [alpine rockcress]
dbj|BAK06811.1|  predicted protein                                      265   2e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002510590.1|  26S proteasome regulatory subunit S3, putative     268   2e-83   Ricinus communis
ref|NP_173447.1|  probable 26S proteasome non-ATPase regulatory s...    268   3e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459703.1|  PREDICTED: 26S proteasome non-ATPase regulat...    268   3e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010666922.1|  PREDICTED: probable 26S proteasome non-ATPas...    268   3e-83   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM53298.1|  putative proteasome regulatory subunit S3               268   4e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935159.1|  PREDICTED: probable 26S proteasome non-ATPas...    268   4e-83   Elaeis guineensis
ref|XP_007041788.1|  PAM domain (PCI/PINT associated module) prot...    267   4e-83   
ref|XP_003545019.1|  PREDICTED: probable 26S proteasome non-ATPas...    267   5e-83   Glycine max [soybeans]
ref|XP_002889051.1|  hypothetical protein ARALYDRAFT_476749             267   6e-83   
ref|XP_009401896.1|  PREDICTED: probable 26S proteasome non-ATPas...    267   7e-83   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK01467.1|  predicted protein                                      266   1e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008809439.1|  PREDICTED: probable 26S proteasome non-ATPas...    266   1e-82   Phoenix dactylifera
gb|AAF79894.1|AC022472_3  Contains similarity to 26s proteasome r...    267   2e-82   Arabidopsis thaliana [mouse-ear cress]
gb|KJB15844.1|  hypothetical protein B456_002G199200                    264   2e-82   Gossypium raimondii
ref|XP_007200984.1|  hypothetical protein PRUPE_ppa004807mg             265   2e-82   Prunus persica
emb|CDX87648.1|  BnaA07g32250D                                          265   3e-82   
ref|XP_010536429.1|  PREDICTED: 26S proteasome non-ATPase regulat...    265   3e-82   Tarenaya hassleriana [spider flower]
ref|NP_177726.1|  probable 26S proteasome non-ATPase regulatory s...    265   3e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106250.1|  PREDICTED: 26S proteasome non-ATPase regulat...    265   3e-82   Brassica rapa
ref|XP_008811676.1|  PREDICTED: probable 26S proteasome non-ATPas...    265   3e-82   Phoenix dactylifera
sp|Q06364.2|PSMD3_DAUCA  RecName: Full=Probable 26S proteasome no...    265   3e-82   Daucus carota [carrots]
gb|KJB15843.1|  hypothetical protein B456_002G199200                    265   4e-82   Gossypium raimondii
ref|XP_010498455.1|  PREDICTED: 26S proteasome non-ATPase regulat...    265   4e-82   Camelina sativa [gold-of-pleasure]
gb|EMT33081.1|  Putative 26S proteasome non-ATPase regulatory sub...    265   4e-82   
ref|XP_003578544.1|  PREDICTED: probable 26S proteasome non-ATPas...    265   5e-82   Brachypodium distachyon [annual false brome]
ref|XP_006307354.1|  hypothetical protein CARUB_v10008972mg             265   5e-82   Capsella rubella
ref|XP_010477252.1|  PREDICTED: 26S proteasome non-ATPase regulat...    265   6e-82   Camelina sativa [gold-of-pleasure]
ref|XP_006390248.1|  hypothetical protein EUTSA_v10018459mg             264   7e-82   Eutrema salsugineum [saltwater cress]
gb|AAF26768.2|AC007396_17  T4O12.21                                     265   1e-81   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73215.1|  BnaC06g36630D                                          263   1e-81   
gb|KHG18147.1|  putative 26S proteasome non-ATPase regulatory sub...    263   2e-81   Gossypium arboreum [tree cotton]
ref|XP_008236045.1|  PREDICTED: probable 26S proteasome non-ATPas...    262   4e-81   Prunus mume [ume]
gb|AAP80660.1|AF479041_1  regulatory particle mon-ATPase subunit 3      251   8e-81   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002893093.1|  EMB2719                                            261   1e-80   Arabidopsis lyrata subsp. lyrata
ref|XP_010416506.1|  PREDICTED: 26S proteasome non-ATPase regulat...    261   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_002285893.1|  PREDICTED: probable 26S proteasome non-ATPas...    260   2e-80   Vitis vinifera
ref|XP_008382101.1|  PREDICTED: probable 26S proteasome non-ATPas...    260   2e-80   Malus domestica [apple tree]
gb|EMS46362.1|  putative 26S proteasome non-ATPase regulatory sub...    265   2e-80   Triticum urartu
ref|XP_008806135.1|  PREDICTED: probable 26S proteasome non-ATPas...    260   3e-80   Phoenix dactylifera
ref|XP_009355646.1|  PREDICTED: probable 26S proteasome non-ATPas...    260   3e-80   Pyrus x bretschneideri [bai li]
ref|XP_006302193.1|  hypothetical protein CARUB_v10020202mg             259   4e-80   Capsella rubella
gb|EMT22108.1|  Putative 26S proteasome non-ATPase regulatory sub...    259   6e-80   
ref|XP_009413027.1|  PREDICTED: probable 26S proteasome non-ATPas...    259   7e-80   
dbj|BAK07086.1|  predicted protein                                      258   2e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90869.1|  predicted protein                                      258   3e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010428646.1|  PREDICTED: 26S proteasome non-ATPase regulat...    257   4e-79   Camelina sativa [gold-of-pleasure]
gb|EMS49644.1|  putative 26S proteasome non-ATPase regulatory sub...    257   6e-79   Triticum urartu
gb|EPS67790.1|  hypothetical protein M569_06981                         256   6e-79   Genlisea aurea
ref|XP_004290733.1|  PREDICTED: probable 26S proteasome non-ATPas...    256   7e-79   Fragaria vesca subsp. vesca
ref|XP_003550437.1|  PREDICTED: probable 26S proteasome non-ATPas...    256   1e-78   Glycine max [soybeans]
ref|XP_006601362.1|  PREDICTED: probable 26S proteasome non-ATPas...    256   1e-78   
ref|XP_010471748.1|  PREDICTED: 26S proteasome non-ATPase regulat...    255   2e-78   
gb|ABR16257.1|  unknown                                                 255   2e-78   Picea sitchensis
gb|KJB47689.1|  hypothetical protein B456_008G037000                    255   2e-78   Gossypium raimondii
ref|XP_006855514.1|  hypothetical protein AMTR_s00057p00205760          255   2e-78   Amborella trichopoda
ref|XP_008377724.1|  PREDICTED: LOW QUALITY PROTEIN: probable 26S...    255   3e-78   
ref|XP_009382040.1|  PREDICTED: probable 26S proteasome non-ATPas...    255   3e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007160631.1|  hypothetical protein PHAVU_001G003600g             254   4e-78   Phaseolus vulgaris [French bean]
ref|XP_007222347.1|  hypothetical protein PRUPE_ppa004821mg             254   8e-78   Prunus persica
gb|KHG11096.1|  putative 26S proteasome non-ATPase regulatory sub...    252   1e-77   Gossypium arboreum [tree cotton]
ref|XP_008221216.1|  PREDICTED: probable 26S proteasome non-ATPas...    253   1e-77   Prunus mume [ume]
ref|XP_008221217.1|  PREDICTED: probable 26S proteasome non-ATPas...    253   1e-77   Prunus mume [ume]
dbj|BAA02696.1|  21D7 antigen                                           250   2e-76   Daucus carota [carrots]
ref|XP_007017885.1|  PAM domain (PCI/PINT associated module) prot...    249   3e-76   
ref|XP_003589555.1|  26S proteasome non-ATPase regulatory subunit       244   3e-74   Medicago truncatula
ref|XP_010446093.1|  PREDICTED: 26S proteasome non-ATPase regulat...    240   1e-73   
ref|XP_004499304.1|  PREDICTED: probable 26S proteasome non-ATPas...    243   1e-73   Cicer arietinum [garbanzo]
gb|AAC79872.1|  putative 21D7 protein                                   233   2e-73   
ref|XP_001757567.1|  predicted protein                                  241   6e-73   
ref|XP_001753136.1|  predicted protein                                  239   4e-72   
ref|XP_010446200.1|  PREDICTED: 26S proteasome non-ATPase regulat...    238   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_001764054.1|  predicted protein                                  235   1e-70   
ref|XP_009628274.1|  PREDICTED: probable 26S proteasome non-ATPas...    229   2e-68   Nicotiana tomentosiformis
ref|XP_009628273.1|  PREDICTED: probable 26S proteasome non-ATPas...    229   2e-68   Nicotiana tomentosiformis
ref|XP_009773691.1|  PREDICTED: probable 26S proteasome non-ATPas...    226   5e-67   Nicotiana sylvestris
ref|XP_009773690.1|  PREDICTED: probable 26S proteasome non-ATPas...    226   5e-67   Nicotiana sylvestris
ref|XP_002970446.1|  hypothetical protein SELMODRAFT_231540             223   3e-66   
ref|XP_004231453.1|  PREDICTED: probable 26S proteasome non-ATPas...    217   8e-64   Solanum lycopersicum
ref|XP_002300686.1|  26S proteasome regulatory subunit S3 family ...    206   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_011034975.1|  PREDICTED: probable 26S proteasome non-ATPas...    204   6e-59   Populus euphratica
ref|XP_011034976.1|  PREDICTED: probable 26S proteasome non-ATPas...    204   8e-59   Populus euphratica
ref|XP_011034972.1|  PREDICTED: probable 26S proteasome non-ATPas...    205   8e-59   Populus euphratica
gb|ERE68314.1|  26S proteasome non-ATPase regulatory subunit 3-li...    170   1e-48   Cricetulus griseus [Chinese hamsters]
sp|Q9U5Z8.1|PSMD3_ANOST  RecName: Full=Probable 26S proteasome no...    177   2e-48   Anopheles stephensi
ref|XP_005952777.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   2e-48   
ref|XP_010209308.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   2e-48   Tinamus guttatus
ref|XP_009950809.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   3e-48   Leptosomus discolor
gb|KFB39121.1|  AGAP009082-PA-like protein                              175   6e-48   Anopheles sinensis
ref|XP_005497468.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   1e-47   
gb|ABN12032.1|  putative 26S proteasome non-ATPase regulatory sub...    167   1e-47   Maconellicoccus hirsutus [pink hibiscus mealybug]
emb|CDS04865.1|  hypothetical protein LRAMOSA07395                      174   1e-47   Lichtheimia ramosa
emb|CDH49942.1|  proteasome regulatory particle subunit                 174   1e-47   Lichtheimia corymbifera JMRC:FSU:9682
gb|ETN60770.1|  26S proteasome regulatory subunit S3                    174   2e-47   Anopheles darlingi [American malaria mosquito]
ref|XP_002945863.1|  26S proteasome regulatory complex                  174   2e-47   Volvox carteri f. nagariensis
ref|XP_004707502.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   2e-47   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_009075840.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    169   3e-47   Acanthisitta chloris
ref|XP_002595252.1|  hypothetical protein BRAFLDRAFT_268075             174   4e-47   Branchiostoma floridae
ref|XP_005181586.1|  PREDICTED: probable 26S proteasome non-ATPas...    173   5e-47   Musca domestica
gb|EFX72606.1|  hypothetical protein DAPPUDRAFT_227411                  172   7e-47   Daphnia pulex
ref|NP_956866.1|  26S proteasome non-ATPase regulatory subunit 3        172   8e-47   Danio rerio [leopard danio]
ref|XP_001696175.1|  26S proteasome regulatory subunit                  172   9e-47   Chlamydomonas reinhardtii
ref|XP_010084066.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   1e-46   Pterocles gutturalis
gb|EXX77249.1|  proteasome regulatory particle lid subunit RPN3         171   1e-46   Rhizophagus irregularis DAOM 197198w
ref|XP_003222495.1|  PREDICTED: 26S proteasome non-ATPase regulat...    172   2e-46   Anolis carolinensis [Carolina anole]
ref|XP_001626069.1|  predicted protein                                  171   2e-46   Nematostella vectensis
emb|CEI90573.1|  Putative Proteasome regulatory particle subunit        164   2e-46   Rhizopus microsporus
ref|XP_009333239.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-46   Pygoscelis adeliae
ref|XP_008688097.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   2e-46   Ursus maritimus [white bear]
ref|XP_010722887.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-46   Meleagris gallopavo [common turkey]
dbj|BAE01724.1|  unnamed protein product                                170   2e-46   Macaca fascicularis [crab eating macaque]
ref|XP_011143024.1|  PREDICTED: probable 26S proteasome non-ATPas...    171   2e-46   Harpegnathos saltator
ref|XP_004450126.1|  PREDICTED: 26S proteasome non-ATPase regulat...    172   2e-46   Dasypus novemcinctus
ref|XP_001605959.1|  PREDICTED: probable 26S proteasome non-ATPas...    171   2e-46   Nasonia vitripennis
ref|XP_006214329.1|  PREDICTED: 26S proteasome non-ATPase regulat...    172   2e-46   Vicugna pacos
ref|XP_005029524.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-46   
ref|XP_011494959.1|  PREDICTED: probable 26S proteasome non-ATPas...    171   3e-46   Ceratosolen solmsi marchali
ref|XP_004608798.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   3e-46   Sorex araneus [Eurasian shrew]
ref|XP_008414675.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   3e-46   Poecilia reticulata
gb|EXX77250.1|  proteasome regulatory particle lid subunit RPN3         171   3e-46   Rhizophagus irregularis DAOM 197198w
gb|EOA94377.1|  26S proteasome non-ATPase regulatory subunit 3          169   3e-46   Anas platyrhynchos [duck]
ref|XP_009477980.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   3e-46   Pelecanus crispus
ref|XP_008293025.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   3e-46   Stegastes partitus
ref|XP_319831.2|  AGAP009082-PA                                         171   3e-46   Anopheles gambiae str. PEST
ref|XP_003442595.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   4e-46   Oreochromis niloticus
ref|XP_008988616.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   4e-46   
ref|XP_623947.1|  PREDICTED: probable 26S proteasome non-ATPase r...    171   4e-46   
ref|XP_003705277.1|  PREDICTED: probable 26S proteasome non-ATPas...    171   4e-46   Megachile rotundata
gb|AFM88771.1|  26S proteasome non-ATPase regulatory subunit 3-li...    171   4e-46   Callorhinchus milii [Australian ghost shark]
ref|XP_005368329.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   4e-46   Microtus ochrogaster [prairie voles]
ref|XP_003689802.1|  PREDICTED: probable 26S proteasome non-ATPas...    171   4e-46   Apis florea [dwarf honeybee]
ref|XP_001662261.1|  AAEL012122-PA                                      171   4e-46   Aedes aegypti
ref|XP_005753080.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   4e-46   Pundamilia nyererei
ref|XP_011235692.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   4e-46   
ref|XP_006608624.1|  PREDICTED: probable 26S proteasome non-ATPas...    170   4e-46   Apis dorsata [rock honeybee]
ref|XP_009874430.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   4e-46   Apaloderma vittatum
ref|XP_008328616.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   5e-46   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005321856.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   5e-46   Ictidomys tridecemlineatus
ref|XP_005999586.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   5e-46   Latimeria chalumnae
ref|XP_005394396.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   5e-46   Chinchilla lanigera
ref|XP_006638287.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   5e-46   Lepisosteus oculatus
ref|XP_004591217.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   5e-46   Ochotona princeps [southern American pika]
ref|XP_009988054.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   5e-46   Tauraco erythrolophus
ref|XP_001846487.1|  26S proteasome non-ATPase regulatory subunit 3     170   5e-46   Culex quinquefasciatus
ref|XP_004608797.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   6e-46   Sorex araneus [Eurasian shrew]
ref|XP_007062032.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   6e-46   
ref|XP_007940247.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   6e-46   Orycteropus afer afer
ref|XP_007420739.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   6e-46   
ref|XP_010840930.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   7e-46   Bison bison bison
gb|EPB85306.1|  hypothetical protein HMPREF1544_07920                   170   7e-46   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_009578233.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   7e-46   Fulmarus glacialis
ref|XP_009883974.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   7e-46   Charadrius vociferus
dbj|BAG51399.1|  unnamed protein product                                170   7e-46   Homo sapiens [man]
ref|XP_006176397.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   7e-46   Camelus ferus
ref|XP_010308532.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   7e-46   Balearica regulorum gibbericeps
ref|XP_010206163.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   7e-46   Colius striatus
gb|AAC18058.1|  diphenol oxidase-A2                                     170   7e-46   Anopheles gambiae
ref|XP_010295693.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   7e-46   Phaethon lepturus
ref|XP_003278356.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   7e-46   
ref|XP_007618536.1|  PREDICTED: 26S proteasome non-ATPase regulat...    171   8e-46   
ref|XP_009569021.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   8e-46   Cuculus canorus
gb|EMC77897.1|  26S proteasome non-ATPase regulatory subunit 3          169   8e-46   
ref|XP_006889464.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   8e-46   Elephantulus edwardii [Cape long-eared elephant shrew]
dbj|BAB71019.1|  unnamed protein product                                170   8e-46   Homo sapiens [man]
ref|XP_009640850.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   8e-46   Egretta garzetta
dbj|BAG60639.1|  unnamed protein product                                170   8e-46   Homo sapiens [man]
dbj|BAC04310.1|  unnamed protein product                                170   9e-46   Homo sapiens [man]
ref|XP_005232750.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   9e-46   
gb|AJK90582.1|  26S proteasome non-ATPase regulatory subunit 3          169   9e-46   Laodelphax striatella
ref|XP_007940246.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   9e-46   Orycteropus afer afer
dbj|GAN08202.1|  26S proteasome non-ATPase regulatory subunit 3         169   9e-46   Mucor ambiguus
ref|XP_009463186.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   9e-46   Nipponia nippon
ref|XP_011056581.1|  PREDICTED: probable 26S proteasome non-ATPas...    169   9e-46   Acromyrmex echinatior
ref|XP_971686.1|  PREDICTED: probable 26S proteasome non-ATPase r...    169   9e-46   Tribolium castaneum [rust-red flour beetle]
ref|XP_002424930.1|  26S proteasome regulatory subunit S3, putative     170   9e-46   Pediculus humanus corporis [human body lice]
ref|XP_004378111.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   9e-46   
ref|XP_010007099.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   9e-46   Chaetura pelagica
ref|XP_008827637.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Nannospalax galili
ref|XP_004282791.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Orcinus orca [Orca]
emb|CAG33053.1|  PSMD3                                                  170   1e-45   Homo sapiens [man]
ref|XP_005898084.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Bos mutus
gb|AAP36540.1|  Homo sapiens proteasome (prosome, macropain) 26S ...    170   1e-45   synthetic construct
ref|XP_004764682.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Mustela putorius furo [black ferret]
ref|NP_002800.2|  26S proteasome non-ATPase regulatory subunit 3        170   1e-45   Homo sapiens [man]
ref|XP_001918105.2|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    170   1e-45   
ref|XP_004395090.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Odobenus rosmarus divergens
ref|XP_006889462.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004633773.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Octodon degus
dbj|BAA23651.1|  proteasome subunit p58                                 170   1e-45   Homo sapiens [man]
ref|XP_003942883.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Saimiri boliviensis boliviensis
ref|XP_006832632.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   1e-45   Chrysochloris asiatica
gb|AAA37241.1|  Tum-P91A antigen                                        170   1e-45   Mus musculus [mouse]
ref|XP_007531081.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Erinaceus europaeus [common hedgehog]
