BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF018E11

Length=796
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO42760.1|  hypothetical protein CISIN_1g014592mg                   307   5e-99   Citrus sinensis [apfelsine]
gb|KDO42759.1|  hypothetical protein CISIN_1g014592mg                   307   9e-99   Citrus sinensis [apfelsine]
ref|XP_006441587.1|  hypothetical protein CICLE_v10020303mg             307   1e-98   Citrus clementina [clementine]
ref|XP_007041181.1|  Elongation factor 1-gamma 3 isoform 1              305   9e-98   Theobroma cacao [chocolate]
ref|XP_010686883.1|  PREDICTED: elongation factor 1-gamma-like          304   2e-97   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010683294.1|  PREDICTED: elongation factor 1-gamma 2-like        303   3e-97   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH34076.1|  translation elongation factor EF1B, gamma chain         303   5e-97   Medicago truncatula
ref|XP_010030200.1|  PREDICTED: elongation factor 1-gamma               302   6e-97   Eucalyptus grandis [rose gum]
ref|XP_004485430.1|  PREDICTED: elongation factor 1-gamma-like is...    302   7e-97   Cicer arietinum [garbanzo]
ref|XP_002264400.1|  PREDICTED: elongation factor 1-gamma-like          302   1e-96   Vitis vinifera
ref|XP_006478210.1|  PREDICTED: elongation factor 1-gamma-like          301   1e-96   Citrus sinensis [apfelsine]
gb|ACU24330.1|  unknown                                                 296   1e-96   Glycine max [soybeans]
ref|XP_003592902.1|  Elongation factor 1-gamma                          301   2e-96   
ref|XP_003592901.1|  Elongation factor 1-gamma                          301   2e-96   Medicago truncatula
ref|XP_009610260.1|  PREDICTED: elongation factor 1-gamma 2-like ...    301   2e-96   Nicotiana tomentosiformis
ref|XP_009774942.1|  PREDICTED: elongation factor 1-gamma 2-like ...    301   3e-96   Nicotiana sylvestris
ref|XP_009774948.1|  PREDICTED: elongation factor 1-gamma 2-like ...    301   3e-96   Nicotiana sylvestris
ref|XP_010553691.1|  PREDICTED: probable elongation factor 1-gamma 2    300   3e-96   Tarenaya hassleriana [spider flower]
ref|XP_009610261.1|  PREDICTED: elongation factor 1-gamma 2-like ...    301   3e-96   Nicotiana tomentosiformis
ref|XP_007222556.1|  hypothetical protein PRUPE_ppa006233mg             300   4e-96   
ref|XP_011047878.1|  PREDICTED: elongation factor 1-gamma               300   5e-96   Populus euphratica
ref|XP_010544111.1|  PREDICTED: probable elongation factor 1-gamma 2    300   5e-96   Tarenaya hassleriana [spider flower]
dbj|BAP19108.1|  elongation factor 1 gamma-like protein                 291   6e-96   Ipomoea nil [qian niu]
ref|XP_002526432.1|  elongation factor 1 gamma, putative                296   6e-96   Ricinus communis
ref|XP_008219063.1|  PREDICTED: elongation factor 1-gamma-like          300   7e-96   Prunus mume [ume]
ref|XP_007148576.1|  hypothetical protein PHAVU_006G220100g             300   7e-96   Phaseolus vulgaris [French bean]
gb|AFK34308.1|  unknown                                                 300   8e-96   Medicago truncatula
ref|XP_007153909.1|  hypothetical protein PHAVU_003G075200g             300   8e-96   Phaseolus vulgaris [French bean]
emb|CAN75785.1|  hypothetical protein VITISV_021574                     300   8e-96   Vitis vinifera
gb|ACB72462.1|  elongation factor 1 gamma-like protein                  299   9e-96   Nicotiana tabacum [American tobacco]
emb|CDP10743.1|  unnamed protein product                                300   9e-96   Coffea canephora [robusta coffee]
gb|ADB11388.1|  gamma class glutathione transferase EF1Bgamma3          300   9e-96   Populus trichocarpa [western balsam poplar]
ref|XP_006600242.1|  PREDICTED: elongation factor 1-gamma isoform X1    299   1e-95   
ref|XP_009759974.1|  PREDICTED: elongation factor 1-gamma 2-like ...    299   1e-95   Nicotiana sylvestris
ref|XP_009759973.1|  PREDICTED: elongation factor 1-gamma 2-like ...    299   1e-95   Nicotiana sylvestris