gb|AIC54981.1|  PSMD3                                                   170   1e-45   synthetic construct
ref|XP_008063363.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Carlito syrichta
ref|XP_004311972.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004434606.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_008517128.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Equus przewalskii [Przewalski horse]
ref|XP_009672109.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   1e-45   Struthio camelus australis
ref|XP_002940423.2|  PREDICTED: 26S proteasome non-ATPase regulat...    169   1e-45   Xenopus tropicalis [western clawed frog]
ref|XP_005076004.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Mesocricetus auratus [Syrian golden hamster]
gb|AIC54982.1|  PSMD3                                                   170   1e-45   synthetic construct
gb|AAH12302.1|  Proteasome (prosome, macropain) 26S subunit, non-...    170   1e-45   Homo sapiens [man]
ref|XP_006889463.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_001008282.1|  26S proteasome non-ATPase regulatory subunit 3     170   1e-45   Rattus norvegicus [brown rat]
ref|NP_033465.1|  26S proteasome non-ATPase regulatory subunit 3        170   1e-45   Mus musculus [mouse]
ref|XP_007112590.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|NP_001233571.1|  26S proteasome non-ATPase regulatory subunit 3     170   1e-45   Pan troglodytes
ref|XP_007940245.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Orycteropus afer afer
ref|XP_004434605.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_008152049.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   Eptesicus fuscus
ref|XP_005964828.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    170   1e-45   Pantholops hodgsonii [Tibetan antelope]
ref|NP_001039365.1|  26S proteasome non-ATPase regulatory subunit 3     170   1e-45   Bos taurus [bovine]
ref|XP_007177639.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_008063362.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_004378110.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_003414749.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_004655517.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_005861943.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_003913001.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_010990106.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_006832631.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   1e-45   
gb|ELR54788.1|  26S proteasome non-ATPase regulatory subunit 3          170   1e-45   
ref|NP_001247785.1|  26S proteasome non-ATPase regulatory subunit 3     170   1e-45   
ref|XP_006155982.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_003996842.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_006100873.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_006924749.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_004684293.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_004012903.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_003131544.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_011257200.1|  PREDICTED: probable 26S proteasome non-ATPas...    169   1e-45   
ref|XP_548138.2|  PREDICTED: 26S proteasome non-ATPase regulatory...    170   1e-45   
ref|XP_008269649.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    170   1e-45   
ref|XP_003786457.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_007562147.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   1e-45   
ref|XP_007085857.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_008580238.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_010958760.1|  PREDICTED: 26S proteasome non-ATPase regulat...    170   1e-45   
ref|XP_003466977.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   1e-45   
ref|XP_009271354.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   1e-45   
ref|XP_005513827.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   1e-45   
ref|NP_001085955.1|  proteasome (prosome, macropain) 26S subunit,...    169   1e-45   
gb|KDE02541.1|  hypothetical protein MVLG_06904                         170   1e-45   
ref|XP_003395331.1|  PREDICTED: probable 26S proteasome non-ATPas...    169   1e-45   
gb|EIE84168.1|  hypothetical protein RO3G_08878                         169   2e-45   
ref|XP_003488721.1|  PREDICTED: probable 26S proteasome non-ATPas...    169   2e-45   
ref|XP_011175669.1|  PREDICTED: probable 26S proteasome non-ATPas...    169   2e-45   
ref|XP_006832630.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-45   
ref|XP_010583859.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-45   
ref|XP_006022648.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-45   
ref|XP_006832629.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-45   
ref|XP_002827666.3|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-45   
ref|XP_005531480.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-45   
ref|XP_010411046.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-45   
ref|XP_011309304.1|  PREDICTED: probable 26S proteasome non-ATPas...    169   2e-45   
ref|XP_002051535.1|  GJ11636                                            168   2e-45   
ref|XP_005694359.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-45   
ref|XP_009094795.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    169   2e-45   
ref|XP_006117479.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   2e-45   
ref|XP_005059837.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   2e-45   
ref|XP_006749652.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   3e-45   
gb|AFM87810.1|  26S proteasome non-ATPase regulatory subunit 3-li...    169   3e-45   
emb|CDQ70571.1|  unnamed protein product                                169   3e-45   
gb|ERL86992.1|  hypothetical protein D910_04395                         168   3e-45   
dbj|BAG62596.1|  unnamed protein product                                169   3e-45   
ref|XP_011197796.1|  PREDICTED: probable 26S proteasome non-ATPas...    168   3e-45   
ref|XP_002002367.1|  GI13097                                            168   3e-45   
ref|XP_008641506.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   3e-45   
ref|XP_008503984.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   4e-45   
gb|ADX97120.1|  26S proteasome non-ATPase regulatory subunit 3          166   4e-45   
ref|XP_005294194.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   4e-45   
ref|XP_005439436.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   4e-45   
dbj|BAG57021.1|  unnamed protein product                                168   4e-45   
ref|NP_001026533.1|  26S proteasome non-ATPase regulatory subunit 3     168   4e-45   
gb|ACN10780.1|  26S proteasome non-ATPase regulatory subunit 3          168   4e-45   
ref|NP_001133516.1|  26S proteasome non-ATPase regulatory subunit 3     168   4e-45   
ref|XP_007230838.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   5e-45   
dbj|BAE32050.1|  unnamed protein product                                168   5e-45   
ref|XP_005107539.1|  PREDICTED: 26S proteasome non-ATPase regulat...    167   5e-45   
ref|XP_004859530.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   5e-45   
ref|XP_007908064.1|  PREDICTED: 26S proteasome non-ATPase regulat...    169   6e-45   
gb|ENN77223.1|  hypothetical protein YQE_06053                          168   6e-45   
emb|CEP09572.1|  hypothetical protein                                   167   7e-45   
ref|XP_004646320.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   7e-45   
ref|XP_003768348.1|  PREDICTED: 26S proteasome non-ATPase regulat...    167   7e-45   
ref|XP_002067151.1|  GK24169                                            167   7e-45   
emb|CAF95635.1|  unnamed protein product                                167   8e-45   
gb|AFM88157.1|  26S proteasome non-ATPase regulatory subunit 3-li...    167   8e-45   
ref|XP_001987942.1|  GH10894                                            167   9e-45   
ref|XP_002079876.1|  GD24178                                            167   9e-45   
ref|XP_007404787.1|  hypothetical protein MELLADRAFT_41669              167   9e-45   
ref|XP_002039065.1|  GM17319                                            167   1e-44   
ref|XP_002090656.1|  GE13227                                            167   1e-44   
emb|CDQ74838.1|  unnamed protein product                                167   1e-44   
ref|XP_001974302.1|  GG21155                                            167   1e-44   
ref|XP_011471341.1|  PREDICTED: 26S proteasome non-ATPase regulat...    166   1e-44   
gb|AAL90075.1|  AT15146p                                                167   1e-44   
ref|NP_477300.1|  regulatory particle non-ATPase 3, isoform A           166   1e-44   
ref|XP_001961923.1|  GF14695                                            166   1e-44   
ref|XP_011190713.1|  PREDICTED: probable 26S proteasome non-ATPas...    166   1e-44   
ref|XP_011331025.1|  PREDICTED: probable 26S proteasome non-ATPas...    166   1e-44   
ref|XP_008553436.1|  PREDICTED: probable 26S proteasome non-ATPas...    166   1e-44   
ref|XP_005430458.1|  PREDICTED: 26S proteasome non-ATPase regulat...    168   2e-44   
ref|XP_004931019.1|  PREDICTED: probable 26S proteasome non-ATPas...    166   2e-44   
ref|XP_006774390.1|  PREDICTED: 26S proteasome non-ATPase regulat...    167   2e-44   
ref|XP_001366018.1|  PREDICTED: 26S proteasome non-ATPase regulat...    167   2e-44   
ref|XP_010865170.1|  PREDICTED: 26S proteasome non-ATPase regulat...    166   2e-44   
dbj|BAE26453.1|  unnamed protein product                                166   2e-44   
dbj|BAC36709.1|  unnamed protein product                                166   2e-44   
ref|XP_008484303.1|  PREDICTED: probable 26S proteasome non-ATPas...    162   3e-44   
gb|KDR10975.1|  hypothetical protein L798_15053                         166   3e-44   
ref|XP_004340207.1|  proteasome (prosome, macropain) 26S subunit,...    166   3e-44   
ref|XP_006805354.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    166   4e-44   
ref|XP_784007.1|  PREDICTED: 26S proteasome non-ATPase regulatory...    165   4e-44   
ref|XP_009029400.1|  hypothetical protein HELRODRAFT_186129             165   4e-44   
dbj|BAM18273.1|  regulatory particle non-ATPase 3, Dox-A2               165   5e-44   
ref|XP_003333601.1|  hypothetical protein PGTG_15023                    165   6e-44   
gb|EMP33839.1|  26S proteasome non-ATPase regulatory subunit 3          168   6e-44   
ref|XP_001357240.1|  GA10344                                            164   6e-44   
ref|XP_006270859.1|  PREDICTED: uncharacterized protein LOC102565064    169   7e-44   
gb|EHJ74217.1|  putative 26S proteasome regulatory subunit S3           164   7e-44   
dbj|BAN21246.1|  26S proteasome regulatory subunit S3                   164   8e-44   
ref|XP_001415380.1|  predicted protein                                  163   8e-44   
ref|XP_006247334.1|  PREDICTED: 26S proteasome non-ATPase regulat...    165   9e-44   
ref|XP_002019057.1|  GL26159                                            164   9e-44   
ref|XP_004996585.1|  proteasome 26S non-ATPase subunit 3                164   1e-43   
ref|XP_001943276.1|  PREDICTED: probable 26S proteasome non-ATPas...    164   1e-43   
ref|XP_005107538.1|  PREDICTED: 26S proteasome non-ATPase regulat...    164   1e-43   
ref|XP_004521419.1|  PREDICTED: probable 26S proteasome non-ATPas...    164   1e-43   
emb|CEJ03868.1|  hypothetical protein RMCBS344292_17843                 163   2e-43   
ref|XP_006814940.1|  PREDICTED: 26S proteasome non-ATPase regulat...    164   2e-43   
ref|XP_008955033.1|  PREDICTED: 26S proteasome non-ATPase regulat...    164   2e-43   
emb|CEG71096.1|  hypothetical protein RMATCC62417_06881                 163   2e-43   
gb|EKC28832.1|  26S proteasome non-ATPase regulatory subunit 3          158   3e-43   
ref|NP_001133204.1|  proteasome (prosome, macropain) 26S subunit,...    162   4e-43   
ref|XP_009501498.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    161   5e-43   
gb|EPY87216.1|  26S proteasome non-ATPase regulatory subunit 3          165   5e-43   
ref|XP_003391976.1|  PREDICTED: probable 26S proteasome non-ATPas...    156   6e-43   
ref|XP_006386166.1|  hypothetical protein POPTR_0002s01940g             161   8e-43   
ref|XP_004859527.1|  PREDICTED: 26S proteasome non-ATPase regulat...    162   1e-42   
gb|EPZ36769.1|  PCI/PINT associated module domain-containing protein    157   1e-42   
ref|XP_010185775.1|  PREDICTED: 26S proteasome non-ATPase regulat...    160   2e-42   
ref|XP_009062478.1|  hypothetical protein LOTGIDRAFT_207043             160   3e-42   
ref|XP_002500951.1|  predicted protein                                  159   3e-42   
emb|CEF96488.1|  26S proteasome regulatory subunit, C-terminal          160   3e-42   
ref|XP_011419304.1|  PREDICTED: 26S proteasome non-ATPase regulat...    158   4e-42   
gb|ELU15663.1|  hypothetical protein CAPTEDRAFT_153237                  160   4e-42   
ref|XP_011419303.1|  PREDICTED: 26S proteasome non-ATPase regulat...    159   6e-42   
ref|XP_002733522.1|  PREDICTED: 26S proteasome non-ATPase regulat...    159   6e-42   
ref|XP_008922188.1|  PREDICTED: 26S proteasome non-ATPase regulat...    162   8e-42   
gb|KDN40963.1|  hypothetical protein K437DRAFT_275585                   159   8e-42   
ref|XP_006677247.1|  hypothetical protein BATDEDRAFT_23283              157   2e-41   
ref|XP_010745328.1|  PREDICTED: 26S proteasome non-ATPase regulat...    154   2e-41   
ref|XP_008870910.1|  hypothetical protein H310_07313                    157   2e-41   
ref|XP_009826168.1|  hypothetical protein H257_03673                    157   3e-41   
gb|EGV91314.1|  26S proteasome non-ATPase regulatory subunit 3          150   3e-41   
ref|XP_004347354.2|  proteasome 26S subunit                             158   3e-41   
gb|KFH67510.1|  26S proteasome regulatory subunit N3                    157   5e-41   
ref|XP_008603832.1|  hypothetical protein SDRG_00145                    156   5e-41   
gb|KDO29869.1|  hypothetical protein SPRG_04936                         156   5e-41   
ref|XP_003744755.1|  PREDICTED: 26S proteasome non-ATPase regulat...    156   7e-41   
ref|XP_003516118.2|  PREDICTED: 26S proteasome non-ATPase regulat...    150   9e-41   
ref|XP_005850128.1|  hypothetical protein CHLNCDRAFT_20545              155   1e-40   
ref|XP_003388163.1|  PREDICTED: probable 26S proteasome non-ATPas...    155   2e-40   
ref|XP_005649181.1|  26S proteasome regulatory subunit                  155   2e-40   
gb|KFM62491.1|  26S proteasome non-ATPase regulatory subunit 3          155   2e-40   
emb|CDI54071.1|  probable 26S proteasome non-ATPase regulatory su...    156   2e-40   
ref|XP_002164530.2|  PREDICTED: 26S proteasome non-ATPase regulat...    155   2e-40   
emb|CCA21665.1|  26S proteasome nonATPase regulatory subunit 3 putat    155   2e-40   
ref|XP_011034977.1|  PREDICTED: probable 26S proteasome non-ATPas...    153   3e-40   
ref|XP_006958332.1|  hypothetical protein WALSEDRAFT_51380              154   3e-40   
ref|XP_005710687.1|  unnamed protein product                            154   4e-40   
ref|XP_009268284.1|  putative 26S proteasome non-ATPase regulator...    154   4e-40   
ref|XP_009862513.1|  PREDICTED: 26S proteasome non-ATPase regulat...    153   4e-40   
emb|CCD58783.1|  26S proteasome regulatory subunit S3, putative         152   7e-40   
ref|XP_002110179.1|  hypothetical protein TRIADDRAFT_53909              153   7e-40   
emb|CCI47625.1|  unnamed protein product                                154   7e-40   
ref|XP_002130296.3|  PREDICTED: 26S proteasome non-ATPase regulat...    153   8e-40   
gb|EJU02426.1|  diphenol oxidase-A2                                     153   1e-39   
emb|CDS26049.1|  26S proteasome regulatory subunit S3                   153   1e-39   
gb|AAW25532.1|  SJCHGC06456 protein                                     152   1e-39   
gb|EEH03591.1|  26S proteasome non-ATPase regulatory subunit 3          153   2e-39   
ref|XP_004556593.1|  PREDICTED: 26S proteasome non-ATPase regulat...    152   2e-39   
gb|EGC47915.1|  26S proteasome non-ATPase regulatory subunit 3          153   2e-39   
emb|CBJ48748.1|  conserved unknown protein                              152   2e-39   
ref|XP_001544199.1|  hypothetical protein HCAG_01246                    153   3e-39   
ref|XP_002623301.1|  proteasome regulatory particle subunit             153   3e-39   
emb|CCD58782.1|  26S proteasome regulatory subunit S3, putative         152   3e-39   
ref|XP_505989.1|  YALI0F28413p                                          151   3e-39   
ref|XP_002541010.1|  26S proteasome non-ATPase regulatory subunit 3     152   3e-39   
dbj|BAG61884.1|  unnamed protein product                                149   3e-39   
ref|XP_010010626.1|  PREDICTED: 26S proteasome non-ATPase regulat...    149   3e-39   
gb|EER37477.1|  26S proteasome non-ATPase regulatory subunit 3          152   4e-39   
emb|CCX06310.1|  Similar to 26S proteasome non-ATPase regulatory ...    152   5e-39   
ref|XP_009533918.1|  hypothetical protein PHYSODRAFT_371796             149   5e-39   
ref|XP_008726963.1|  hypothetical protein G647_04397                    152   5e-39   
ref|XP_001731719.1|  hypothetical protein MGL_0987                      151   6e-39   
ref|XP_008900914.1|  hypothetical protein PPTG_08551                    151   6e-39   
ref|XP_001217445.1|  26S proteasome non-ATPase regulatory subunit 3     152   7e-39   
gb|EKC28831.1|  26S proteasome non-ATPase regulatory subunit 3          151   7e-39   
gb|ETK93153.1|  hypothetical protein L915_03600                         151   7e-39   
gb|ETI53309.1|  hypothetical protein F443_03708                         151   7e-39   
ref|XP_009034199.1|  hypothetical protein AURANDRAFT_70080              150   7e-39   
ref|XP_001246714.1|  hypothetical protein CIMG_00485                    151   8e-39   
ref|XP_002896901.1|  26S proteasome non-ATPase regulatory subunit 3     150   8e-39   
emb|CDS24591.1|  26S proteasome regulatory subunit S3                   150   9e-39   
gb|EFB23382.1|  hypothetical protein PANDA_019565                       149   1e-38   
ref|XP_009162946.1|  hypothetical protein T265_00810                    150   1e-38   
ref|XP_003066514.1|  26S proteasome regulatory subunit, putative        151   1e-38   
emb|CDI99509.1|  26S proteasome regulatory subunit S3                   150   1e-38   
gb|EUB56878.1|  26S proteasome non-ATPase regulatory subunit 3          150   1e-38   
ref|XP_004859528.1|  PREDICTED: 26S proteasome non-ATPase regulat...    150   1e-38   
gb|EPS26680.1|  hypothetical protein PDE_01618                          151   1e-38   
ref|XP_007881271.1|  hypothetical protein PFL1_05544                    150   1e-38   
ref|XP_005139508.1|  PREDICTED: 26S proteasome non-ATPase regulat...    149   1e-38   
ref|XP_009533913.1|  hypothetical protein PHYSODRAFT_361753             150   2e-38   
ref|XP_009808068.1|  PREDICTED: 26S proteasome non-ATPase regulat...    149   2e-38   
gb|KIW69090.1|  hypothetical protein PV04_04986                         150   2e-38   
dbj|GAA56602.1|  26S proteasome regulatory subunit N3                   150   2e-38   
gb|EPQ62972.1|  non-ATPase regulatory subunit of the 26S proteasome     150   2e-38   
dbj|BAE63324.1|  unnamed protein product                                149   3e-38   
ref|XP_001270630.1|  proteasome regulatory particle subunit (RpnC...    150   3e-38   
ref|XP_002384196.1|  proteasome regulatory particle subunit (RpnC...    149   4e-38   
ref|XP_001904761.1|  hypothetical protein                               149   4e-38   
emb|CDM32337.1|  Probable 26S proteasome regulatory subunit rpn3        149   5e-38   
emb|CBQ73651.1|  probable 26S proteasome non-ATPase regulatory su...    149   6e-38   
ref|XP_007003785.1|  hypothetical protein TREMEDRAFT_71399              148   6e-38   
ref|XP_003188828.1|  proteasome regulatory particle subunit (RpnC)      149   6e-38   
dbj|GAC75152.1|  26S proteasome regulatory complex, subunit RPN3/...    149   6e-38   
ref|XP_007293346.1|  proteasome regulatory particle subunit             149   7e-38   
dbj|GAA99198.1|  hypothetical protein E5Q_05890                         148   7e-38   
ref|XP_001263840.1|  proteasome regulatory particle subunit (RpnC...    149   7e-38   
ref|XP_011111683.1|  hypothetical protein H072_5877                     148   7e-38   