ref|XP_010272551.1|  PREDICTED: elongation factor 1-gamma-like is...    299   1e-95   Nelumbo nucifera [Indian lotus]
gb|ACA50518.1|  elongation factor 1-gamma                               298   2e-95   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647077.1|  PREDICTED: elongation factor 1-gamma 2-like        298   2e-95   Oryza brachyantha
ref|XP_010272550.1|  PREDICTED: elongation factor 1-gamma-like is...    300   3e-95   Nelumbo nucifera [Indian lotus]
gb|AHZ94964.1|  elongation factor 1                                     298   3e-95   Lilium regale
ref|NP_001046318.1|  Os02g0220600                                       298   3e-95   
gb|KEH32762.1|  translation elongation factor EF1B, gamma chain         298   4e-95   Medicago truncatula
gb|KJB47884.1|  hypothetical protein B456_008G046300                    292   4e-95   Gossypium raimondii
ref|XP_004155227.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    297   4e-95   
gb|ABA81876.1|  unknown                                                 297   5e-95   Solanum tuberosum [potatoes]
gb|KEH32761.1|  translation elongation factor EF1B, gamma chain         296   5e-95   Medicago truncatula
ref|NP_001046317.1|  Os02g0220500                                       297   5e-95   
sp|Q6YW46.2|EF1G2_ORYSJ  RecName: Full=Elongation factor 1-gamma ...    297   6e-95   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008452240.1|  PREDICTED: elongation factor 1-gamma-like          297   6e-95   Cucumis melo [Oriental melon]
ref|XP_008456982.1|  PREDICTED: elongation factor 1-gamma-like          297   6e-95   Cucumis melo [Oriental melon]
ref|XP_010242290.1|  PREDICTED: elongation factor 1-gamma-like          297   6e-95   Nelumbo nucifera [Indian lotus]
ref|XP_008452241.1|  PREDICTED: elongation factor 1-gamma-like          297   7e-95   Cucumis melo [Oriental melon]
gb|KHN03584.1|  Elongation factor 1-gamma                               297   7e-95   Glycine soja [wild soybean]
gb|AAO72574.1|  elongation factor 1 gamma-like protein                  297   7e-95   Oryza sativa Japonica Group [Japonica rice]
gb|EEE56572.1|  hypothetical protein OsJ_05923                          299   8e-95   Oryza sativa Japonica Group [Japonica rice]
gb|KJB47885.1|  hypothetical protein B456_008G046300                    293   9e-95   Gossypium raimondii
gb|EEC72757.1|  hypothetical protein OsI_06402                          299   9e-95   Oryza sativa Indica Group [Indian rice]
ref|XP_010928857.1|  PREDICTED: elongation factor 1-gamma 2             297   1e-94   Elaeis guineensis
gb|KJB47897.1|  hypothetical protein B456_008G046200                    296   1e-94   Gossypium raimondii
ref|NP_001274793.1|  elongation factor 1-gamma 2-like                   296   1e-94   Solanum tuberosum [potatoes]
ref|XP_008378997.1|  PREDICTED: elongation factor 1-gamma               287   1e-94   
gb|AIZ68134.1|  translation elongation factor 1-gamma                   296   1e-94   Ornithogalum longebracteatum [sea-onion]
ref|XP_006385057.1|  elongation factor 1-gamma 1 family protein         296   2e-94   Populus trichocarpa [western balsam poplar]
ref|XP_008789740.1|  PREDICTED: elongation factor 1-gamma 1 isofo...    295   2e-94   
ref|XP_004133719.1|  PREDICTED: elongation factor 1-gamma-like          296   2e-94   
ref|XP_006389499.1|  elongation factor 1-gamma 1 family protein         296   2e-94   
ref|XP_006339362.1|  PREDICTED: elongation factor 1-gamma 2-like ...    296   2e-94   Solanum tuberosum [potatoes]
ref|XP_008789739.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    296   2e-94   Phoenix dactylifera
ref|XP_006339363.1|  PREDICTED: elongation factor 1-gamma 2-like ...    296   2e-94   Solanum tuberosum [potatoes]
ref|XP_011028370.1|  PREDICTED: elongation factor 1-gamma 2-like        296   2e-94   Populus euphratica
gb|ADR70876.1|  eukaryotic translation elongation factor 1B gamma...    296   2e-94   Hevea brasiliensis [jebe]
gb|KHG12420.1|  hypothetical protein F383_17048                         296   2e-94   Gossypium arboreum [tree cotton]
gb|KJB47883.1|  hypothetical protein B456_008G046300                    296   2e-94   Gossypium raimondii
ref|NP_001242737.1|  uncharacterized protein LOC100810452               296   2e-94   
gb|KHN40193.1|  Elongation factor 1-gamma                               296   2e-94   Glycine soja [wild soybean]
ref|XP_011074970.1|  PREDICTED: elongation factor 1-gamma-like          296   3e-94   Sesamum indicum [beniseed]
gb|KHG04277.1|  hypothetical protein F383_29497                         296   3e-94   Gossypium arboreum [tree cotton]
ref|XP_010907209.1|  PREDICTED: elongation factor 1-gamma 2-like        295   3e-94   Elaeis guineensis
ref|XP_011031541.1|  PREDICTED: elongation factor 1-gamma-like          296   3e-94   Populus euphratica
ref|XP_002325529.1|  hypothetical protein POPTR_0019s10560g             296   3e-94   Populus trichocarpa [western balsam poplar]
emb|CBI29690.3|  unnamed protein product                                296   4e-94   Vitis vinifera
ref|XP_004966044.1|  PREDICTED: elongation factor 1-gamma 3-like        295   4e-94   Setaria italica
gb|KHN39680.1|  Elongation factor 1-gamma                               292   4e-94   Glycine soja [wild soybean]
ref|XP_004966045.1|  PREDICTED: elongation factor 1-gamma 3-like        295   5e-94   Setaria italica
ref|XP_004240589.1|  PREDICTED: elongation factor 1-gamma 2-like        295   5e-94   Solanum lycopersicum
ref|XP_002278756.2|  PREDICTED: elongation factor 1-gamma               295   6e-94   Vitis vinifera
ref|NP_001131533.1|  uncharacterized protein LOC100192872               291   6e-94   
ref|NP_001241223.1|  uncharacterized protein LOC100787125               295   6e-94   Glycine max [soybeans]
gb|EYU22759.1|  hypothetical protein MIMGU_mgv1a007114mg                295   7e-94   Erythranthe guttata [common monkey flower]
ref|XP_008677347.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    294   8e-94   
gb|KDO40980.1|  hypothetical protein CISIN_1g021153mg                   290   8e-94   Citrus sinensis [apfelsine]
ref|XP_004951452.1|  PREDICTED: elongation factor 1-gamma 2-like        294   8e-94   Setaria italica
ref|XP_004250642.1|  PREDICTED: elongation factor 1-gamma 2-like ...    294   9e-94   Solanum lycopersicum
ref|XP_004250641.1|  PREDICTED: elongation factor 1-gamma 2-like ...    294   9e-94   Solanum lycopersicum
ref|XP_006392372.1|  hypothetical protein EUTSA_v10023493mg             292   1e-93   
ref|XP_004294500.1|  PREDICTED: elongation factor 1-gamma-like          294   1e-93   Fragaria vesca subsp. vesca
gb|ACJ85171.1|  unknown                                                 294   1e-93   Medicago truncatula
gb|AFW71312.1|  hypothetical protein ZEAMMB73_547198                    290   2e-93   
ref|XP_002451782.1|  hypothetical protein SORBIDRAFT_04g007760          293   2e-93   Sorghum bicolor [broomcorn]
ref|XP_006392370.1|  hypothetical protein EUTSA_v10023493mg             293   2e-93   Eutrema salsugineum [saltwater cress]
gb|KDO40983.1|  hypothetical protein CISIN_1g021153mg                   288   3e-93   Citrus sinensis [apfelsine]
gb|KDO40981.1|  hypothetical protein CISIN_1g021153mg                   289   3e-93   Citrus sinensis [apfelsine]
ref|XP_003540135.1|  PREDICTED: elongation factor 1-gamma-like          293   3e-93   
ref|XP_008643919.1|  PREDICTED: uncharacterized protein LOC100381...    293   4e-93   
gb|KDP42461.1|  hypothetical protein JCGZ_00258                         293   4e-93   Jatropha curcas
gb|AFW76477.1|  elongation factor gamma1                                288   4e-93   
ref|XP_008352808.1|  PREDICTED: elongation factor 1-gamma-like          293   4e-93   
ref|XP_008804357.1|  PREDICTED: elongation factor 1-gamma 2-like        294   4e-93   Phoenix dactylifera
ref|XP_002438602.1|  hypothetical protein SORBIDRAFT_10g022570          292   5e-93   Sorghum bicolor [broomcorn]