>ref|XP_011092961.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
 ref|XP_011092962.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
Length=488

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKF+STFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  323  GDLELFKTVAEKFASTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIVSKAIRDGAIDATLD TNG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  383  SANPVADAESIVSKAIRDGAIDATLDHTNGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_004153753.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like, partial [Cucumis sativus]
Length=170

 Score =   272 bits (696),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAE+FSSTFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLD
Sbjct  5    GDLELFKIVAERFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAQKLRLD  64

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANPIADAESIVSKAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLN 
Sbjct  65   SANPIADAESIVSKAIRDGAIDATVDHANGWMVSKETGDIYSTNEPQAAFNSRIAFCLNT  124

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  125  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  170



>ref|XP_002312950.2| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE86905.2| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=485

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKFSSTFSKDRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  320  GDLELFKSVAEKFSSTFSKDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  379

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDATLDR NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  380  SANPVADAESIVAKAIRDGAIDATLDRANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  439

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  440  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  485



>emb|CDP19574.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFSSTFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  322  GDLELFRTVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  382  SANPVADAESIVAKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKE AEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  442  HNEAVRALRFPPNSHKEKECAEKRRERQQQEQELAKHIAEEDDDEF  487



>ref|XP_008460112.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
Length=485

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFSSTFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  320  GDLELFRTVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  379

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIVSKAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  380  SANPVADAESIVSKAIRDGAIDATVDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  439

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  440  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  485



>ref|XP_011045871.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Populus euphratica]
Length=486

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKFSSTFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  321  GDLELFKSVAEKFSSTFSTDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  380

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDATLDR NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  381  SANPVADAESIVAKAIRDGAIDATLDRANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  440

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  441  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  486



>gb|KDO68111.1| hypothetical protein CISIN_1g011352mg [Citrus sinensis]
Length=453

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKFSSTFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  288  GDLELFKSVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  347

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIVSKAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  348  SANPVADAESIVSKAIRDGAIDATVDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  407

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  408  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  453



>sp|P93768.1|PSMD3_TOBAC RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 
21D7 [Nicotiana tabacum]
 dbj|BAA19252.1| 21D7 [Nicotiana tabacum]
Length=488

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR+VAEKFSSTFS D TNNLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  323  GDLELFRKVAEKFSSTFSSDGTNNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  383  SPNPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  488



>ref|XP_009628272.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana tomentosiformis]
Length=488

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR+VAEKFSSTFS D TNNLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  323  GDLELFRKVAEKFSSTFSSDGTNNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  383  SPNPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  488



>ref|XP_006422568.1| hypothetical protein CICLE_v10028313mg [Citrus clementina]
 ref|XP_006486715.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Citrus sinensis]
 gb|ESR35808.1| hypothetical protein CICLE_v10028313mg [Citrus clementina]
 gb|KDO68110.1| hypothetical protein CISIN_1g011352mg [Citrus sinensis]
Length=488

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKFSSTFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  323  GDLELFKSVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIVSKAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  383  SANPVADAESIVSKAIRDGAIDATVDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_009773689.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Nicotiana sylvestris]
Length=488

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR+VAEKFSSTFS D TNNLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  323  GDLELFRKVAEKFSSTFSSDGTNNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  383  SPNPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  488



>emb|CDO98056.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFSSTFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  322  GDLELFRTVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  382  SANPVADAESIVAKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALR+PPNS+KEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  442  HNEAVRALRYPPNSNKEKESAEKRRERQQQEQELAKHIAEEDDDEF  487



>ref|XP_009623855.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana tomentosiformis]
Length=491

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR+VA+KFSSTFS D TNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  326  GDLELFRKVADKFSSTFSSDGTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  386  SPNPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHK KESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  446  HNEAVRALRFPPNSHKGKESAEKRRERQQQEQELAKHIAEEDDDDF  491



>ref|XP_011088624.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
Length=488

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKF++TFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  323  GDLELFKAVAEKFATTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  383  SANPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEE++D+F
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEEEDEF  488



>ref|XP_004231054.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Solanum lycopersicum]
Length=487

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKFSSTF  DRTNNLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  322  GDLELFKNVAEKFSSTFGSDRTNNLIVRLRHNVIRTGLRNISISYSRISLTDVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  382  SPNPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELA+HIAEEDDDDF
Sbjct  442  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAQHIAEEDDDDF  487



>dbj|BAG94867.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95111.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  227  GDLELFRAVAEKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  286

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  287  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  346

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  347  HNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  392



>tpg|DAA48734.1| TPA: hypothetical protein ZEAMMB73_878535 [Zea mays]
Length=298

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  133  GDLELFRTVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  192

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  193  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  252

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEE+DDDF
Sbjct  253  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEEDDDF  298



>ref|XP_002521275.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
 gb|EEF41131.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
Length=491

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKFS+ FS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  326  GDLELFKSVAEKFSTIFSADRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  386  SANPVADAESIVAKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  446  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  491



>ref|XP_004167007.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3a-like, partial [Cucumis sativus]
Length=287

 Score =   268 bits (686),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFSSTFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  122  GDLELFRTVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  181

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S N IADAESIVSKA RDGAIDAT+D  N  MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  182  SENLIADAESIVSKATRDGAIDATVDHGNRWMVSKETGDIYSTNEPQFAFNSRIAFCLNM  241

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  242  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  287



>gb|EEC83998.1| hypothetical protein OsI_30168 [Oryza sativa Indica Group]
Length=339

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  174  GDLELFRAVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  233

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  234  SDNPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  293

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  294  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  339



>ref|XP_008447941.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
 ref|XP_008447942.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
Length=481

 Score =   274 bits (701),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFSSTFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  316  GDLELFRTVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  375

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NPIADAESIVSKA RDGAIDAT+D  N  MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  376  SENPIADAESIVSKATRDGAIDATVDHGNKWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  435

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  436  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  481



>gb|AFK34954.1| unknown [Lotus japonicus]
Length=187

 Score =   264 bits (675),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KF++TF+ D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL+
Sbjct  22   GDLELFRNIADKFATTFNADGTHNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLN  81

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA+P+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  82   SASPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  141

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  142  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  187



>ref|XP_002279715.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
 ref|XP_010646732.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
Length=487

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKFS+TFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLD
Sbjct  322  GDLELFKSVAEKFSTTFSSDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAQKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANPIADAESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  SANPIADAESIVAKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQFAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN+AVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  442  HNDAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  487



>ref|XP_002306189.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE86700.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=488

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ +AEKFSSTF+ DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  323  GDLELFKSIAEKFSSTFNADRTLNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+A+AESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  383  SANPVAEAESIVAKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_009799469.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana sylvestris]
Length=491

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR+VA+KFSSTFS D TNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  326  GDLELFRKVADKFSSTFSSDGTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  386  SPNPFADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV ALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  446  HNEAVCALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  491



>gb|EAZ09931.1| hypothetical protein OsI_32229 [Oryza sativa Indica Group]
Length=487

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  322  GDLELFRAVAEKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  382  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  442  HNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  487



>ref|NP_001063817.1| Os09g0541900 [Oryza sativa Japonica Group]
 dbj|BAB82474.1| 21D7 [Oryza sativa Japonica Group]
 dbj|BAC79193.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Oryza 
sativa Japonica Group]
 dbj|BAD46593.1| putative nuclear antigen 21D7 [Oryza sativa Japonica Group]
 dbj|BAF25731.1| Os09g0541900 [Oryza sativa Japonica Group]
 gb|EAZ45527.1| hypothetical protein OsJ_30188 [Oryza sativa Japonica Group]
Length=487

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  322  GDLELFRAVAEKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  382  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  442  HNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  487



>ref|XP_010920092.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=488

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFS TF+ DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLD
Sbjct  323  GDLELFRTVAEKFSGTFNSDRTRNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D +NG MVSKETGDIYSTNEPQIAFNSRI FCLNM
Sbjct  383  SQNPVADAESIVAKAIRDGAIDATIDHSNGWMVSKETGDIYSTNEPQIAFNSRIVFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEK RERQQQEQELAKHIAEEDDD+F
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKMRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_004145004.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
 ref|XP_004160668.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
 gb|KGN46247.1| hypothetical protein Csa_6G077440 [Cucumis sativus]
Length=485

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAE+FSSTFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLD
Sbjct  320  GDLELFKIVAERFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAQKLRLD  379

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANPIADAESIVSKAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLN 
Sbjct  380  SANPIADAESIVSKAIRDGAIDATVDHANGWMVSKETGDIYSTNEPQAAFNSRIAFCLNT  439

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  440  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  485



>ref|XP_011046661.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Populus euphratica]
Length=488

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKFSSTF+ DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  323  GDLELFKSVAEKFSSTFNADRTLNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+A+AESIV+KAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  383  SANPVAEAESIVAKAIRDGAIDATVDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_010266036.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
Length=488

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+ TFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  322  GDLELFRTVAEKFTDTFSSDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  STNPVADAESIVSKAIRDGAIDATVDHANGCMVSKETGDIYSTNEPQFAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekr-rerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHK+++ + ++ RERQQQEQELAKHIAEEDDD+F
Sbjct  442  HNEAVRALRFPPNSHKKEKESAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_010933362.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=488

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFS TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLD
Sbjct  323  GDLELFRTVAEKFSGTFNSDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGA+DA +D  NGCMVSKETGD+YSTNEPQIAFNSRI FCLNM
Sbjct  383  SQNPVADAESIVAKAIRDGAVDAMIDHANGCMVSKETGDVYSTNEPQIAFNSRIVFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_006660915.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Oryza brachyantha]
Length=392

 Score =   269 bits (688),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  227  GDLELFRAVAEKFVSTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  286

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG M SKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  287  SDNPVADAESIVAKAIRDGAIDATIDHANGWMASKETGDVYSTNEPQIAFNSRIAFCLNM  346

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  347  HNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  392



>ref|XP_004500920.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cicer arietinum]
Length=488

 Score =   272 bits (695),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KF++TFS D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  323  GDLELFRNIADKFATTFSADGTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NPIADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  383  SPNPIADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  443  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  488



>ref|XP_007136115.1| hypothetical protein PHAVU_009G019100g [Phaseolus vulgaris]
 gb|ESW08109.1| hypothetical protein PHAVU_009G019100g [Phaseolus vulgaris]
Length=487

 Score =   272 bits (695),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KF++TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+
Sbjct  322  GDLELFRNIADKFATTFNADRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S+NPIADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  382  SSNPIADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  487



>ref|XP_004957510.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Setaria italica]
Length=489

 Score =   272 bits (695),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KFSSTFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  324  GDLELFRSVADKFSSTFSADRTCNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  383

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  384  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  443

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  444  HNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  489



>gb|KEH36262.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=423

 Score =   270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KF++TFS D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  258  GDLELFRNIADKFATTFSADGTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  317

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  318  SPNPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  377

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  378  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  423



>ref|XP_010063310.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Eucalyptus grandis]
 gb|KCW70517.1| hypothetical protein EUGRSUZ_F03722 [Eucalyptus grandis]
Length=487

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF++TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  322  GDLELFRTVAEKFATTFNTDRTHNLIVRLRHNVIRTGLRNISISYSRISLEDVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDATLD  N CMVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  382  SPNPVADAESIVSKAIRDGAIDATLDHANRCMVSKETGDIYSTNEPQMAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEE+DDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEEDDDF  487



>gb|KDP29682.1| hypothetical protein JCGZ_18844 [Jatropha curcas]
Length=487

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKFS+TFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  322  GDLELFKSVAEKFSTTFSSDRTYNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S+NP+ADAESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQI FNSRIAFCLNM
Sbjct  382  SSNPVADAESIVAKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIEFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRAL FPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  442  HNEAVRALMFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  487



>gb|EYU37968.1| hypothetical protein MIMGU_mgv1a005284mg [Erythranthe guttata]
 gb|EYU37969.1| hypothetical protein MIMGU_mgv1a005284mg [Erythranthe guttata]
Length=490

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKF+STFS D T NLIVRLRHNVIRTGLRNISI+YS+ISL DVAKKLRLD
Sbjct  325  GDLELFKSVAEKFASTFSSDGTKNLIVRLRHNVIRTGLRNISISYSKISLVDVAKKLRLD  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NPIADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  385  SPNPIADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  444

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  445  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  490



>ref|XP_006416422.1| hypothetical protein EUTSA_v10007479mg [Eutrema salsugineum]
 gb|ESQ34775.1| hypothetical protein EUTSA_v10007479mg [Eutrema salsugineum]
Length=488

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKFS TFS+DRT+NLIVRLRHNVIRTGLRNISI+YSRISL+DVA+KLRL+
Sbjct  323  GDLELFRTVQEKFSDTFSQDRTHNLIVRLRHNVIRTGLRNISISYSRISLSDVAQKLRLN  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  443  HNEAVRALRFPPNTHKEKESDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_004974153.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Setaria italica]
Length=491

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  326  GDLELFRAVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  386  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  446  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  491



>ref|XP_003527532.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
Length=487

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KF++TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+
Sbjct  322  GDLELFRNIADKFATTFNADRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA+P+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  382  SASPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  487



>ref|XP_003603813.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
 gb|AES74064.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=490

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KF++TFS D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  325  GDLELFRNIADKFATTFSADGTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  385  SPNPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  444

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  445  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  490



>dbj|BAG87837.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  227  GDLELFRAVADKFVSTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  286

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  287  SDNPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  346

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  347  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  392



>ref|XP_002444618.1| hypothetical protein SORBIDRAFT_07g024800 [Sorghum bicolor]
 gb|EES14113.1| hypothetical protein SORBIDRAFT_07g024800 [Sorghum bicolor]
Length=496

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  331  GDLELFRAVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NPIADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  391  SENPIADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  450

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  451  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  496



>ref|XP_003523322.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
Length=487

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KF++TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+
Sbjct  322  GDLELFRNIADKFATTFNADRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  SANPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQSAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  487



>gb|KEH36263.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=453

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KF++TFS D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  288  GDLELFRNIADKFATTFSADGTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  347

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  348  SPNPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  407

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  408  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  453



>ref|XP_010229049.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Brachypodium distachyon]
Length=490

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  325  GDLELFRTVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAE IVSKAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQ+AFNSRIAFCLNM
Sbjct  385  SQNPVADAECIVSKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQVAFNSRIAFCLNM  444

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  445  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  490



>dbj|BAB78499.1| 26S proteasome regulatory particle non-ATPase subunit3 [Oryza 
sativa Japonica Group]
Length=419

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  254  GDLELFRAVADKFVSTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  313

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  314  SDNPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  373

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  374  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  419



>ref|XP_010107643.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Morus 
notabilis]
 gb|EXC16554.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Morus 
notabilis]
Length=487

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFS+TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  322  GDLELFRSVAEKFSNTFNSDRTHNLIVRLRHNVIRTGLRNISISYSRISLIDVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ AF++RIAFCLN+
Sbjct  382  SANPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQTAFDTRIAFCLNL  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  442  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  487



>ref|NP_001149380.1| LOC100283005 [Zea mays]
 gb|ACG35233.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score =   270 bits (689),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  327  GDLELFRTVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  386

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  387  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  446

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEE+DDDF
Sbjct  447  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEEDDDF  492



>ref|XP_006660365.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Oryza brachyantha]
Length=486

 Score =   269 bits (688),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  321  GDLELFRAVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  380

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  381  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  440

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEED+DDF
Sbjct  441  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDEDDF  486



>gb|EEE69116.1| hypothetical protein OsJ_28197 [Oryza sativa Japonica Group]
Length=467

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  302  GDLELFRAVADKFVSTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  361

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  362  SDNPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  421

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  422  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  467



>gb|ACF84535.1| unknown [Zea mays]
 gb|ACN28040.1| unknown [Zea mays]
 tpg|DAA48733.1| TPA: 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score =   269 bits (688),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  327  GDLELFRTVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  386

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  387  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  446

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEE+DDDF
Sbjct  447  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEEDDDF  492



>gb|ACN28097.1| unknown [Zea mays]
 gb|AFW65684.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=491

 Score =   269 bits (688),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  326  GDLELFRAVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NPIADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  386  SENPIADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AE+DDDDF
Sbjct  446  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEDDDDDF  491



>gb|ACG34075.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  327  GDLELFRTVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  386

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  387  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  446

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEE+DDDF
Sbjct  447  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEEDDDF  492



>ref|XP_004144854.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
 gb|KGN43263.1| hypothetical protein Csa_7G014490 [Cucumis sativus]
Length=481

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFSSTFS DRTNNLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  316  GDLELFRTVAEKFSSTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  375

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S N IADAESIVSKA RDGAIDAT+D  N  MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  376  SENLIADAESIVSKATRDGAIDATVDHGNRWMVSKETGDIYSTNEPQFAFNSRIAFCLNM  435

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAE RRERQQQEQELAKHIAEEDDDDF
Sbjct  436  HNEAVRALRFPPNSHKEKESAETRRERQQQEQELAKHIAEEDDDDF  481



>ref|XP_010266868.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
 ref|XP_010266869.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
Length=488

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 159/167 (95%), Gaps = 1/167 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF++TFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  322  GDLELFRTVAEKFANTFSTDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            +ANP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+Y+TNEPQ+AFNSRIAFCLNM
Sbjct  382  TANPVADAESIVAKAIRDGAIDATVDHANGWMVSKETGDVYATNEPQLAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekr-rerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHK+++ + ++ RERQQQEQELAKHIAEEDDDDF
Sbjct  442  HNEAVRALRFPPNSHKKEKESAEKRRERQQQEQELAKHIAEEDDDDF  488



>gb|KHN09062.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=487

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KF++TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+
Sbjct  322  GDLELFRNIADKFATTFNADRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA+P+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  SASPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQSAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  487



>ref|NP_001149170.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
 gb|ACG34451.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=491

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  326  GDLELFRAVADKFASTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NPIADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  386  SENPIADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AE+DDDDF
Sbjct  446  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEDDDDDF  491



>ref|XP_007017882.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOY15107.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
Length=487

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+STFS D+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL+
Sbjct  322  GDLELFRTVAEKFASTFSTDKTHNLIVRLRHNVIRTGLRNISISYSRISLADVAEKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S  P+ADAESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAF+SRIAFCLNM
Sbjct  382  SKTPVADAESIVAKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFHSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  487