gb|AFW87006.1|  hypothetical protein ZEAMMB73_710904                    291   5e-93   
ref|XP_010101278.1|  Elongation factor 1-gamma                          293   6e-93   
ref|XP_009417204.1|  PREDICTED: elongation factor 1-gamma 2-like        292   6e-93   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW76480.1|  elongation factor gamma1                                291   7e-93   
ref|NP_001148829.1|  elongation factor 1-gamma 3                        292   8e-93   Zea mays [maize]
ref|XP_009353791.1|  PREDICTED: elongation factor 1-gamma               292   8e-93   Pyrus x bretschneideri [bai li]
ref|NP_001151229.1|  elongation factor 1-gamma 2                        291   8e-93   Zea mays [maize]
ref|XP_009362385.1|  PREDICTED: elongation factor 1-gamma-like          292   8e-93   Pyrus x bretschneideri [bai li]
ref|XP_008647353.1|  PREDICTED: uncharacterized protein LOC100192...    291   9e-93   
ref|XP_009355338.1|  PREDICTED: elongation factor 1-gamma               292   9e-93   Pyrus x bretschneideri [bai li]
ref|XP_006431568.1|  hypothetical protein CICLE_v10003566mg             291   1e-92   Citrus clementina [clementine]
emb|CDY22629.1|  BnaC08g42630D                                          291   2e-92   Brassica napus [oilseed rape]
ref|XP_009110814.1|  PREDICTED: probable elongation factor 1-gamma 1    291   2e-92   Brassica rapa
emb|CDY31074.1|  BnaA08g26240D                                          291   2e-92   Brassica napus [oilseed rape]
emb|CDX93494.1|  BnaA06g05540D                                          291   2e-92   
gb|ACU24584.1|  unknown                                                 291   2e-92   Glycine max [soybeans]
ref|XP_006494223.1|  PREDICTED: elongation factor 1-gamma 3-like ...    291   2e-92   Citrus sinensis [apfelsine]
ref|XP_008365322.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    291   2e-92   
ref|XP_004300001.1|  PREDICTED: elongation factor 1-gamma-like          291   2e-92   Fragaria vesca subsp. vesca
gb|ACG36145.1|  elongation factor 1-gamma 3                             290   4e-92   Zea mays [maize]
ref|XP_008218696.1|  PREDICTED: elongation factor 1-gamma               290   4e-92   Prunus mume [ume]
ref|XP_009418787.1|  PREDICTED: elongation factor 1-gamma 2-like        290   4e-92   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ84953.1|  unknown                                                 280   4e-92   Medicago truncatula
ref|XP_009148264.1|  PREDICTED: probable elongation factor 1-gamma 1    290   4e-92   Brassica rapa
ref|XP_008218698.1|  PREDICTED: elongation factor 1-gamma-like          290   4e-92   Prunus mume [ume]
ref|XP_006845799.1|  hypothetical protein AMTR_s00019p00255470          290   5e-92   
ref|XP_004308137.1|  PREDICTED: elongation factor 1-gamma-like is...    290   5e-92   Fragaria vesca subsp. vesca
ref|XP_006417552.1|  hypothetical protein EUTSA_v10007759mg             290   5e-92   Eutrema salsugineum [saltwater cress]
dbj|BAD94347.1|  hypothetical protein                                   280   7e-92   Arabidopsis thaliana [mouse-ear cress]
gb|EPS67955.1|  elongation factor 1 gamma-like protein                  290   7e-92   Genlisea aurea
gb|AAL87298.1|  unknown protein                                         287   8e-92   Arabidopsis thaliana [mouse-ear cress]
emb|CDY50887.1|  BnaCnng19790D                                          289   8e-92   Brassica napus [oilseed rape]
emb|CDY06365.1|  BnaA09g48380D                                          289   9e-92   
gb|AAO72563.1|  elongation factor 1 gamma-like protein                  289   1e-91   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057916.1|  Os06g0571400                                       289   1e-91   
ref|XP_009118302.1|  PREDICTED: probable elongation factor 1-gamma 1    289   1e-91   Brassica rapa
gb|EYU28215.1|  hypothetical protein MIMGU_mgv1a007176mg                289   1e-91   Erythranthe guttata [common monkey flower]
ref|XP_006302321.1|  hypothetical protein CARUB_v10020374mg             288   1e-91   Capsella rubella
gb|EAZ37421.1|  hypothetical protein OsJ_21756                          289   2e-91   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011470423.1|  PREDICTED: elongation factor 1-gamma-like is...    290   2e-91   Fragaria vesca subsp. vesca
ref|NP_563848.1|  elongation factor EF-1 gamma subunit                  288   2e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008339412.1|  PREDICTED: elongation factor 1-gamma               288   2e-91   
gb|AAK59587.1|  putative elongation factor 1B gamma                     288   2e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892012.1|  hypothetical protein ARALYDRAFT_474857             288   2e-91   
ref|XP_006656177.1|  PREDICTED: elongation factor 1-gamma 3-like        288   2e-91   
ref|NP_176084.1|  elongation factor EF-1 gamma subunit                  288   2e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490215.1|  PREDICTED: probable elongation factor 1-gamma 1    288   2e-91   Camelina sativa [gold-of-pleasure]
ref|XP_006307657.1|  hypothetical protein CARUB_v10009284mg             288   2e-91   Capsella rubella
ref|XP_010511351.1|  PREDICTED: probable elongation factor 1-gamma 2    288   2e-91   Camelina sativa [gold-of-pleasure]
ref|XP_010470318.1|  PREDICTED: probable elongation factor 1-gamma 2    288   2e-91   Camelina sativa [gold-of-pleasure]
ref|XP_007222927.1|  hypothetical protein PRUPE_ppa005220mg             290   3e-91   Prunus persica
sp|Q9FUM1.1|EF1G_PRUAV  RecName: Full=Elongation factor 1-gamma; ...    288   4e-91   Prunus avium [gean]
ref|XP_002889762.1|  hypothetical protein ARALYDRAFT_471063             287   4e-91   
ref|XP_010475805.1|  PREDICTED: probable elongation factor 1-gamm...    287   7e-91   
gb|AGC13144.1|  EF1Bgamma class glutathione S-transferase               286   2e-90   Pinus tabuliformis [southern Chinese pine]
emb|CBI29691.3|  unnamed protein product                                276   2e-90   Vitis vinifera
ref|XP_003563720.1|  PREDICTED: elongation factor 1-gamma 3             285   3e-90   Brachypodium distachyon [annual false brome]
ref|XP_010475804.1|  PREDICTED: probable elongation factor 1-gamm...    285   3e-90   Camelina sativa [gold-of-pleasure]
gb|AHC03515.1|  gamma class glutathione S-transferase                   284   9e-90   Larix kaempferi [karamatsu]
ref|XP_010458260.1|  PREDICTED: probable elongation factor 1-gamma 1    283   1e-89   Camelina sativa [gold-of-pleasure]
emb|CDY20681.1|  BnaC08g13770D                                          287   2e-89   Brassica napus [oilseed rape]
ref|XP_003571724.1|  PREDICTED: elongation factor 1-gamma 2             283   3e-89   Brachypodium distachyon [annual false brome]
gb|ABK25057.1|  unknown                                                 282   8e-89   Picea sitchensis
gb|EMT01475.1|  Elongation factor 1-gamma 2                             284   1e-87   
ref|NP_001235707.1|  elongation factor 1-gamma                          278   2e-87   
gb|KGN56266.1|  hypothetical protein Csa_3G110630                       277   3e-87   
gb|EMS60520.1|  Elongation factor 1-gamma 2                             270   2e-84   Triticum urartu
gb|AIW07751.1|  elongation factor subfamily 1b subunit gamma            262   3e-84   Pinus krempfii
gb|AIW07759.1|  elongation factor subfamily 1b subunit gamma            261   4e-84   Pinus krempfii
gb|EMT20600.1|  Elongation factor 1-gamma 2                             269   4e-84   
gb|AIW07777.1|  elongation factor subfamily 1b subunit gamma            260   1e-83   Pinus krempfii
gb|EEC80835.1|  hypothetical protein OsI_23436                          269   2e-83   Oryza sativa Indica Group [Indian rice]
dbj|BAH56923.1|  AT1G57720                                              239   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099002.1|  PREDICTED: elongation factor 1-gamma 2-like        233   2e-70   Sesamum indicum [beniseed]