>gb|EYU22574.1| hypothetical protein MIMGU_mgv1a005362mg [Erythranthe guttata]
Length=487

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKF++TFS D T NLIVRLRHNVIRTGLRNISI+YS+ISL DVAKKLRLD
Sbjct  322  GDLELFKSVAEKFATTFSSDGTKNLIVRLRHNVIRTGLRNISISYSKISLVDVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NPIADAESIVSKAIRDGAIDATLD  NG M+SKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  382  SPNPIADAESIVSKAIRDGAIDATLDHGNGWMLSKETGDIYSTNEPQIAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQ QEQELAKHIAEEDDD+F
Sbjct  442  HNEAVRALRFPPNSHKEKESAEKRRERQLQEQELAKHIAEEDDDEF  487



>ref|NP_001062444.1| Os08g0550100 [Oryza sativa Japonica Group]
 dbj|BAD08959.1| putative 21D7 [Oryza sativa Japonica Group]
 dbj|BAF24358.1| Os08g0550100 [Oryza sativa Japonica Group]
Length=486

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF STFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  321  GDLELFRAVADKFVSTFSADRTRNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  380

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  381  SDNPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  440

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  441  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  486



>gb|KHN45952.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=487

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KF++TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+
Sbjct  322  GDLELFRNIADKFATTFNADRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA+P+ADAESIVSKAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  SASPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQSAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  487



>gb|KFK42036.1| hypothetical protein AALP_AA2G203500 [Arabis alpina]
Length=488

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V E+F+ TFS+DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+
Sbjct  323  GDLELFRNVQERFAKTFSEDRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLN  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  383  SANPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  443  HNEAVRALRFPPNTHKEKESDEKRREKKQQEEELAKYMAEEDDDDF  488



>dbj|BAK06811.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  227  GDLELFRAVADKFASTFSADRTHNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  286

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            + NP+ADAE IV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQ AFNSRIAFCLNM
Sbjct  287  TGNPVADAECIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQAAFNSRIAFCLNM  346

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  347  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  392



>ref|XP_002510590.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
 gb|EEF52777.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
Length=491

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+ TF+ DRT+NLIVRLRHNVIRTGLRNISI+YS ISLADVAKKLRLD
Sbjct  326  GDLELFRTVAEKFAETFNTDRTHNLIVRLRHNVIRTGLRNISISYSCISLADVAKKLRLD  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA+P+ADAESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAFNSRIAFCLNM
Sbjct  386  SASPVADAESIVAKAIRDGAIDATLDHVNGWMVSKETGDIYSTNEPQIAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKESAEKRRERQQQEQELAKHIAEE+DDDF
Sbjct  446  HNEAVRALRFPPNTHKEKESAEKRRERQQQEQELAKHIAEEEDDDF  491



>ref|NP_173447.1| probable 26S proteasome non-ATPase regulatory subunit 3a [Arabidopsis 
thaliana]
 sp|Q9LNU4.3|PSD3A_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 3 
homolog A; AltName: Full=26S proteasome regulatory subunit RPN3a; 
Short=AtRPN3a; AltName: Full=26S proteasome regulatory 
subunit S3 homolog A; AltName: Full=Protein EMBRYO DEFECTIVE 
2719; AltName: Full=Protein HAPLESS 15 [Arabidopsis thaliana]
 gb|AAP86658.1| 26S proteasome subunit RPN3a [Arabidopsis thaliana]
 gb|AEE29950.1| probable 26S proteasome non-ATPase regulatory subunit 3a [Arabidopsis 
thaliana]
Length=488

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKF  TF++DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+
Sbjct  323  GDLELFRTVQEKFLDTFAQDRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLN  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  443  HNEAVRALRFPPNTHKEKESDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_010459703.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Camelina sativa]
Length=488

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKF  TF++DRT+NLIVRLRHNVIRTGLRNISIAYSRISL DVAKKLRL+
Sbjct  323  GDLELFRTVQEKFLDTFAQDRTHNLIVRLRHNVIRTGLRNISIAYSRISLPDVAKKLRLN  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NGCM+SKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAIDATIDHKNGCMISKETGDIYSTNEPQTAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEA+RALRFPPN+HKEKES EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  443  HNEAIRALRFPPNTHKEKESDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_010666922.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKFSSTF KDRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  322  GDLELFRGVTEKFSSTFDKDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDATLD  NG M+SKETGDIYST EPQ AF+SRIAFCLNM
Sbjct  382  SPNPVADAESIVAKAIRDGAIDATLDHANGWMLSKETGDIYSTTEPQSAFDSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALR+PPNSHKEKESAEKRRERQQQEQELAKHIAEE+DDDF
Sbjct  442  HNEAVRALRYPPNSHKEKESAEKRRERQQQEQELAKHIAEEEDDDF  487



>gb|AAM53298.1| putative proteasome regulatory subunit S3 [Arabidopsis thaliana]
Length=488

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKF  TF++DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+
Sbjct  323  GDLELFRTVQEKFLDTFAQDRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLN  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  443  HNEAVRALRFPPNTHKEKESDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_010935159.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=493

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+ TFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLD
Sbjct  328  GDLELFRTVAEKFAGTFSSDRTRNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLD  387

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG M+SKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  388  SDNPVADAESIVAKAIRDGAIDATIDHANGWMLSKETGDVYSTNEPQIAFNSRIAFCLNM  447

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRAL+FPPNSH+EKES EKRRERQQQEQELAKHIAEEDDD+F
Sbjct  448  HNEAVRALKFPPNSHREKESEEKRRERQQQEQELAKHIAEEDDDEF  493



>ref|XP_007041788.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 ref|XP_007041789.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOX97619.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOX97620.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
Length=484

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 158/166 (95%), Gaps = 3/166 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFSSTFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  322  GDLELFRTVAEKFSSTFSSDRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S   +ADAESIV+KAIRDGAIDATLD  NGCM+SKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  382  S---VADAESIVAKAIRDGAIDATLDHANGCMLSKETGDIYSTNEPQMAFNSRIAFCLNM  438

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  439  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  484



>ref|XP_003545019.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
 gb|KHN39404.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=490

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF +TF++DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+
Sbjct  325  GDLELFRNVAEKFGTTFNRDRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLN  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA+P+ADAESIV+KAIRDGAIDA+LD  NG MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  385  SASPVADAESIVAKAIRDGAIDASLDHANGWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  444

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+ KEKESAEKRRER QQEQELAKHIAEEDDDDF
Sbjct  445  HNEAVRALRFPPNTQKEKESAEKRRERHQQEQELAKHIAEEDDDDF  490



>ref|XP_002889051.1| hypothetical protein ARALYDRAFT_476749 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65310.1| hypothetical protein ARALYDRAFT_476749 [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   267 bits (682),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF  V EKF+ TF+KDRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+
Sbjct  322  GDLELFGNVQEKFAETFAKDRTHNLIVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  SANPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESDEKRREKKQQEEELAKYMAEEDDDDF  487



>ref|XP_009401896.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
Length=487

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VA+KFS TFS DRT+NLIVRLRHNVIRTGLRNISIAYSRISLADVA+KLRLD
Sbjct  322  GDLELFKIVADKFSGTFSSDRTHNLIVRLRHNVIRTGLRNISIAYSRISLADVARKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D +NG +VSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  382  SPNPVADAESIVAKAIRDGAIDATIDHSNGWVVSKETGDVYSTNEPQIAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNS+KEKES E RRERQQQEQELAKHIAEEDDDDF
Sbjct  442  HNEAVRALRFPPNSNKEKESEETRRERQQQEQELAKHIAEEDDDDF  487



>dbj|BAK01467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  324  GDLELFRAVADKFASTFSADRTHNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  383

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            + NP+ADAE IV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQ AFNSRIAFCLNM
Sbjct  384  TGNPVADAECIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQAAFNSRIAFCLNM  443

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  444  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  489



>ref|XP_008809439.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=488

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KFS TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLD
Sbjct  323  GDLELFRTVADKFSGTFNSDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGA+DA +D  NG MVSKETGD+YSTNEPQIAFNSRI FCLNM
Sbjct  383  SQNPVADAESIVAKAIRDGAVDAIIDHANGWMVSKETGDVYSTNEPQIAFNSRIVFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  443  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  488



>gb|AAF79894.1|AC022472_3 Contains similarity to 26s proteasome regulatory subunit S3 from 
Nicotiana tabacum gi|3914467 and contains a PCI PF|01399 
domain. ESTs gb|AV527569, gb|T75824, gb|T88578, gb|F15139, 
gb|AV520993, gb|AV440056, gb|AI099602, gb|F15138 come from this 
gene [Arabidopsis thaliana]
Length=519

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKF  TF++DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+
Sbjct  354  GDLELFRTVQEKFLDTFAQDRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLN  413

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  414  SENPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNM  473

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  474  HNEAVRALRFPPNTHKEKESDEKRRERKQQEEELAKHMAEEDDDDF  519



>gb|KJB15844.1| hypothetical protein B456_002G199200 [Gossypium raimondii]
Length=430

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 158/166 (95%), Gaps = 3/166 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFS+TFS DRT+NLIVRLRHNVIRTGLRNISI+YSRI+LADVAKKLRLD
Sbjct  268  GDLELFRSVAEKFSTTFSSDRTHNLIVRLRHNVIRTGLRNISISYSRIALADVAKKLRLD  327

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S   +ADAESIV+KAIRDGAIDATLD +NGCM+SKETGDIYST EPQ AFNSRIAFCLNM
Sbjct  328  S---VADAESIVAKAIRDGAIDATLDHSNGCMLSKETGDIYSTTEPQTAFNSRIAFCLNM  384

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  385  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  430



>ref|XP_007200984.1| hypothetical protein PRUPE_ppa004807mg [Prunus persica]
 gb|EMJ02183.1| hypothetical protein PRUPE_ppa004807mg [Prunus persica]
Length=490

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +AEKFS+ FS DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  325  GDLELFRNIAEKFSNIFSSDRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDATLD TNG MVSKETGDIYSTNEPQ AF++RIAFCLN+
Sbjct  385  SPNPVADAESIVAKAIRDGAIDATLDHTNGWMVSKETGDIYSTNEPQAAFDTRIAFCLNL  444

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN+AVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  445  HNDAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  490



>emb|CDX87648.1| BnaA07g32250D [Brassica napus]
Length=482

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKFS TFS+DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+
Sbjct  317  GDLELFRNVQEKFSKTFSEDRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLN  376

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  377  SANPVADAESIVAKAIRDGAIDATIDHKNGYMVSKETGDIYSTNEPQNAFNSRIAFCLNM  436

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+H+EKES EKRRE +QQE+ELAK++AEEDDDDF
Sbjct  437  HNEAVRALRFPPNTHREKESEEKRREMKQQEEELAKYMAEEDDDDF  482



>ref|XP_010536429.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Tarenaya hassleriana]
Length=487

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V E+F+ TF+KDRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+
Sbjct  322  GDLELFRTVQERFTETFAKDRTHNLIVRLRHNVIRTGLRNISISYSRISLEDVAKKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  N  MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  382  SANPVADAESIVAKAIRDGAIDATIDHKNNWMVSKETGDIYSTNEPQMAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRER+QQE+ELAKH+AE+DDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESDEKRRERKQQEEELAKHMAEDDDDDF  487



>ref|NP_177726.1| probable 26S proteasome non-ATPase regulatory subunit 3b [Arabidopsis 
thaliana]
 sp|Q9LQR8.2|PSD3B_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 3 
homolog B; AltName: Full=26S proteasome regulatory subunit RPN3b; 
Short=AtRPN3b; AltName: Full=26S proteasome regulatory 
subunit S3 homolog B [Arabidopsis thaliana]
 gb|AAL09749.1| At1g75990/T4O12_21 [Arabidopsis thaliana]
 gb|AAU90061.1| At1g75990 [Arabidopsis thaliana]
 gb|AEE35783.1| probable 26S proteasome non-ATPase regulatory subunit 3b [Arabidopsis 
thaliana]
Length=487

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF ++ EKF+ TF++DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+
Sbjct  322  GDLELFGKIQEKFAKTFAEDRTHNLIVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  SANPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+H+EKES EKRRE +QQE+ELAK++AEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHREKESEEKRREMKQQEEELAKYMAEEDDDDF  487



>ref|XP_009106250.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B [Brassica rapa]
Length=491

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKFS TFS+DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+
Sbjct  326  GDLELFRNVQEKFSKTFSEDRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLN  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  386  SANPVADAESIVAKAIRDGAIDATIDHKNGYMVSKETGDIYSTNEPQNAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+H+EKES EKRRE +QQE+ELAK++AEEDDDDF
Sbjct  446  HNEAVRALRFPPNTHREKESEEKRREMKQQEEELAKYMAEEDDDDF  491



>ref|XP_008811676.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=495

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+ TFS DRTNNLIVRLRHNVIRTGLRNISI+YSR+SL+D+A+KLRLD
Sbjct  330  GDLELFRTVAEKFAGTFSSDRTNNLIVRLRHNVIRTGLRNISISYSRVSLSDIARKLRLD  389

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  390  SDNPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  449

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN+AVRALRFPPNSHKEKESAEKRRERQQQEQELAKHI E+DDD+F
Sbjct  450  HNDAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIEEDDDDEF  495



>sp|Q06364.2|PSMD3_DAUCA RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 
21D7 [Daucus carota]
Length=489

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRLD
Sbjct  324  GDLELFRXVADKFASTFTADRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVARKLRLD  383

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIVSKAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  384  SPNPVADAESIVSKAIRDGAIDATIDHANGWMVSKETGDIYSTNEPQAAFNSRIAFCLNM  443

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFP NSHK+KESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  444  HNEAVRALRFPANSHKDKESAEKRRERQQQEQELAKHIAEEDDDEF  489



>gb|KJB15843.1| hypothetical protein B456_002G199200 [Gossypium raimondii]
Length=484

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 158/166 (95%), Gaps = 3/166 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFS+TFS DRT+NLIVRLRHNVIRTGLRNISI+YSRI+LADVAKKLRLD
Sbjct  322  GDLELFRSVAEKFSTTFSSDRTHNLIVRLRHNVIRTGLRNISISYSRIALADVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S   +ADAESIV+KAIRDGAIDATLD +NGCM+SKETGDIYST EPQ AFNSRIAFCLNM
Sbjct  382  S---VADAESIVAKAIRDGAIDATLDHSNGCMLSKETGDIYSTTEPQTAFNSRIAFCLNM  438

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  439  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  484



>ref|XP_010498455.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A-like [Camelina sativa]
Length=488

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKF  TF++DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+
Sbjct  323  GDLELFRTVQEKFLDTFAQDRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLN  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDA +D  NGCM+SKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAIDAIIDHKNGCMISKETGDIYSTNEPQTAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  443  HNEAVRALRFPPNTHKEKESDEKRRERKQQEEELAKHMAEEDDDDF  488



>gb|EMT33081.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Aegilops 
tauschii]
Length=496

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  331  GDLELFRAVADKFASTFSADRTHNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            + NP+ADAE IV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQ AFNSRIAFCLNM
Sbjct  391  TENPVADAECIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQAAFNSRIAFCLNM  450

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  451  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  496



>ref|XP_003578544.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Brachypodium distachyon]
Length=497

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+STFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISL D+AKKLRLD
Sbjct  332  GDLELFRAVAEKFASTFSADRTSNLIVRLRHNVIRTGLRNISISYSRISLVDIAKKLRLD  391

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGA+DA +D  NG +VSKETGD+YSTNEPQ AFNSRIAFCLNM
Sbjct  392  SENPVADAESIVAKAIRDGAVDAIIDHANGWVVSKETGDVYSTNEPQAAFNSRIAFCLNM  451

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  452  HNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  497



>ref|XP_006307354.1| hypothetical protein CARUB_v10008972mg [Capsella rubella]
 gb|EOA40252.1| hypothetical protein CARUB_v10008972mg [Capsella rubella]
Length=488

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKF  TFS+DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+
Sbjct  323  GDLELFRTVQEKFLDTFSQDRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLN  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAIDATIDHKNGWMVSKETGDIYSTNEPQTAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  443  HNEAVRALRFPPNTHKEKESDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_010477252.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Camelina sativa]
Length=488

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKF  TF++DRT+NLIVRLRHNVIRTGLRNISIAYSRISL DVAKKLRL+
Sbjct  323  GDLELFRTVQEKFLDTFAQDRTHNLIVRLRHNVIRTGLRNISIAYSRISLPDVAKKLRLN  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG M+SKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAIDATIDHKNGWMISKETGDIYSTNEPQTAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRER+QQE+ELAKH+AEEDDDDF
Sbjct  443  HNEAVRALRFPPNTHKEKESDEKRRERKQQEEELAKHMAEEDDDDF  488



>ref|XP_006390248.1| hypothetical protein EUTSA_v10018459mg [Eutrema salsugineum]
 dbj|BAJ34390.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27534.1| hypothetical protein EUTSA_v10018459mg [Eutrema salsugineum]
Length=488

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V E+F+ TFS+DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+
Sbjct  323  GDLELFRNVQERFAKTFSEDRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLN  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  N CMVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAIDATIDHKNSCMVSKETGDIYSTNEPQTAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+H+EKES EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  443  HNEAVRALRFPPNTHREKESDEKRREKKQQEEELAKYMAEEDDDDF  488



>gb|AAF26768.2|AC007396_17 T4O12.21 [Arabidopsis thaliana]
Length=532

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF ++ EKF+ TF++DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+
Sbjct  367  GDLELFGKIQEKFAKTFAEDRTHNLIVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLN  426

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  NGCMVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  427  SANPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGDIYSTNEPQTAFNSRIAFCLNM  486

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+H+EKES EKRRE +QQE+ELAK++AEEDDDDF
Sbjct  487  HNEAVRALRFPPNTHREKESEEKRREMKQQEEELAKYMAEEDDDDF  532



>emb|CDX73215.1| BnaC06g36630D [Brassica napus]
Length=491

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKF+ TFS+DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+
Sbjct  326  GDLELFRNVQEKFAKTFSEDRTHNLIVRLRHNVIRTGLRNISISYSRISLTDVAQKLRLN  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  386  SANPVADAESIVAKAIRDGAIDATIDHKNGYMVSKETGDIYSTNEPQNAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+H+EKES EKRRE +QQE+ELAK++AEEDDDDF
Sbjct  446  HNEAVRALRFPPNTHREKESEEKRREMKQQEEELAKYMAEEDDDDF  491



>gb|KHG18147.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Gossypium 
arboreum]
Length=484

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 157/166 (95%), Gaps = 3/166 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFS+TFS DRT+NLIVRLRHNVIRTGLRNISI+YSRI+LADV KKLRLD
Sbjct  322  GDLELFRSVAEKFSTTFSSDRTHNLIVRLRHNVIRTGLRNISISYSRIALADVGKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S   +ADAESIV+KAIRDGAIDATLD +NGCM+SKETGDIYST EPQ AFNSRIAFCLNM
Sbjct  382  S---VADAESIVAKAIRDGAIDATLDHSNGCMLSKETGDIYSTTEPQTAFNSRIAFCLNM  438

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  439  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  484