ref|XP_002973046.1|  hypothetical protein SELMODRAFT_98733              232   1e-69   
ref|XP_002984514.1|  hypothetical protein SELMODRAFT_156635             232   2e-69   Selaginella moellendorffii
gb|AFP90271.1|  elongation factor 1-gamma 1                             214   2e-66   Pinus yunnanensis [Yunnan pine]
gb|AFP90278.1|  elongation factor 1-gamma 1                             214   2e-66   Pinus yunnanensis [Yunnan pine]
gb|AFP90281.1|  elongation factor 1-gamma 1                             213   3e-66   Pinus yunnanensis [Yunnan pine]
gb|AFP90241.1|  elongation factor 1-gamma 1                             213   4e-66   Pinus tabuliformis [southern Chinese pine]
gb|AFP90255.1|  elongation factor 1-gamma 1                             212   9e-66   Pinus tabuliformis [southern Chinese pine]
gb|AFP90268.1|  elongation factor 1-gamma 1                             212   1e-65   Pinus densata
ref|XP_001771013.1|  predicted protein                                  222   1e-65   
gb|AFP90265.1|  elongation factor 1-gamma 1                             212   1e-65   Pinus densata
gb|AFP90276.1|  elongation factor 1-gamma 1                             212   1e-65   Pinus densata
gb|AFP90258.1|  elongation factor 1-gamma 1                             211   2e-65   Pinus densata
gb|KGN56265.1|  hypothetical protein Csa_3G110620                       219   3e-65   
gb|AFP90264.1|  elongation factor 1-gamma 1                             210   4e-65   Pinus densata
gb|AFP90247.1|  elongation factor 1-gamma 1                             210   4e-65   Pinus tabuliformis [southern Chinese pine]
gb|AFP90253.1|  elongation factor 1-gamma 1                             210   5e-65   Pinus tabuliformis [southern Chinese pine]
gb|AFP90275.1|  elongation factor 1-gamma 1                             210   6e-65   Pinus densata
ref|XP_001758671.1|  predicted protein                                  220   6e-65   
gb|AFP90246.1|  elongation factor 1-gamma 1                             210   8e-65   Pinus densata
gb|AFP90254.1|  elongation factor 1-gamma 1                             209   9e-65   Pinus tabuliformis [southern Chinese pine]
gb|AFP90282.1|  elongation factor 1-gamma 1                             209   1e-64   Pinus densata
ref|XP_001774148.1|  predicted protein                                  219   2e-64   
gb|AFP90244.1|  elongation factor 1-gamma 1                             208   2e-64   Pinus densata
ref|XP_004172027.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    216   6e-64   
ref|XP_004134257.1|  PREDICTED: elongation factor 1-gamma-like          203   3e-59   
dbj|BAD94101.1|  hypothetical protein                                   182   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001167773.1|  hypothetical protein                               174   5e-51   
gb|ABR25394.1|  elongation factor 1-gamma 3                             165   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_007041191.1|  Elongation factor 1-gamma 3, putative              164   1e-45   
ref|XP_005645852.1|  glutathione S-transferase                          162   1e-42   Coccomyxa subellipsoidea C-169
ref|XP_004341586.1|  elongation factor 1-gamma family protein           138   3e-34   Acanthamoeba castellanii str. Neff
gb|ETL96568.1|  hypothetical protein L917_05966                         128   1e-32   Phytophthora parasitica
emb|CCI44608.1|  unnamed protein product                                133   2e-32   Albugo candida
gb|ETM49712.1|  hypothetical protein L914_06089                         127   5e-32   Phytophthora parasitica
gb|EXX52334.1|  Tef4p                                                   129   2e-31   Rhizophagus irregularis DAOM 197198w
emb|CCA15330.1|  calciumdependent protein 1 putative                    130   2e-31   Albugo laibachii Nc14
gb|ETK89973.1|  hypothetical protein L915_06156                         127   2e-31   Phytophthora parasitica
emb|CBK20805.2|  unnamed protein product                                127   3e-31   Blastocystis hominis
gb|ESA05922.1|  hypothetical protein GLOINDRAFT_349960                  129   6e-31   
ref|XP_008867564.1|  hypothetical protein H310_04829                    128   2e-30   Aphanomyces invadans
emb|CBK21757.2|  unnamed protein product                                127   2e-30   Blastocystis hominis
ref|NP_001184949.1|  elongation factor EF-1 gamma subunit               125   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|ETK89994.1|  hypothetical protein L915_06152                         127   4e-30   Phytophthora parasitica
gb|ETP19871.1|  hypothetical protein F441_06281                         127   4e-30   Phytophthora parasitica CJ01A1
ref|XP_008891718.1|  hypothetical protein PPTG_02398                    126   4e-30   Phytophthora parasitica INRA-310
ref|XP_002901767.1|  elongation factor 1-gamma, putative                126   5e-30   Phytophthora infestans T30-4
ref|XP_006680023.1|  hypothetical protein BATDEDRAFT_37118              126   5e-30   Batrachochytrium dendrobatidis JAM81
ref|XP_002901771.1|  elongation factor 1-gamma, putative                125   1e-29   Phytophthora infestans T30-4
ref|XP_009519315.1|  hypothetical protein PHYSODRAFT_284839             125   1e-29   Phytophthora sojae
ref|XP_009519320.1|  hypothetical protein PHYSODRAFT_359164             125   2e-29   Phytophthora sojae
emb|CDH60277.1|  elongation factor 1 gamma domain-containingprotein     121   3e-28   Lichtheimia corymbifera JMRC:FSU:9682
gb|EPY23706.1|  elongation factor 1-gamma                               119   4e-28   Strigomonas culicis
ref|XP_001562716.1|  elongation factor-1 gamma                          121   4e-28   Leishmania braziliensis MHOM/BR/75/M2904
emb|CDS05969.1|  hypothetical protein LRAMOSA08497                      119   1e-27   Lichtheimia ramosa
emb|CEP19706.1|  hypothetical protein                                   119   2e-27   Parasitella parasitica
gb|EPY29488.1|  elongation factor 1-gamma                               119   2e-27   Strigomonas culicis
gb|EPY20606.1|  elongation factor 1-gamma                               119   2e-27   Strigomonas culicis
ref|XP_008365338.1|  PREDICTED: elongation factor 1-gamma-like          117   4e-27   
ref|XP_003872780.1|  elongation factor-1 gamma                          117   6e-27   Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_010704334.1|  elongation factor-1 gamma                          117   7e-27   Leishmania panamensis
ref|XP_009825362.1|  hypothetical protein H257_03107                    117   9e-27   Aphanomyces astaci
gb|EFA79702.1|  glutathione S-transferase domain-containing protein     117   1e-26   Heterostelium album PN500
gb|EPY38232.1|  elongation factor 1-gamma                               115   1e-26   Angomonas deanei
emb|CCC95849.1|  unnamed protein product                                116   1e-26   Trypanosoma congolense IL3000
gb|AAS55635.1|  elongation factor 1B gamma 2                            116   2e-26   Crithidia fasciculata
emb|CCC95841.1|  unnamed protein product                                116   2e-26   Trypanosoma congolense IL3000
gb|EPY35413.1|  elongation factor 1-gamma                               115   3e-26   Angomonas deanei
gb|EPY35420.1|  elongation factor 1-gamma                               115   3e-26   Angomonas deanei
ref|XP_002371737.1|  elongation factor 1-gamma, putative                115   3e-26   Toxoplasma gondii ME49
ref|XP_003858781.1|  elongation factor-1 gamma                          115   3e-26   Leishmania donovani
ref|XP_001463559.1|  elongation factor-1 gamma                          115   3e-26   Leishmania infantum JPCM5
gb|EPY28959.1|  elongation factor 1-gamma                               115   3e-26   Angomonas deanei