>ref|XP_008236045.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Prunus mume]
Length=490

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +AEKF++ F+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  325  GDLELFRNIAEKFANIFNSDRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDATLD TNG MVSKETGDIYSTNEPQ AF++RIAFCLN+
Sbjct  385  SPNPVADAESIVAKAIRDGAIDATLDHTNGWMVSKETGDIYSTNEPQAAFDTRIAFCLNL  444

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN+AVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  445  HNDAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  490



>gb|AAP80660.1|AF479041_1 regulatory particle mon-ATPase subunit 3, partial [Triticum aestivum]
Length=159

 Score =   251 bits (640),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  661  VAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADA  482
            VA+KF+STFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD+ NP+ADA
Sbjct  2    VADKFASTFSADRTHNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLDTENPVADA  61

Query  481  ESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRAL  302
            E IV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQ AFNSRIAFCLNMHNEAV+A+
Sbjct  62   ECIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQAAFNSRIAFCLNMHNEAVKAM  121

Query  301  RFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  122  RFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  159



>ref|XP_002893093.1| EMB2719 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69352.1| EMB2719 [Arabidopsis lyrata subsp. lyrata]
Length=488

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR V EKF  TFS+DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRL+
Sbjct  323  GDLELFRTVQEKFLDTFSQDRTHNLIVRLRHNVIRTGLRNISISYSRISLPDVAKKLRLN  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKE GDIYSTNEPQ AFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAIDATIDHKNGWMVSKEIGDIYSTNEPQTAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKE ES EKRRER+QQE+ELAKH+AEE+DDDF
Sbjct  443  HNEAVRALRFPPNTHKETESDEKRRERKQQEEELAKHMAEEEDDDF  488



>ref|XP_010416506.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B [Camelina sativa]
Length=487

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF  V EKF+ TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+
Sbjct  322  GDLELFGNVQEKFAKTFANDRTHNLIVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  SANPVADAESIVAKAIRDGAIDATIDHKNGWMVSKETGDIYSTNEPQTAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESDEKRREKKQQEEELAKYMAEEDDDDF  487



>ref|XP_002285893.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
 emb|CBI18933.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+ TFS DR +NLIVRLRHNVIRTGLRNISI+YSRISLAD+A KLRLD
Sbjct  322  GDLELFRSVAEKFAGTFSTDRIHNLIVRLRHNVIRTGLRNISISYSRISLADIASKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAI DGAIDATLD +NG MVSKETGDIYST EPQIAFNSRI FCLNM
Sbjct  382  SANPVADAESIVAKAIHDGAIDATLDHSNGWMVSKETGDIYSTIEPQIAFNSRITFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALR+PPN+ KEKESAEKRRERQQQEQELAKHIAEE+DDDF
Sbjct  442  HNEAVRALRYPPNTQKEKESAEKRRERQQQEQELAKHIAEEEDDDF  487



>ref|XP_008382101.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Malus domestica]
Length=487

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ +AEKFS+ F+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  322  GDLELFKNIAEKFSNVFNADRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ AF++RIAFCLN+
Sbjct  382  SPNPVADAESIVAKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQAAFDTRIAFCLNL  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN+AVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  442  HNDAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  487



>gb|EMS46362.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Triticum 
urartu]
Length=651

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KF+STFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  486  GDLELFRAVADKFASTFSADRTHNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  545

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            + NP+ADAE IV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQ AFNSRIAFCLNM
Sbjct  546  TENPVADAECIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQAAFNSRIAFCLNM  605

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+A+RFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  606  HNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  651



>ref|XP_008806135.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=497

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKF+ TFS DRT NLIVRLRHNVIRTGLRN+SI+YS ISLADVA+KLRLD
Sbjct  333  GDLELFRTVAEKFAGTFSSDRTRNLIVRLRHNVIRTGLRNVSISYSSISLADVARKLRLD  392

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG M+SKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  393  SDNPVADAESIVAKAIRDGAIDATIDHANGWMLSKETGDVYSTNEPQIAFNSRIAFCLNM  452

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDD  194
            HNEAVRAL+FPPNSH+EKESAEKRRERQQQ+QELAKHIAEEDD+
Sbjct  453  HNEAVRALKFPPNSHREKESAEKRRERQQQQQELAKHIAEEDDE  496



>ref|XP_009355646.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Pyrus x bretschneideri]
Length=487

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ +AEKFS  F+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  322  GDLELFKNIAEKFSDVFNADRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ AF++RIAFCLN+
Sbjct  382  SPNPVADAESIVAKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQAAFDTRIAFCLNL  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN+AVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  442  HNDAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  487



>ref|XP_006302193.1| hypothetical protein CARUB_v10020202mg [Capsella rubella]
 gb|EOA35091.1| hypothetical protein CARUB_v10020202mg [Capsella rubella]
Length=487

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF  V EKF+ TF+ DRT NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRL+
Sbjct  322  GDLELFGNVQEKFAKTFAIDRTQNLIVRLRHNVIRTGLRNISISYSRISLQDVAQKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  SANPVADAESIVAKAIRDGAIDATIDHKNGWMVSKETGDIYSTNEPQTAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESDEKRREKKQQEEELAKYMAEEDDDDF  487



>gb|EMT22108.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Aegilops 
tauschii]
Length=496

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLE+FR VAEKF STFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  331  GDLEVFRAVAEKFGSTFSADRTSNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            +   +ADAESIV+KAIRDGAIDAT+D  NG +VSKETGD+YSTNEPQ AFNSRIAFCLNM
Sbjct  391  TKTAVADAESIVAKAIRDGAIDATIDHANGWVVSKETGDVYSTNEPQAAFNSRIAFCLNM  450

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPPNSHKEKESAEKRRER QQE+ELAKH+AEE+DDDF
Sbjct  451  HNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEEDDDF  496



>ref|XP_009413027.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009413028.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009413029.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
Length=487

 Score =   259 bits (662),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+K+S TFS DRT NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLD
Sbjct  323  GDLELFRTVADKYSGTFSSDRTRNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDVYSTNEPQIAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDD  194
            HNEAVRALRFPPNS+KEKES EKRRERQQQEQELAKHIAEEDDD
Sbjct  443  HNEAVRALRFPPNSNKEKESEEKRRERQQQEQELAKHIAEEDDD  486



>dbj|BAK07086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLE+FR VA+KF STFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  331  GDLEVFRVVADKFGSTFSADRTSNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            +   +ADAESIV+KAIRDGA+DAT+D  NG +VSKETGD+YSTNEPQ AFNSRIAFCLNM
Sbjct  391  TKTAVADAESIVAKAIRDGAVDATIDHANGWVVSKETGDVYSTNEPQAAFNSRIAFCLNM  450

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  451  HNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  496



>dbj|BAJ90869.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLE+FR VA+KF STFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  331  GDLEVFRVVADKFGSTFSADRTSNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            +   +ADAESIV+KAIRDGA+DAT+D  NG +VSKETGD+YSTNEPQ AFNSRIAFCLNM
Sbjct  391  TKTAVADAESIVAKAIRDGAVDATIDHANGWVVSKETGDVYSTNEPQAAFNSRIAFCLNM  450

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  451  HNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  496



>ref|XP_010428646.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=487

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF  V EKF+ TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA KLRL+
Sbjct  322  GDLELFGNVQEKFAKTFANDRTHNLIVRLRHNVIRTGLRNISISYSRISLQDVALKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  SANPVADAESIVAKAIRDGAIDATIDHKNGWMVSKETGDIYSTNEPQTAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRE++QQE+ELAK++AEEDDDD 
Sbjct  442  HNEAVRALRFPPNTHKEKESDEKRREKKQQEEELAKYMAEEDDDDL  487



>gb|EMS49644.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Triticum 
urartu]
Length=517

 Score =   257 bits (657),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLE+FR VAEKF S FS DRT+NLIVRLRHNVIRTGLRNISI+YSRISLAD+AKKLRLD
Sbjct  352  GDLEVFRAVAEKFGSIFSADRTSNLIVRLRHNVIRTGLRNISISYSRISLADIAKKLRLD  411

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            +   +ADAESIV+KAIRDGAIDAT+D  NG +VSKETGD+YSTNEPQ AFNSRIAFCLNM
Sbjct  412  TKTAVADAESIVAKAIRDGAIDATIDHANGWVVSKETGDVYSTNEPQAAFNSRIAFCLNM  471

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPPNSHKEKESAEKRRER QQE+ELAKH+AEEDDDDF
Sbjct  472  HNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMAEEDDDDF  517



>gb|EPS67790.1| hypothetical protein M569_06981, partial [Genlisea aurea]
Length=487

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VAEKFSS+F  D T NLIVRLRHNVIRTGLRNISI+YSRISLAD+A+KLRLD
Sbjct  325  GDLELFKAVAEKFSSSFGSDGTKNLIVRLRHNVIRTGLRNISISYSRISLADIARKLRLD  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDATLD   G M SKETGDIYSTNEPQ AFNSRI+FCLNM
Sbjct  385  SGNPVADAESIVAKAIRDGAIDATLDHGKGWMTSKETGDIYSTNEPQTAFNSRISFCLNM  444

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDD  197
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDD
Sbjct  445  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDD  487



>ref|XP_004290733.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Fragaria vesca subsp. vesca]
Length=488

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR +A+KFS+ FS D T+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRLD
Sbjct  323  GDLELFRTIADKFSTVFSSDGTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S  P+ DAESIV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQ AF++RIAFCLN+
Sbjct  383  SPTPVDDAESIVAKAIRDGAIDATLDHANGYMVSKETGDIYSTNEPQAAFDTRIAFCLNL  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN+AVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  443  HNDAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_003550437.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like isoform X1 [Glycine max]
 gb|KHN12619.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=490

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR   EKF +TFS+DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+
Sbjct  325  GDLELFRNATEKFGTTFSRDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLN  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA+P+AD+ESIV+KAIRDGAIDA+LD  NG MVSK TGDIYSTNEPQ+A NSRIAFCLNM
Sbjct  385  SASPVADSESIVAKAIRDGAIDASLDHANGWMVSKGTGDIYSTNEPQLALNSRIAFCLNM  444

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            +NEAVRALRFPPN  KEKE+AEKRRER QQEQELAKHIAEEDDDDF
Sbjct  445  YNEAVRALRFPPNKDKEKENAEKRRERHQQEQELAKHIAEEDDDDF  490



>ref|XP_006601362.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like isoform X2 [Glycine max]
Length=497

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR   EKF +TFS+DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVAKKLRL+
Sbjct  332  GDLELFRNATEKFGTTFSRDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVAKKLRLN  391

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA+P+AD+ESIV+KAIRDGAIDA+LD  NG MVSK TGDIYSTNEPQ+A NSRIAFCLNM
Sbjct  392  SASPVADSESIVAKAIRDGAIDASLDHANGWMVSKGTGDIYSTNEPQLALNSRIAFCLNM  451

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            +NEAVRALRFPPN  KEKE+AEKRRER QQEQELAKHIAEEDDDDF
Sbjct  452  YNEAVRALRFPPNKDKEKENAEKRRERHQQEQELAKHIAEEDDDDF  497



>ref|XP_010471748.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=487

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF  V EKF+ TF+ DRT+NLIVRL HNVIRTGLRNISI+YSRISL DVA KLRL+
Sbjct  322  GDLELFGNVQEKFAKTFANDRTHNLIVRLHHNVIRTGLRNISISYSRISLQDVALKLRLN  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ DAESIV+KAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  SANPVTDAESIVAKAIRDGAIDATIDHKNGWMVSKETGDIYSTNEPQTAFNSRIAFCLNM  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HKEKES EKRRE++QQE+ELAK++AEEDDDDF
Sbjct  442  HNEAVRALRFPPNTHKEKESDEKRREKKQQEEELAKYMAEEDDDDF  487



>gb|ABR16257.1| unknown [Picea sitchensis]
Length=492

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 157/167 (94%), Gaps = 1/167 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL+LFR VA+K+S TFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA KLRL+
Sbjct  326  GDLDLFRSVADKYSKTFSADRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAAKLRLN  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA P+ADA+SIV+KAIRDGAIDAT+D  NG M+SKETGD+YSTNEPQ+AFNSRIAFCLNM
Sbjct  386  SATPVADAQSIVAKAIRDGAIDATIDHANGWMLSKETGDVYSTNEPQLAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkek-esaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN+HK++ ESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  446  HNEAVRALRFPPNAHKKERESAEKRRERQQQEQELAKHIAEEDDDEF  492



>gb|KJB47689.1| hypothetical protein B456_008G037000 [Gossypium raimondii]
Length=484

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 153/166 (92%), Gaps = 3/166 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFSSTFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  322  GDLELFRSVAEKFSSTFSSDRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S   +ADAESIV+KAIRDGAIDATLD  + CM+SKETGDIYS  EPQ  FNSRIAFCLNM
Sbjct  382  S---VADAESIVAKAIRDGAIDATLDHASRCMLSKETGDIYSMTEPQTVFNSRIAFCLNM  438

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRER+QQEQELAKHIAEEDDD+F
Sbjct  439  HNEAVRALRFPPNSHKEKESAEKRRERRQQEQELAKHIAEEDDDEF  484



>ref|XP_006855514.1| hypothetical protein AMTR_s00057p00205760 [Amborella trichopoda]
 gb|ERN16981.1| hypothetical protein AMTR_s00057p00205760 [Amborella trichopoda]
Length=484

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 156/166 (94%), Gaps = 3/166 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+K+S+TFSKDRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVA KLRLD
Sbjct  322  GDLELFRSVADKYSATFSKDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVASKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S   +ADAESIV+KAIRDGAIDAT+D   G ++SKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  382  S---VADAESIVAKAIRDGAIDATIDHAKGWVLSKETGDIYSTNEPQAAFNSRIAFCLNM  438

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  439  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  484



>ref|XP_008377724.1| PREDICTED: LOW QUALITY PROTEIN: probable 26S proteasome non-ATPase 
regulatory subunit 3 [Malus domestica]
Length=487

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL LF+ +AEKFS+ F+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  322  GDLXLFKNIAEKFSNVFNADRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  381

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRD AIDATLD  NG MVSKETGDIYSTNEPQ AF++RIAFCLN+
Sbjct  382  SPNPVADAESIVAKAIRDXAIDATLDHANGWMVSKETGDIYSTNEPQAAFDTRIAFCLNL  441

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN+AVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  442  HNDAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  487



>ref|XP_009382040.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009382041.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=488

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+KFS TF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRLD
Sbjct  323  GDLELFRIVADKFSGTFNSDRTHNLIVRLRHNVIRTGLRNISISYSRISLADVARKLRLD  382

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGA+DA +D  NG MVSKETG++YSTNEPQIAFNSRIAFCLNM
Sbjct  383  SENPVADAESIVAKAIRDGAVDAIIDHANGWMVSKETGNVYSTNEPQIAFNSRIAFCLNM  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNS+KEKES EKRRERQQQEQELAKHIAEEDD DF
Sbjct  443  HNEAVRALRFPPNSNKEKESEEKRRERQQQEQELAKHIAEEDDGDF  488



>ref|XP_007160631.1| hypothetical protein PHAVU_001G003600g [Phaseolus vulgaris]
 gb|ESW32625.1| hypothetical protein PHAVU_001G003600g [Phaseolus vulgaris]
Length=490

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL+LF+ VAEKF +TF++D T+NLIVRLRHNVIRTGLRNISI+YSRIS+ADVAKKLRL+
Sbjct  325  GDLDLFKNVAEKFGTTFNRDGTHNLIVRLRHNVIRTGLRNISISYSRISVADVAKKLRLN  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+ADAESIV+KAIRDGA+DA+LD  +G M SKETGDIYSTNEPQ+AFNSRI+FCLNM
Sbjct  385  SANPVADAESIVAKAIRDGAVDASLDHADGWMGSKETGDIYSTNEPQVAFNSRISFCLNM  444

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV ALRFPPN+HKEKESAEKRRER QQEQELAKHI EEDDDDF
Sbjct  445  HNEAVLALRFPPNTHKEKESAEKRRERHQQEQELAKHIEEEDDDDF  490



>ref|XP_007222347.1| hypothetical protein PRUPE_ppa004821mg [Prunus persica]
 gb|EMJ23546.1| hypothetical protein PRUPE_ppa004821mg [Prunus persica]
Length=490

 Score =   254 bits (648),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 153/166 (92%), Gaps = 1/166 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL LFR VAEKF++TFSKD+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL 
Sbjct  326  GDLALFRNVAEKFAATFSKDQTHNLIVRLRHNVIRTGLRNISISYSRISLADVAEKLRLI  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NPIADAESIV+KAIRDGAI+A+LD +NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  386  STNPIADAESIVAKAIRDGAIEASLDHSNGWMVSKETGDIYSTNEPQAAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN H +++ + +RRERQQQEQELA HI E+DDDDF
Sbjct  446  HNEAVRALRFPPNPH-KEKESAERRERQQQEQELANHITEDDDDDF  490



>gb|KHG11096.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Gossypium 
arboreum]
Length=447

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 152/166 (92%), Gaps = 3/166 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFSSTFS DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVAKKLRLD
Sbjct  285  GDLELFRSVAEKFSSTFSSDRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLD  344

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S   +ADAESIV+KAIRDGAIDA LD  + CM+SKETGDIYS  EPQ  FNSRIAFCLNM
Sbjct  345  S---VADAESIVAKAIRDGAIDAILDHASRCMLSKETGDIYSMTEPQTVFNSRIAFCLNM  401

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  402  HNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDEF  447



>ref|XP_008221216.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Prunus mume]
Length=491

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 153/166 (92%), Gaps = 1/166 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL LFR VAEKF++TFSKD+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL 
Sbjct  327  GDLALFRNVAEKFAATFSKDQTHNLIVRLRHNVIRTGLRNISISYSRISLADVAEKLRLI  386

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NPIADAESIV+KAIRDGAI+A+LD +NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  387  STNPIADAESIVAKAIRDGAIEASLDHSNGWMVSKETGDIYSTNEPQAAFNSRIAFCLNM  446

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN H +++ + +RRERQQQEQELA HI E+DDDDF
Sbjct  447  HNEAVRALRFPPNPH-KEKESAERRERQQQEQELANHITEDDDDDF  491



>ref|XP_008221217.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Prunus mume]
Length=490

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 153/166 (92%), Gaps = 1/166 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL LFR VAEKF++TFSKD+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL 
Sbjct  326  GDLALFRNVAEKFAATFSKDQTHNLIVRLRHNVIRTGLRNISISYSRISLADVAEKLRLI  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NPIADAESIV+KAIRDGAI+A+LD +NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  386  STNPIADAESIVAKAIRDGAIEASLDHSNGWMVSKETGDIYSTNEPQAAFNSRIAFCLNM  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAVRALRFPPN H +++ + +RRERQQQEQELA HI E+DDDDF
Sbjct  446  HNEAVRALRFPPNPH-KEKESAERRERQQQEQELANHITEDDDDDF  490



>dbj|BAA02696.1| 21D7 antigen [Daucus carota]
Length=488

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  661  VAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADA  482
            VA+KF+STF+ DRT+NLIVRLRHNVIRTGLRNISI+YSRISL DVA+KLRLDS NP+ADA
Sbjct  331  VADKFASTFTADRTHNLIVRLRHNVIRTGLRNISISYSRISLVDVARKLRLDSPNPVADA  390

Query  481  ESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRAL  302
            ESIVSKAIRDGAIDAT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNMHNEAVRAL
Sbjct  391  ESIVSKAIRDGAIDATIDHANGWMVSKETGDIYSTNEPQAAFNSRIAFCLNMHNEAVRAL  450

Query  301  RFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            RFP NSHK+KESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  451  RFPANSHKDKESAEKRRERQQQEQELAKHIAEEDDDEF  488



>ref|XP_007017885.1| PAM domain (PCI/PINT associated module) protein isoform 4 [Theobroma 
cacao]
 gb|EOY15110.1| PAM domain (PCI/PINT associated module) protein isoform 4 [Theobroma 
cacao]
Length=474

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  655  EKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLDSANPIADAES  476
            +KF+STFS D+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL+S  P+ADAES
Sbjct  319  KKFASTFSTDKTHNLIVRLRHNVIRTGLRNISISYSRISLADVAEKLRLNSKTPVADAES  378

Query  475  IVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRF  296
            IV+KAIRDGAIDATLD  NG MVSKETGDIYSTNEPQIAF+SRIAFCLNMHNEAVRALRF
Sbjct  379  IVAKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFHSRIAFCLNMHNEAVRALRF  438

Query  295  PPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            PPN+HKEKESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  439  PPNTHKEKESAEKRRERQQQEQELAKHIAEEDDDDF  474



>ref|XP_003589555.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
 gb|AES59806.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=483

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEK+++TF+ D TNNLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL 
Sbjct  317  GDLELFRNVAEKYATTFNTDGTNNLIVRLRHNVIRTGLRNISISYSRISLADVAQKLRLS  376

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA+PIADAESI+SKAIRDGAIDATLD  NG MVSKE GDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  377  SADPIADAESIISKAIRDGAIDATLDHANGWMVSKEIGDIYSTNEPQLAFNSRIAFCLNM  436

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHI  212
            HNEAV+ALRFP N+HKEKE AEKRRERQQQEQELAKHI
Sbjct  437  HNEAVQALRFPKNTHKEKEIAEKRRERQQQEQELAKHI  474



>ref|XP_010446093.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=392

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 149/164 (91%), Gaps = 3/164 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF  V EKFS TF+KDRT+NLIVRLRHNVIRT LRNIS++Y RISL DVA+KLRLD
Sbjct  231  GDLELFGNVQEKFSKTFAKDRTHNLIVRLRHNVIRTALRNISVSYWRISLQDVAQKLRLD  290

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S   +ADAESIV+KAIRDGAI+AT+D  NG MVSKETGDIYSTNEPQ AFNSRIAFCLNM
Sbjct  291  S---VADAESIVAKAIRDGAIEATIDHKNGLMVSKETGDIYSTNEPQTAFNSRIAFCLNM  347

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDD  194
            HNEAVRALR+PPN+HKEKE+ EKRRE++QQE+ELAK++AEEDDD
Sbjct  348  HNEAVRALRYPPNTHKEKENEEKRREKKQQEEELAKYMAEEDDD  391



>ref|XP_004499304.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cicer arietinum]
Length=491

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+K+++TF+ D TNNLIVRLRHNVIRTGLRNISI+YSRISLADVA+KLRL 
Sbjct  325  GDLELFRNVADKYATTFNTDGTNNLIVRLRHNVIRTGLRNISISYSRISLADVAQKLRLS  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANPIADAE I+SKAIRDGAIDATLD TN  MVSKETGDIYSTNEPQ+AFNSRIAFCLNM
Sbjct  385  SANPIADAECIISKAIRDGAIDATLDHTNKWMVSKETGDIYSTNEPQLAFNSRIAFCLNM  444

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHI  212
            HNEAV+ALRFP N+HKEKE AEKRRERQQQEQELAKHI
Sbjct  445  HNEAVQALRFPKNTHKEKEIAEKRRERQQQEQELAKHI  482



>gb|AAC79872.1| putative 21D7 protein [Dendrobium grex Madame Thong-In]
Length=188

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 146/165 (88%), Gaps = 1/165 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL     VAEKFS+TFS DRT NLIVR    +   GLRNISI+YSRISL+DVAKKLRLD
Sbjct  23   GDLSFSGLVAEKFSTTFSSDRTTNLIVRY-DTMWFGGLRNISISYSRISLSDVAKKLRLD  81

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ADAESIV+KAIRDGAIDAT+D  NG M+SKETGDIYSTNEPQ+AF+SRIAFCLNM
Sbjct  82   SDNPVADAESIVAKAIRDGAIDATIDHANGWMISKETGDIYSTNEPQLAFHSRIAFCLNM  141

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDD  191
            HNEAV+ALRFPPNSHKEKESAEKRRERQ QEQELAKHIAEE+DDD
Sbjct  142  HNEAVKALRFPPNSHKEKESAEKRRERQHQEQELAKHIAEEEDDD  186



>ref|XP_001757567.1| predicted protein [Physcomitrella patens]
 gb|EDQ77624.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFRQVAEK+SS F+ D+ +NLIVRLRHNVIRTGLRNISIAYSRISLADVA KL LD
Sbjct  320  GDLELFRQVAEKYSSVFTADKCHNLIVRLRHNVIRTGLRNISIAYSRISLADVATKLHLD  379

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA P+ DAESIV+KAIRDG IDA++D +NG M SKET DIYST EPQ AF+SRIAFCLN 
Sbjct  380  SATPVDDAESIVTKAIRDGGIDASVDHSNGWMQSKETSDIYSTQEPQQAFHSRIAFCLNT  439

Query  325  HNEAVRALRFPPNSHkek-esaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPP++HK++ ES+EKRRERQQQEQELAKHIAEEDDD+F
Sbjct  440  HNEAVKALRFPPDAHKKQLESSEKRRERQQQEQELAKHIAEEDDDEF  486



>ref|XP_001753136.1| predicted protein [Physcomitrella patens]
 gb|EDQ82177.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEK SS F+ D+ +NLIVRLRHNVIRTGLRNISIAYSRISL DVAKKL LD
Sbjct  320  GDLELFRHVAEKSSSVFTADKCHNLIVRLRHNVIRTGLRNISIAYSRISLTDVAKKLHLD  379

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA P+ DAESIV+KAIRDG IDA++D +NG M SKETGD+YST EPQ AF+SRIAFCLN+
Sbjct  380  SATPVDDAESIVTKAIRDGGIDASVDHSNGWMQSKETGDVYSTQEPQQAFHSRIAFCLNI  439

Query  325  HNEAVRALRFPPNSHkek-esaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPP++HK++ ESAEKRRERQQQEQELAKHIAEEDDD+F
Sbjct  440  HNEAVQALRFPPDAHKKELESAEKRRERQQQEQELAKHIAEEDDDEF  486



>ref|XP_010446200.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=475

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 148/164 (90%), Gaps = 3/164 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF  V EKFS TF+KDRT+NLIVRLRHNVIRT LRNIS++YS ISL DVA+KLRLD
Sbjct  314  GDLELFGNVQEKFSKTFAKDRTHNLIVRLRHNVIRTALRNISVSYSSISLQDVAQKLRLD  373

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S   +ADAESIV+KAIRDGAI+AT+D  NG MVSKETGDIYST EPQ AFNSRIAFCLNM
Sbjct  374  S---VADAESIVAKAIRDGAIEATIDHKNGLMVSKETGDIYSTKEPQTAFNSRIAFCLNM  430

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDD  194
            HNEAVRALR+PPN+HKEKE+ EKRRE++QQE+ELAK++AEEDDD
Sbjct  431  HNEAVRALRYPPNTHKEKENEEKRREKKQQEEELAKYMAEEDDD  474



>ref|XP_001764054.1| predicted protein [Physcomitrella patens]
 gb|EDQ71193.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VA+K SS F+ D+++NLIVRLRHNVIRTGLRNISIAYSRISLADVA KL LD
Sbjct  320  GDLELFRSVADKHSSVFTSDKSHNLIVRLRHNVIRTGLRNISIAYSRISLADVATKLHLD  379

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S  P+ DAESIV+KAIRDG IDA++D   G M SKETGDIYST EPQ AF+SRIAFCLN 
Sbjct  380  SPTPVEDAESIVTKAIRDGGIDASVDHAKGWMQSKETGDIYSTQEPQHAFHSRIAFCLNT  439

Query  325  HNEAVRALRFPPNSHkek-esaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEAV+ALRFPP++HK++ ESAEKRRERQQQEQELAKHIAEEDDDDF
Sbjct  440  HNEAVKALRFPPDAHKKELESAEKRRERQQQEQELAKHIAEEDDDDF  486



>ref|XP_009628274.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Nicotiana tomentosiformis]
Length=485

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR   EKFSS F++DRT+NLIVRLRHNVIR GLRNIS +YSRISLAD+AKKL LD
Sbjct  344  GDLELFRTADEKFSSIFNQDRTSNLIVRLRHNVIRAGLRNISASYSRISLADIAKKLNLD  403

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ DAE+IV+KAIRDGAIDATLD  NG +VSK TGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  404  SENPVDDAENIVAKAIRDGAIDATLDHANGWLVSKATGDVYSTNEPQIAFNSRIAFCLNM  463

Query  325  HNEAVRALRFPPN  287
            HNEAVRALRFP N
Sbjct  464  HNEAVRALRFPQN  476



>ref|XP_009628273.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Nicotiana tomentosiformis]
Length=486

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR   EKFSS F++DRT+NLIVRLRHNVIR GLRNIS +YSRISLAD+AKKL LD
Sbjct  345  GDLELFRTADEKFSSIFNQDRTSNLIVRLRHNVIRAGLRNISASYSRISLADIAKKLNLD  404

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S NP+ DAE+IV+KAIRDGAIDATLD  NG +VSK TGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  405  SENPVDDAENIVAKAIRDGAIDATLDHANGWLVSKATGDVYSTNEPQIAFNSRIAFCLNM  464

Query  325  HNEAVRALRFPPN  287
            HNEAVRALRFP N
Sbjct  465  HNEAVRALRFPQN  477



>ref|XP_009773691.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X3 [Nicotiana sylvestris]
Length=487

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLEL R VA KFSSTFS+DRT+NLIVRLRHNVIRTGLRNIS AYSRISLAD+AKKL LD
Sbjct  346  GDLELLRTVAVKFSSTFSQDRTSNLIVRLRHNVIRTGLRNISTAYSRISLADIAKKLNLD  405

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S +P+ DAE++V+KAIRDGAIDAT+D  N  +VSK TGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  406  SEHPVDDAENLVAKAIRDGAIDATIDHANRWLVSKATGDVYSTNEPQIAFNSRIAFCLNM  465

Query  325  HNEAVRALRFPPN  287
            HNEAV ALRFP N
Sbjct  466  HNEAVHALRFPQN  478



>ref|XP_009773690.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Nicotiana sylvestris]
Length=488

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLEL R VA KFSSTFS+DRT+NLIVRLRHNVIRTGLRNIS AYSRISLAD+AKKL LD
Sbjct  347  GDLELLRTVAVKFSSTFSQDRTSNLIVRLRHNVIRTGLRNISTAYSRISLADIAKKLNLD  406

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S +P+ DAE++V+KAIRDGAIDAT+D  N  +VSK TGD+YSTNEPQIAFNSRIAFCLNM
Sbjct  407  SEHPVDDAENLVAKAIRDGAIDATIDHANRWLVSKATGDVYSTNEPQIAFNSRIAFCLNM  466

Query  325  HNEAVRALRFPPN  287
            HNEAV ALRFP N
Sbjct  467  HNEAVHALRFPQN  479



>ref|XP_002970446.1| hypothetical protein SELMODRAFT_231540 [Selaginella moellendorffii]
 ref|XP_002978519.1| hypothetical protein SELMODRAFT_233136 [Selaginella moellendorffii]
 gb|EFJ20505.1| hypothetical protein SELMODRAFT_233136 [Selaginella moellendorffii]
 gb|EFJ28576.1| hypothetical protein SELMODRAFT_231540 [Selaginella moellendorffii]
Length=482

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELF+ VA+ FS  FS+D+T+NLIVRLRHNVIRTGLRNISI+YSRISLADVA KL L 
Sbjct  316  GDLELFKSVADNFSPIFSRDKTHNLIVRLRHNVIRTGLRNISISYSRISLADVAAKLHLS  375

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S + ++DAES+V+KAIRDG IDA +D   G M S+ETGDIYST EPQ+AF+SRIAFCLN 
Sbjct  376  SDSAVSDAESMVAKAIRDGGIDAVIDHARGFMQSRETGDIYSTQEPQLAFHSRIAFCLNT  435

Query  325  HNEAVRALRFPPNSHkek-esaekrrerqqqeqELAKHIAEEDDDDF  188
            +N+AV+ALRFPPN+HK++ ESAEKRRERQQQEQELAKHIAEE+DDDF
Sbjct  436  YNDAVKALRFPPNAHKKELESAEKRRERQQQEQELAKHIAEEEDDDF  482



>ref|XP_004231453.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Solanum lycopersicum]
Length=484

 Score =   217 bits (553),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAEKFSSTFS+D+T+NLI R+RHNVIRTG++N+S++Y+RISLAD+AKKL LD
Sbjct  346  GDLELFRTVAEKFSSTFSQDKTSNLINRVRHNVIRTGIKNVSVSYTRISLADIAKKLNLD  405

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
              NPI DAE+IV+KAIRDGAIDATLD  NG +VSK T D+YSTNEPQIAF+SRI FCL+M
Sbjct  406  LENPIGDAENIVAKAIRDGAIDATLDHANGWLVSKATEDVYSTNEPQIAFDSRINFCLSM  465

Query  325  HNEAVRALRFP  293
            HNEA+RALRFP
Sbjct  466  HNEALRALRFP  476



>ref|XP_002300686.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE79959.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=492

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAE  +  F  D+T NLIVRLRHNVIRTGLR ISI+YSRISLADVA+KL+LD
Sbjct  327  GDLELFRNVAEDLAGFFGSDKTYNLIVRLRHNVIRTGLRKISISYSRISLADVAEKLKLD  386

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+AD ESI +KAIRDGAI A LD  NG +VSK+TGDIYST +P   F+SRIAFCLN+
Sbjct  387  SANPVADVESITAKAIRDGAIHAILDHANGWLVSKDTGDIYSTAKPLAVFSSRIAFCLNL  446

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            H +AV+ALRFPP + +EK+S +  RE Q  ++E+A+   +ED+  F
Sbjct  447  HTDAVKALRFPPKTQEEKDSDDYWRESQVLDEEIAREFMDEDETYF  492



>ref|XP_011034975.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Populus euphratica]
Length=492

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAE F+  F  D+T NLIVRLRHNVIRTGLR ISI+YSRISLADVA+KL+LD
Sbjct  327  GDLELFRNVAEDFAGFFGSDKTYNLIVRLRHNVIRTGLRKISISYSRISLADVAEKLKLD  386

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+AD ESI +KAIRDGAI A LD  NG +VSK+TGDIYST +P   F+SRIAFC N+
Sbjct  387  SANPVADVESITAKAIRDGAIHAVLDHANGWLVSKDTGDIYSTAKPLAVFSSRIAFCRNL  446

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
             N+AV+ALRFPP + +E++S E  RE Q  ++E+A+   +ED+  F
Sbjct  447  QNDAVKALRFPPKTQEERDSDEYWRESQVLDEEIAREYMDEDETYF  492



>ref|XP_011034976.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X3 [Populus euphratica]
Length=491

 Score =   204 bits (519),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAE F+  F  D+T NLIVRLRHNVIRTGLR ISI+YSRISLADVA+KL+LD
Sbjct  326  GDLELFRNVAEDFAGFFGSDKTYNLIVRLRHNVIRTGLRKISISYSRISLADVAEKLKLD  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+AD ESI +KAIRDGAI A LD  NG +VSK+TGDIYST +P   F+SRIAFC N+
Sbjct  386  SANPVADVESITAKAIRDGAIHAVLDHANGWLVSKDTGDIYSTAKPLAVFSSRIAFCRNL  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
             N+AV+ALRFPP + +E++S E  RE Q  ++E+A+   +ED+  F
Sbjct  446  QNDAVKALRFPPKTQEERDSDEYWRESQVLDEEIAREYMDEDETYF  491



>ref|XP_011034972.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Populus euphratica]
 ref|XP_011034973.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Populus euphratica]
Length=517

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDLELFR VAE F+  F  D+T NLIVRLRHNVIRTGLR ISI+YSRISLADVA+KL+LD
Sbjct  352  GDLELFRNVAEDFAGFFGSDKTYNLIVRLRHNVIRTGLRKISISYSRISLADVAEKLKLD  411

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SANP+AD ESI +KAIRDGAI A LD  NG +VSK+TGDIYST +P   F+SRIAFC N+
Sbjct  412  SANPVADVESITAKAIRDGAIHAVLDHANGWLVSKDTGDIYSTAKPLAVFSSRIAFCRNL  471

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
             N+AV+ALRFPP + +E++S E  RE Q  ++E+A+   +ED+  F
Sbjct  472  QNDAVKALRFPPKTQEERDSDEYWRESQVLDEEIAREYMDEDETYF  517



>gb|ERE68314.1| 26S proteasome non-ATPase regulatory subunit 3-like protein [Cricetulus 
griseus]
Length=223

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  59   GNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  118

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  119  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDI  175

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  176  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  222



>sp|Q9U5Z8.1|PSMD3_ANOST RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Diphenol 
oxidase A2 component; Short=DOX-A2 [Anopheles stephensi]
 emb|CAB61220.1| 26S proteasome regulatory subunit [Anopheles stephensi]
Length=500

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 125/167 (75%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F +D T  LI+RLRHNVI+T +R+I +AYSRIS  D+A+KL LD
Sbjct  337  GNLQRFGEVLENFGEQFRQDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLD  396

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG IDATLD   G M +KE+ DIYST EPQ+AF+ RI+FCL++
Sbjct  397  SPE---DAEFIVAKAIRDGVIDATLDPEKGYMRTKESTDIYSTREPQLAFHQRISFCLDL  453

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqe-qELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ ++  + + R  ++Q+  ELAK +AEEDDDDF
Sbjct  454  HNQSVKAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDDDDF  500



>ref|XP_005952777.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3-like 
[Haplochromis burtoni]
Length=281

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV E+F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  117  GNLAKFNQVLEQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  176

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKET DIY T EPQ+AF+ RI+FCL++
Sbjct  177  SPE---DAEFIVAKAIRDGVIEASINHEKGFVQSKETMDIYGTREPQLAFHQRISFCLDI  233

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP ++ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  234  HNMSVKAMRFPPKAYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  280



>ref|XP_010209308.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Tinamus guttatus]
Length=181

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  17   GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  76

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  77   SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  133

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  134  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  180



>ref|XP_009950809.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Leptosomus discolor]
Length=207

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  43   GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  102

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  103  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  159

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  160  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  206



>gb|KFB39121.1| AGAP009082-PA-like protein [Anopheles sinensis]
Length=497

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 124/167 (74%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F +D T  LI+RLRHNVI+T +R+I +AYSRIS  D+AKKL LD
Sbjct  334  GNLQRFGEVLENFGEQFRQDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIAKKLGLD  393

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD   G M SKE+ DIYST EPQ+AF+ RI+FCL++
Sbjct  394  SPE---DAEFIVAKAIRDGVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRISFCLDL  450

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqe-qELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ ++  + + R  ++Q+  ELAK +AEEDDD F
Sbjct  451  HNQSVKAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDDDGF  497



>ref|XP_005497468.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Zonotrichia 
albicollis]
Length=234

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  70   GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  129

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  130  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  186

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  187  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  233



>gb|ABN12032.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Maconellicoccus 
hirsutus]
Length=213

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F +V  KFS+ F +DRT  +I+RLRHNVI+TG+R I+ +YSRI+  ++AK+L LD
Sbjct  49   GNLHTFSEVLNKFSAQFQQDRTFLMIIRLRHNVIKTGVRAIAASYSRITPENIAKQLGLD  108

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA    DAE I++KAIRDG I+A +D  NG M +KE+ DIY T EPQIAF+ R AFCL +
Sbjct  109  SAQ---DAECIIAKAIRDGVIEAIIDPVNGYMQTKESTDIYCTAEPQIAFHERTAFCLEL  165

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AE++DD F
Sbjct  166  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEDEDDGF  212



>emb|CDS04865.1| hypothetical protein LRAMOSA07395 [Absidia idahoensis var. thermophila]
Length=495

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 120/165 (73%), Gaps = 5/165 (3%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL  F++   +F S F KD+T  LI+RLRHNVI+TG+R IS++YS+ISL D+  KL LD
Sbjct  329  GDLNKFQEGLAQFDSVFKKDKTYTLILRLRHNVIKTGIRMISLSYSKISLRDICLKLHLD  388

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IVSKAIRDG IDATLD   G M SKE  DIYSTNEPQ AFN+RI FCLN+
Sbjct  389  SEE---DAEFIVSKAIRDGVIDATLDHNGGFMKSKEIVDIYSTNEPQHAFNNRITFCLNL  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDD  191
            HN+AV+A+RFP ++H  ++        +++E+ELA+ IAE D DD
Sbjct  446  HNDAVKAMRFPLDAH--RKELANAEAARERERELAQEIAEGDMDD  488



>emb|CDH49942.1| proteasome regulatory particle subunit [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=495

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 120/165 (73%), Gaps = 5/165 (3%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL  F++   +F S F KD+T  LI+RLRHNVI+TG+R IS++YS+ISL D+  KL LD
Sbjct  329  GDLNKFQEGLAQFDSVFKKDKTYTLILRLRHNVIKTGIRMISLSYSKISLRDICLKLHLD  388

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IVSKAIRDG IDATLD   G M SKE  DIYSTNEPQ AFN+RI FCLN+
Sbjct  389  SEE---DAEFIVSKAIRDGVIDATLDHNGGFMKSKEIVDIYSTNEPQHAFNNRITFCLNL  445

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDD  191
            HN+AV+A+RFP ++H  ++        +++E+ELA+ IAE D DD
Sbjct  446  HNDAVKAMRFPLDAH--RKELANAEAARERERELAQEIAEGDMDD  488



>gb|ETN60770.1| 26S proteasome regulatory subunit S3 [Anopheles darlingi]
Length=495

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 124/167 (74%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F +D T  LI+RLRHNVI+T +R+I +AYSRIS  D+A+KL LD
Sbjct  332  GNLQRFGEVLENFGEQFRQDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLD  391

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD   G M SKE+ DIYST EPQ+AF+ RI+FCL++
Sbjct  392  SPE---DAEFIVAKAIRDGVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRISFCLDL  448

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqe-qELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ ++  + + R  ++Q+  ELAK +AEEDDD F
Sbjct  449  HNQSVKAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDDDGF  495



>ref|XP_002945863.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
 gb|EFJ52858.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
Length=490

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 126/167 (75%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GD   F+QV E+FSS F  DRT+NLI RL  NVIR GLR +++AYSRISLA++A KL L 
Sbjct  327  GDTLAFKQVTERFSSVFLADRTHNLITRLHQNVIRIGLRRMNLAYSRISLAEIAAKLHLV  386

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA    DAE IV+KAIRDG IDA +D   G M S+E  D+YST EPQ AF++RIAFCL++
Sbjct  387  SAE---DAEYIVAKAIRDGGIDAVIDHEGGFMASRERVDVYSTAEPQAAFHARIAFCLDL  443

Query  325  HNEAVRALRFPPNSH-kekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEA++A+RF P++H ++ ES+E R+ER   EQELAK + E+D +DF
Sbjct  444  HNEAIKAMRFEPDAHRRKAESSEARQERLAAEQELAKALEEDDGEDF  490



>ref|XP_004707502.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Echinops 
telfairi]
Length=358

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  194  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  253

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  254  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDI  310

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  311  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  357



>ref|XP_009075840.1| PREDICTED: LOW QUALITY PROTEIN: 26S proteasome non-ATPase regulatory 
subunit 3, partial [Acanthisitta chloris]
Length=303

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  139  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  198

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  199  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  255

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  256  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  302



>ref|XP_002595252.1| hypothetical protein BRAFLDRAFT_268075 [Branchiostoma floridae]
 gb|EEN51264.1| hypothetical protein BRAFLDRAFT_268075 [Branchiostoma floridae]
Length=512

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 131/167 (78%), Gaps = 5/167 (3%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F +V EK+   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  350  GNLAKFNEVLEKYGDRFQADNTWTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  409

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+AT+D   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  410  SPE---DAEFIVAKAIRDGVIEATIDHEKGYVQSKENTDIYSTREPQLAFHQRISFCLDI  466

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+RFPP S+ +  ESAE++RER++Q+ ELAK IA +D+DDF
Sbjct  467  HNQSVKAMRFPPKSYSKDLESAEEQRERERQDLELAKEIA-DDEDDF  512



>ref|XP_005181586.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musca domestica]
Length=489

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 130/167 (78%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F +D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AK+L LD
Sbjct  326  GNLKRFGEVVENFGPKFQQDHTYTLIIRLRHNVIKTAIRSIGLSYSRISPADIAKRLMLD  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD  N  M SKE+ DIYST EPQ+AF+ RI+FCLN+
Sbjct  386  SPE---DAEFIVAKAIRDGVIEATLDPANNFMRSKESTDIYSTREPQLAFHERISFCLNL  442

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AE++DD F
Sbjct  443  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEDEDDGF  489



>gb|EFX72606.1| hypothetical protein DAPPUDRAFT_227411 [Daphnia pulex]
Length=496

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 125/167 (75%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GD+  F QV E +  TF  D T  LI+RLRHNVI+T +R IS++YSRISLAD+A KL LD
Sbjct  332  GDIHRFNQVLENYGKTFQADHTYTLIIRLRHNVIKTAIRAISLSYSRISLADIAHKLLLD  391

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA    DAE IV+KAIRDG I+A LD     M SKE+ D+YST EPQ+AF+ RI FCL +
Sbjct  392  SAE---DAEFIVAKAIRDGVIEAWLDHEGKFMQSKESIDVYSTKEPQLAFHQRITFCLQI  448

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+RFPP ++ +  ESAE+RRER+QQ+ E AK +AEEDDD F
Sbjct  449  HNQSVKAMRFPPKAYNKDLESAEERREREQQDLEYAKEMAEEDDDGF  495



>ref|NP_956866.1| 26S proteasome non-ATPase regulatory subunit 3 [Danio rerio]
 gb|AAH56598.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Danio 
rerio]
 gb|AAH66451.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Danio 
rerio]
Length=503

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 130/167 (78%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  339  GNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  398

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKET DIYST EPQ+AF+ RIAFCL++
Sbjct  399  SPE---DAEFIVAKAIRDGVIEASINHEKGFVQSKETMDIYSTREPQLAFHQRIAFCLDI  455

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP ++ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  456  HNMSVKAMRFPPKAYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  502



>ref|XP_001696175.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
 gb|EDP08152.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
Length=488

 Score =   172 bits (436),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 119/166 (72%), Gaps = 3/166 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GD+  F+QVAE+    F  D T+NLI RL HNVIR GLR I++AYSRISLA++A KL L+
Sbjct  326  GDMRAFKQVAERCHDVFLADATHNLITRLHHNVIRIGLRRINLAYSRISLAEIAAKLHLN  385

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            +A    DAE IV+KAIRDG IDA +D   G M S+E  D+YST EPQ AF++RIAFCL++
Sbjct  386  NAE---DAEYIVAKAIRDGGIDAVIDHDGGFMASRERPDVYSTAEPQAAFHARIAFCLDL  442

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HNEA++A+RF P++H+ K+   + R+ +   ++      EED+DDF
Sbjct  443  HNEAIKAMRFEPDAHRRKQETSEARQERLAAEQELAKALEEDEDDF  488



>ref|XP_010084066.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Pterocles gutturalis]
Length=320

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A KL+LD
Sbjct  156  GNLSKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAHKLQLD  215

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  216  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  272

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  273  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  319



>gb|EXX77249.1| proteasome regulatory particle lid subunit RPN3 [Rhizophagus 
irregularis DAOM 197198w]
Length=419

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL  F++   K+   F KD+T  LI+RLRHNVI+TG+R IS++YSRISL D+  KL LD
Sbjct  253  GDLSTFQETLAKYGDVFRKDKTFTLILRLRHNVIKTGIRMISLSYSRISLRDICLKLHLD  312

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG IDA +D   G M SKE  DIYSTNEPQ AFN+RI FCLN+
Sbjct  313  SEK---DAEYIVAKAIRDGVIDAIIDHEKGFMKSKENVDIYSTNEPQSAFNARITFCLNL  369

Query  325  HNEAVRALRFPPNSH  281
            HN++V+A+RFP N+H
Sbjct  370  HNDSVKAMRFPLNAH  384



>ref|XP_003222495.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Anolis 
carolinensis]
Length=523

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 130/167 (78%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++FS  F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  359  GNLAKFNQVLDQFSDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  418

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  419  SPE---DAEFIVAKAIRDGVIEASINHEKGYIQSKEMTDIYSTREPQLAFHQRISFCLDI  475

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  476  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  522



>ref|XP_001626069.1| predicted protein [Nematostella vectensis]
 gb|EDO33969.1| predicted protein [Nematostella vectensis]
Length=495

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 125/165 (76%), Gaps = 4/165 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL++F QV EKF   F +++T  +I+RLRHNVI+ G+R I+++YS+IS  D+A+KL+LD
Sbjct  332  GDLKVFNQVVEKFKERFLEEKTYTIIIRLRHNVIKAGVRMINLSYSKISFVDIAQKLQLD  391

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A++D   G + SKE  DIYSTNEPQ AF+ RI+FCL++
Sbjct  392  SPE---DAEFIVAKAIRDGVIEASIDHEKGTVQSKENVDIYSTNEPQGAFHQRISFCLDI  448

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqe-qELAKHIAEEDDD  194
            +N++V+A+RFPP S+ +   + + +  ++++  ELAK +AEEDDD
Sbjct  449  YNQSVKAMRFPPKSYSKNLESFEEQREREKQDMELAKEMAEEDDD  493



>emb|CEI90573.1| Putative Proteasome regulatory particle subunit [Rhizopus microsporus]
Length=212

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL  F++   ++ + F KD+T  LI+RLRHNVI+TG+R IS++YS+ISL D+  KL LD
Sbjct  9    GDLAKFQEGLGQYDAIFKKDKTYTLILRLRHNVIKTGIRMISLSYSKISLRDICIKLHLD  68

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IVSKAIRDG IDA+LD   G M SKE  DIY TNEPQ A++ RI FCLN+
Sbjct  69   SEE---DAEFIVSKAIRDGVIDASLDHARGFMKSKEIVDIYGTNEPQNAYHQRINFCLNL  125

Query  325  HNEAVRALRFPPNSH  281
            HNEAV+A+RFP ++H
Sbjct  126  HNEAVKAMRFPMDAH  140



>ref|XP_009333239.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Pygoscelis 
adeliae]
Length=396

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  232  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  291

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  292  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  348

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  349  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  395



>ref|XP_008688097.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Ursus maritimus]
Length=429

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  265  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  324

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  325  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  381

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  382  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  428



>ref|XP_010722887.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Meleagris 
gallopavo]
Length=396

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  232  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  291

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  292  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  348

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  349  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  395



>dbj|BAE01724.1| unnamed protein product [Macaca fascicularis]
Length=435

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  271  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  330

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  331  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  387

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  388  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  434



>ref|XP_011143024.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Harpegnathos saltator]
 gb|EFN82224.1| Probable 26S proteasome non-ATPase regulatory subunit 3 [Harpegnathos 
saltator]
Length=501

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F  D T  LI+RLRHNVI+T +R+I ++YSRIS AD+A+KL LD
Sbjct  337  GNLQRFGEVLENFGPQFRSDHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIARKLGLD  396

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S+    DAE IV+KAIRDG I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++
Sbjct  397  SS---VDAEFIVAKAIRDGVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDL  453

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  454  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGF  500



>ref|XP_004450126.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Dasypus 
novemcinctus]
Length=533

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV E+F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  369  GNLAKFNQVLEQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  428

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  429  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  485

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  486  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  532



>ref|XP_001605959.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nasonia vitripennis]
Length=497

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 127/167 (76%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F  D T  LI+RLRHNVI+T +R+I ++YSRIS AD+A+KL LD
Sbjct  333  GNLQRFGEVLENFGPQFRSDHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIARKLGLD  392

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++
Sbjct  393  SG---VDAEFIVAKAIRDGVIEATLDPENGYMRSKETTDIYCTREPLLAFHQRITFCLDL  449

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  450  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGF  496



>ref|XP_006214329.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Vicugna 
pacos]
Length=534

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV E+F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  370  GNLAKFNQVLEQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  429

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  430  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  486

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  487  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  533



>ref|XP_005029524.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Anas platyrhynchos]
Length=382

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  218  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  277

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  278  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  334

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  335  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  381



>ref|XP_011494959.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Ceratosolen solmsi marchali]
Length=499

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 127/167 (76%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F  D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AKKL LD
Sbjct  335  GNLQRFGEVLENFGPQFRSDHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIAKKLGLD  394

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++
Sbjct  395  SG---VDAEFIVAKAIRDGVIEATLDPENGYMRSKETTDIYCTREPLLAFHQRITFCLDL  451

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AEEDDD +
Sbjct  452  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGY  498



>ref|XP_004608798.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X2 [Sorex araneus]
Length=498

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  334  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  393

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  394  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDI  450

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  451  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  497



>ref|XP_008414675.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Poecilia 
reticulata]
Length=527

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV E+F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  363  GNLAKFNQVLEQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  422

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKET DIY T EPQ+AF+ RI+FCL++
Sbjct  423  SPE---DAEFIVAKAIRDGVIEASINHEKGFVQSKETMDIYGTREPQLAFHQRISFCLDI  479

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP ++ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  480  HNMSVKAMRFPPKAYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  526



>gb|EXX77250.1| proteasome regulatory particle lid subunit RPN3 [Rhizophagus 
irregularis DAOM 197198w]
Length=491

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL  F++   K+   F KD+T  LI+RLRHNVI+TG+R IS++YSRISL D+  KL LD
Sbjct  325  GDLSTFQETLAKYGDVFRKDKTFTLILRLRHNVIKTGIRMISLSYSRISLRDICLKLHLD  384

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG IDA +D   G M SKE  DIYSTNEPQ AFN+RI FCLN+
Sbjct  385  SEK---DAEYIVAKAIRDGVIDAIIDHEKGFMKSKENVDIYSTNEPQSAFNARITFCLNL  441

Query  325  HNEAVRALRFPPNSH  281
            HN++V+A+RFP N+H
Sbjct  442  HNDSVKAMRFPLNAH  456



>gb|EOA94377.1| 26S proteasome non-ATPase regulatory subunit 3, partial [Anas 
platyrhynchos]
Length=391

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  227  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  286

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  287  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  343

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  344  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  390



>ref|XP_009477980.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Pelecanus crispus]
Length=437

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  273  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  332

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  333  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  389

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  390  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  436



>ref|XP_008293025.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Stegastes 
partitus]
Length=518

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV E+F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  354  GNLAKFNQVLEQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  413

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKET DIY T EPQ+AF+ RI+FCL++
Sbjct  414  SPE---DAEFIVAKAIRDGVIEASINHEKGFVQSKETMDIYGTREPQLAFHQRISFCLDI  470

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP ++ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  471  HNMSVKAMRFPPKAYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  517



>ref|XP_319831.2| AGAP009082-PA [Anopheles gambiae str. PEST]
 sp|O61470.2|PSMD3_ANOGA RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Diphenol 
oxidase A2 component; Short=DOX-A2 [Anopheles gambiae]
 gb|EAA14736.2| AGAP009082-PA [Anopheles gambiae str. PEST]
Length=496

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 123/167 (74%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V   F   F +D T  LI+RLRHNVI+T +R+I +AYSRIS  D+A+KL LD
Sbjct  333  GNLQRFGEVLVNFGEQFRQDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLD  392

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD   G M SKE+ DIYST EPQ+AF+ RI+FCL++
Sbjct  393  SPE---DAEFIVAKAIRDGVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRISFCLDL  449

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqe-qELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ ++  + + R  ++Q+  ELAK +AEEDDD F
Sbjct  450  HNQSVKAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDDDGF  496



>ref|XP_003442595.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3-like 
[Oreochromis niloticus]
Length=522

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV E+F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  358  GNLAKFNQVLEQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  417

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKET DIY T EPQ+AF+ RI+FCL++
Sbjct  418  SPE---DAEFIVAKAIRDGVIEASINHEKGFVQSKETMDIYGTREPQLAFHQRISFCLDI  474

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP ++ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  475  HNMSVKAMRFPPKAYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  521



>ref|XP_008988616.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Callithrix 
jacchus]
Length=534

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F  TF  D T  LI++LRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  370  GNLAKFHQVLDQFGETFQADGTYTLIIQLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  429

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  430  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  486

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+ RER+QQ+ E AK +AE+DDD F
Sbjct  487  HNMSVKAMRFPPKSYNKDLESAEELREREQQDLEFAKEMAEDDDDSF  533



>ref|XP_623947.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Apis mellifera]
 ref|XP_006572172.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Apis mellifera]
Length=495

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F  D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AKKL LD
Sbjct  331  GNLQRFGEVLENFGPQFRADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIAKKLGLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S+    DAE IV+KAIRDG I+ATL+  NG M SKET DIY T EP +AF+ RI FCL++
Sbjct  391  SS---VDAEFIVAKAIRDGVIEATLEPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDL  447

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  448  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGF  494



>ref|XP_003705277.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Megachile rotundata]
Length=496

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F  D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AKKL LD
Sbjct  332  GNLQRFGEVLENFGPQFRADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIAKKLGLD  391

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S+    DAE IV+KAIRDG I+ATL+  NG M SKET DIY T EP +AF+ RI FCL++
Sbjct  392  SS---VDAEFIVAKAIRDGVIEATLEPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDL  448

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  449  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGF  495



>gb|AFM88771.1| 26S proteasome non-ATPase regulatory subunit 3-like protein [Callorhinchus 
milii]
Length=522

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV E+F   F  D T  LI+RLRHNVI+TG+R IS++YSRI+L D+A+KL+LD
Sbjct  358  GNLSKFNQVLEQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRIALTDIAQKLQLD  417

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A++D   G + SKET DIY T EPQ+AF+ RI+FCL++
Sbjct  418  SPE---DAEFIVAKAIRDGVIEASIDHERGYVQSKETIDIYGTREPQLAFHQRISFCLDI  474

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  475  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  521



>ref|XP_005368329.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Microtus 
ochrogaster]
Length=530

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  366  GNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  425

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  426  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDI  482

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  483  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  529



>ref|XP_003689802.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Apis florea]
Length=495

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F  D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AKKL LD
Sbjct  331  GNLQRFGEVLENFGPQFRADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIAKKLGLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S+    DAE IV+KAIRDG I+ATL+  NG M SKET DIY T EP +AF+ RI FCL++
Sbjct  391  SS---VDAEFIVAKAIRDGVIEATLEPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDL  447

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  448  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGF  494



>ref|XP_001662261.1| AAEL012122-PA [Aedes aegypti]
 gb|EAT35739.1| AAEL012122-PA [Aedes aegypti]
Length=493

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 123/167 (74%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F +D T  LI+RLRHNVI+T +R+I ++YSRIS  D+A+KL LD
Sbjct  330  GNLQRFGEVLENFGDQFRQDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDIARKLGLD  389

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD   G M SKE+ DIYST EPQ+AF+ RI FCL++
Sbjct  390  SHE---DAEFIVAKAIRDGVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRITFCLDL  446

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqe-qELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ ++  + + R  ++Q+  ELAK +AEEDDD +
Sbjct  447  HNQSVKAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDDDGY  493



>ref|XP_005753080.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3-like 
[Pundamilia nyererei]
Length=522

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV E+F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  358  GNLAKFNQVLEQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  417

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKET DIY T EPQ+AF+ RI+FCL++
Sbjct  418  SPE---DAEFIVAKAIRDGVIEASINHEKGFVQSKETMDIYGTREPQLAFHQRISFCLDI  474

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP ++ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  475  HNMSVKAMRFPPKAYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  521



>ref|XP_011235692.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Ailuropoda melanoleuca]
Length=476

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  312  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  371

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  372  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  428

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  429  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  475



>ref|XP_006608624.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Apis dorsata]
Length=495

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F  D T  LI+RLRHNVI+T +R+I ++YSRIS AD+AKKL LD
Sbjct  331  GNLQRFGEVLENFGPQFRADHTFTLILRLRHNVIKTAIRSIGLSYSRISPADIAKKLGLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S+    DAE IV+KAIRDG I+ATL+  NG M SKET DIY T EP +AF+ RI FCL++
Sbjct  391  SS---VDAEFIVAKAIRDGVIEATLEPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDL  447

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  448  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGF  494



>ref|XP_009874430.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Apaloderma vittatum]
Length=456

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  292  GNLSKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  351

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  352  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  408

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  409  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  455



>ref|XP_008328616.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Cynoglossus 
semilaevis]
Length=520

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV E+F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  356  GNLANFNQVLEQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  415

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKET DIY T EPQ+AF+ RI+FCL++
Sbjct  416  SPE---DAEFIVAKAIRDGVIEASINHEKGFVQSKETMDIYGTREPQLAFHQRISFCLDI  472

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP ++ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  473  HNMSVKAMRFPPKAYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  519



>ref|XP_005321856.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Ictidomys 
tridecemlineatus]
Length=534

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  370  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  429

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  430  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDI  486

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  487  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  533



>ref|XP_005999586.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Latimeria 
chalumnae]
Length=524

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 130/167 (78%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  360  GNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  419

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKET DIY+T EPQ+AF+ RI+FCL++
Sbjct  420  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKETIDIYTTREPQLAFHQRISFCLDI  476

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  477  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  523



>ref|XP_005394396.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Chinchilla 
lanigera]
Length=533

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  369  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  428

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  429  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDI  485

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  486  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  532



>ref|XP_006638287.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3-like 
[Lepisosteus oculatus]
Length=514

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV E+F   F  D T  LI+RLRHNVI+TG+R IS++YSRISL+D+A+KL+LD
Sbjct  350  GNLAKFNQVLEQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLSDIAQKLQLD  409

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKET DIY T EPQ+AF+ RI+FCL++
Sbjct  410  SPE---DAEFIVAKAIRDGVIEASINHDKGYVQSKETIDIYGTREPQLAFHQRISFCLDI  466

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  467  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  513



>ref|XP_004591217.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Ochotona 
princeps]
Length=531

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  367  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  426

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  427  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDI  483

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  484  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  530



>ref|XP_009988054.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Tauraco erythrolophus]
Length=397

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  233  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  292

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKET DIYST EPQ+AF+ RI+FCL++
Sbjct  293  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKETIDIYSTREPQLAFHQRISFCLDI  349

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+  RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  350  HNMSVKVXRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  396



>ref|XP_001846487.1| 26S proteasome non-ATPase regulatory subunit 3 [Culex quinquefasciatus]
 gb|EDS43779.1| 26S proteasome non-ATPase regulatory subunit 3 [Culex quinquefasciatus]
Length=493

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 123/167 (74%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F  D T  LI+RLRHNVI+T +R+I ++YSRIS  D+A+KL LD
Sbjct  330  GNLQRFGEVLENFGDQFRLDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPKDIARKLGLD  389

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD   G M SKE+ DIYST EPQ+AF+ RI+FCL++
Sbjct  390  SHE---DAEFIVAKAIRDGVIEATLDPEKGYMRSKESTDIYSTREPQLAFHQRISFCLDL  446

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqe-qELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ ++  + + R  ++Q+  ELAK +AEEDDD F
Sbjct  447  HNQSVKAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDDDGF  493



>ref|XP_004608797.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X1 [Sorex araneus]
Length=536

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  372  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  431

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  432  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDI  488

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  489  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  535



>ref|XP_007062032.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Chelonia 
mydas]
Length=408

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 130/167 (78%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F+  F  D T  LI+RLRHNVI+TG+R IS++YSRI+LAD+A+KL+LD
Sbjct  244  GNLAKFNQVLDQFADKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRIALADIAQKLQLD  303

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  304  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  360

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  361  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  407



>ref|XP_007940247.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X3 [Orycteropus afer afer]
Length=495

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  331  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  391  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  447

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  448  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  494



>ref|XP_007420739.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Python 
bivittatus]
Length=521

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  357  GNLAKFNQVLDQFGDKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  416

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  417  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDI  473

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  474  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  520



>ref|XP_010840930.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Bison 
bison bison]
Length=498

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  334  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  393

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  394  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  450

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  451  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  497



>gb|EPB85306.1| hypothetical protein HMPREF1544_07920 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=498

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL  F++   +F + F KD+T  LI+RLRHNVI+TG+R IS++YS+ISL D+  KL LD
Sbjct  332  GDLNKFQEGLAQFDAVFKKDKTYTLILRLRHNVIKTGIRMISLSYSKISLRDICIKLHLD  391

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG IDATLD + G M SKE  DIYSTNEPQ A++ RI FCLN+
Sbjct  392  SEE---DAEFIVAKAIRDGVIDATLDHSGGFMKSKEIADIYSTNEPQNAYHQRINFCLNL  448

Query  325  HNEAVRALRFPPNSH  281
            HNEA++A+RFP ++H
Sbjct  449  HNEAIKAMRFPMDAH  463



>ref|XP_009578233.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Fulmarus glacialis]
Length=460

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  296  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  355

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  356  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  412

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  413  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  459



>ref|XP_009883974.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Charadrius 
vociferus]
Length=464

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  300  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  359

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  360  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  416

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  417  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  463



>dbj|BAG51399.1| unnamed protein product [Homo sapiens]
Length=498

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  334  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  393

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  394  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  450

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  451  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  497



>ref|XP_006176397.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Camelus 
ferus]
Length=498

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  334  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  393

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  394  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  450

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  451  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  497



>ref|XP_010308532.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Balearica regulorum gibbericeps]
Length=460

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  296  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  355

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  356  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  412

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  413  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  459



>ref|XP_010206163.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Colius striatus]
Length=460

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  296  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  355

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  356  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  412

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  413  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  459



>gb|AAC18058.1| diphenol oxidase-A2 [Anopheles gambiae]
Length=496

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 123/167 (74%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V   F   F +D T  LI+RLRHNVI+T +R+I +AYSRIS  D+A+KL LD
Sbjct  333  GNLQRFGEVLVNFGEQFRQDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDIARKLGLD  392

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD   G M +KE+ DIYST EPQ+AF+ RI+FCL++
Sbjct  393  SPE---DAEFIVAKAIRDGVIEATLDPEKGYMRTKESTDIYSTREPQLAFHQRISFCLDL  449

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqe-qELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ ++  + + R  ++Q+  ELAK +AEEDDD F
Sbjct  450  HNQSVKAMRYPPKSYGKELESAEERREREQQDLELAKEMAEEDDDGF  496



>ref|XP_010295693.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3, partial 
[Phaethon lepturus]
Length=460

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  296  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  355

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  356  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  412

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  413  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  459



>ref|XP_003278356.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Nomascus 
leucogenys]
Length=499

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  335  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  394

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  395  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  451

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  452  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  498



>ref|XP_007618536.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X3 [Cricetulus griseus]
Length=540

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  376  GNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  435

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  436  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMTDIYSTREPQLAFHQRISFCLDI  492

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  493  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  539



>ref|XP_009569021.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Cuculus 
canorus]
Length=465

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  301  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  360

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  361  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  417

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  418  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  464



>gb|EMC77897.1| 26S proteasome non-ATPase regulatory subunit 3, partial [Columba 
livia]
Length=461

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  297  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  356

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  357  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  413

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  414  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  460



>ref|XP_006889464.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X3 [Elephantulus edwardii]
Length=516

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  352  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  411

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  412  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  468

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  469  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  515



>dbj|BAB71019.1| unnamed protein product [Homo sapiens]
Length=517

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  353  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  412

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  413  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  469

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  470  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  516



>ref|XP_009640850.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Egretta 
garzetta]
Length=465

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  301  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  360

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  361  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  417

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  418  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  464



>dbj|BAG60639.1| unnamed protein product [Homo sapiens]
Length=511

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  347  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  406

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  407  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  463

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  464  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  510



>dbj|BAC04310.1| unnamed protein product [Homo sapiens]
Length=521

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  357  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  416

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  417  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  473

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  474  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  520



>ref|XP_005232750.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Falco 
peregrinus]
Length=464

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  300  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  359

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  360  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  416

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  417  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  463



>gb|AJK90582.1| 26S proteasome non-ATPase regulatory subunit 3 [Laodelphax striatella]
Length=498

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL+ F +V E F   F  D T  LI+RLRHNVI+T +R+I ++YSRI+ A++AKKL LD
Sbjct  334  GDLQRFGEVLENFGPQFRSDHTFTLILRLRHNVIKTAIRSIGLSYSRITPANIAKKLGLD  393

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD   G + SKE+ DIY T EPQ+AF+ RI+FCL++
Sbjct  394  SPE---DAEFIVAKAIRDGVIEATLDPEKGYVQSKESTDIYCTREPQLAFHQRISFCLDL  450

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AEEDDD F
Sbjct  451  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDDGF  497



>ref|XP_007940246.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
X2 [Orycteropus afer afer]
Length=517

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  353  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  412

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  413  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  469

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  470  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  516



>dbj|GAN08202.1| 26S proteasome non-ATPase regulatory subunit 3 [Mucor ambiguus]
Length=497

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL  F++   +F + F KD+T  LI+RLRHNVI+TG+R IS++YS+ISL D+  KL LD
Sbjct  331  GDLNKFQEGLAQFDAVFKKDKTYTLILRLRHNVIKTGIRMISLSYSKISLRDICIKLHLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG IDATLD + G M SKE  DIYSTNEPQ A++ RI FCLN+
Sbjct  391  SEE---DAEFIVAKAIRDGVIDATLDHSGGFMKSKEIADIYSTNEPQNAYHQRINFCLNL  447

Query  325  HNEAVRALRFPPNSH  281
            HNEA++A+RFP ++H
Sbjct  448  HNEAIKAMRFPMDAH  462



>ref|XP_009463186.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Nipponia 
nippon]
Length=466

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  302  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  361

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  362  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  418

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  419  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  465



>ref|XP_011056581.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Acromyrmex echinatior]
 gb|EGI64232.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Acromyrmex 
echinatior]
Length=491

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 118/166 (71%), Gaps = 7/166 (4%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L+ F +V E F   F  D T  LI+RLRHNVI+T +R+I ++YSRIS  D+A+KL LD
Sbjct  332  GNLQRFGEVLENFGPQFRADHTFTLILRLRHNVIKTAIRSIGLSYSRISPTDIARKLGLD  391

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S+    DAE IV+KAIRDG I+ATLD  NG M SKET DIY T EP +AF+ RI FCL++
Sbjct  392  SS---VDAEFIVAKAIRDGVIEATLDPENGYMRSKETTDIYCTKEPLLAFHQRITFCLDL  448

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN++V+A+R+PP S+      +     +QQ+ ELAK +AEEDDD F
Sbjct  449  HNQSVKAMRYPPKSY----GKDLESAAEQQDLELAKEMAEEDDDGF  490



>ref|XP_971686.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Tribolium castaneum]
 gb|EFA04054.1| hypothetical protein TcasGA2_TC014286 [Tribolium castaneum]
Length=495

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 122/167 (73%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F +V E F   F +D T  LI+RLRHNVI+T +R I ++YSRIS  D+AKKL LD
Sbjct  331  GNLHRFGEVLENFGPQFRQDHTFTLILRLRHNVIKTAIRAIGLSYSRISPQDIAKKLGLD  390

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            SA    DAE IV+KAIRDG I+ATLD   G M SKE+ DIY T EPQ+AF+ RI+FCL++
Sbjct  391  SAE---DAEFIVAKAIRDGVIEATLDPEGGYMRSKESTDIYCTKEPQLAFHQRISFCLDL  447

Query  325  HNEAVRALRFPPNSHkekesaekrrerqqqe-qELAKHIAEEDDDDF  188
            HN++V+A+R+PP ++ ++  + + R  ++Q+  ELAK +AEEDDD F
Sbjct  448  HNQSVKAMRYPPKAYGKELESAEERREREQQDLELAKEMAEEDDDGF  494



>ref|XP_002424930.1| 26S proteasome regulatory subunit S3, putative [Pediculus humanus 
corporis]
 gb|EEB12192.1| 26S proteasome regulatory subunit S3, putative [Pediculus humanus 
corporis]
Length=505

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 125/165 (76%), Gaps = 4/165 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            GDL  F +V E F   F  D T+ LI RLRHNVI+T +R+I ++Y RIS AD+AKKL LD
Sbjct  342  GDLHHFSEVLENFKPQFEADHTSTLIHRLRHNVIKTAIRSIGLSYVRISPADIAKKLGLD  401

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+ATLD   G M SKET DIY T EPQ+AF+ RI+FCL++
Sbjct  402  SPE---DAEFIVAKAIRDGVIEATLDPETGTMRSKETCDIYCTREPQLAFHQRISFCLDL  458

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDD  194
            HN++V+A+R+PP S+ +  ESAE+RRER+QQ+ ELAK +AEEDDD
Sbjct  459  HNQSVKAMRYPPKSYGKDLESAEERREREQQDLELAKEMAEEDDD  503



>ref|XP_004378111.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 isoform 
2 [Trichechus manatus latirostris]
Length=517

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  353  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  412

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  413  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  469

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  470  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  516



>ref|XP_010007099.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Chaetura 
pelagica]
Length=476

 Score =   169 bits (428),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  312  GNLAKFNQVLDQFGDKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  371

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  372  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  428

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  429  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDGF  475



>ref|XP_008827637.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Nannospalax 
galili]
Length=531

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  367  GNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  426

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  427  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  483

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  484  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  530



>ref|XP_004282791.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Orcinus 
orca]
 ref|XP_007465242.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Lipotes 
vexillifer]
Length=534

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  370  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  429

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  430  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  486

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  487  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  533



>emb|CAG33053.1| PSMD3 [Homo sapiens]
Length=534

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  370  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  429

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  430  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  486

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  487  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  533



>ref|XP_005898084.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Bos 
mutus]
Length=534

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  370  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  429

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  430  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  486

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  487  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  533



>gb|AAP36540.1| Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 
3 [synthetic construct]
 gb|AAX43562.1| proteasome 26S subunit 3, partial [synthetic construct]
Length=535

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  370  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  429

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  430  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  486

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  487  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  533



>ref|XP_004764682.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Mustela 
putorius furo]
 ref|XP_004799117.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 [Mustela 
putorius furo]
Length=536

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  372  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  431

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  432  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  488

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  489  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  535



>ref|NP_002800.2| 26S proteasome non-ATPase regulatory subunit 3 [Homo sapiens]
 sp|O43242.2|PSMD3_HUMAN RecName: Full=26S proteasome non-ATPase regulatory subunit 3; 
AltName: Full=26S proteasome regulatory subunit RPN3; AltName: 
Full=26S proteasome regulatory subunit S3; AltName: Full=Proteasome 
subunit p58 [Homo sapiens]
 gb|AAH00074.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Homo 
sapiens]
 gb|AAH04859.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Homo 
sapiens]
 gb|AAH20518.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Homo 
sapiens]
 gb|AAH25686.1| Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Homo 
sapiens]
 gb|AAP35881.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Homo 
sapiens]
 gb|AAX31842.1| proteasome [synthetic construct]
 gb|AAX41992.1| proteasome 26S subunit 3 [synthetic construct]
 gb|EAW60625.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [Homo 
sapiens]
 dbj|BAG10925.1| 26S proteasome non-ATPase regulatory subunit 3 [synthetic construct]
 dbj|BAG51131.1| unnamed protein product [Homo sapiens]
 gb|ADZ15576.1| proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 [synthetic 
construct]
 gb|AIC49512.1| PSMD3, partial [synthetic construct]
 gb|AIC54980.1| PSMD3, partial [synthetic construct]
Length=534

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 129/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  685  GDLELFRQVAEKFSSTFSKDRTNNLIVRLRHNVIRTGLRNISIAYSRISLADVAKKLRLD  506
            G+L  F QV ++F   F  D T  LI+RLRHNVI+TG+R IS++YSRISLAD+A+KL+LD
Sbjct  370  GNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLD  429

Query  505  SANPIADAESIVSKAIRDGAIDATLDRTNGCMVSKETGDIYSTNEPQIAFNSRIAFCLNM  326
            S     DAE IV+KAIRDG I+A+++   G + SKE  DIYST EPQ+AF+ RI+FCL++
Sbjct  430  SPE---DAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDI  486

Query  325  HNEAVRALRFPPNSHke-kesaekrrerqqqeqELAKHIAEEDDDDF  188
            HN +V+A+RFPP S+ +  ESAE+RRER+QQ+ E AK +AE+DDD F
Sbjct  487  HNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSF  533



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880