ref|XP_001463560.1|  elongation factor-1 gamma                          115   4e-26   Leishmania infantum JPCM5
emb|CAC35543.1|  elongation factor-1 gamma                              115   4e-26   Leishmania infantum
sp|P34715.1|EF1G_TRYCR  RecName: Full=Elongation factor 1-gamma; ...    115   4e-26   Trypanosoma cruzi
emb|CDS12960.1|  hypothetical protein LRAMOSA05144                      115   5e-26   Lichtheimia ramosa
ref|XP_001681271.1|  elongation factor-1 gamma                          115   6e-26   Leishmania major strain Friedlin
ref|XP_004353907.1|  glutathione S-transferase domain-containing ...    115   6e-26   Cavenderia fasciculata
ref|XP_008888397.1|  elongation factor 1-gamma, putative                114   6e-26   
gb|EPB91935.1|  hypothetical protein HMPREF1544_01229                   114   7e-26   Mucor circinelloides f. circinelloides 1006PhL
emb|CAF94681.1|  unnamed protein product                                110   9e-26   Tetraodon nigroviridis
gb|EKF26874.1|  elongation factor 1-gamma (EF-1-gamma), putative        110   1e-25   Trypanosoma cruzi marinkellei
dbj|GAM21220.1|  hypothetical protein SAMD00019534_043950               114   1e-25   Acytostelium subglobosum LB1
gb|EKG02410.1|  elongation factor 1-gamma (EF-1-gamma), putative        114   1e-25   Trypanosoma cruzi
ref|XP_806964.1|  elongation factor 1-gamma (EF-1-gamma)                114   1e-25   Trypanosoma cruzi strain CL Brener
ref|XP_009040775.1|  hypothetical protein AURANDRAFT_70385              113   2e-25   Aureococcus anophagefferens
emb|CEI89465.1|  hypothetical protein RMCBS344292_03820                 113   2e-25   Rhizopus microsporus
emb|CEG74026.1|  hypothetical protein RMATCC62417_09299                 113   2e-25   Rhizopus microsporus
emb|CDO76003.1|  hypothetical protein BN946_scf184780.g10               113   2e-25   Trametes cinnabarina
emb|CEI97373.1|  hypothetical protein RMCBS344292_11508                 113   2e-25   Rhizopus microsporus
emb|CBH18353.1|  elongation factor 1 gamma, putative                    113   3e-25   Trypanosoma brucei gambiense DAL972
ref|XP_009041108.1|  hypothetical protein AURANDRAFT_39051              113   3e-25   Aureococcus anophagefferens
ref|XP_829366.1|  elongation factor 1 gamma                             112   3e-25   Trypanosoma brucei brucei TREU927
gb|ESL05599.1|  elongation factor 1-gamma                               112   3e-25   Trypanosoma rangeli SC58
emb|CBJ27519.1|  eukaryotic elongation factor-1 B gamma                 112   3e-25   Ectocarpus siliculosus
ref|XP_009314156.1|  putative elongation factor 1-gamma (EF-1-gamma)    112   3e-25   Trypanosoma grayi
ref|XP_651475.1|  eukaryotic translation elongation factor 1 gamma      108   4e-25   
dbj|BAN38538.1|  eukaryotic translation elongation factor 1 gamma...    108   4e-25   
emb|CBH18338.1|  elongation factor 1 gamma, putative                    113   4e-25   
ref|XP_007367152.1|  elongation factor 1-gamma                          112   4e-25   
emb|CDH55788.1|  elongation factor 1-gamma                              112   5e-25   
ref|XP_003677986.1|  hypothetical protein NCAS_0H03290                  112   5e-25   
ref|XP_003886058.1|  hypothetical protein NCLIV_064580                  112   5e-25   
emb|CCW66695.1|  unnamed protein product                                112   6e-25   
gb|EPB85278.1|  hypothetical protein HMPREF1544_07959                   112   6e-25   
ref|XP_003675590.1|  hypothetical protein NCAS_0C02340                  112   6e-25   
ref|XP_829376.1|  elongation factor 1 gamma                             113   7e-25   
emb|CCC53922.1|  putative elongation factor 1 gamma                     111   8e-25   
gb|ELU41062.1|  elongation factor 1-gamma                               114   8e-25   
emb|CCW64576.1|  unnamed protein product                                111   9e-25   
emb|CDH55787.1|  elongation factor 1-gamma                              112   9e-25   
gb|EIE88418.1|  hypothetical protein RO3G_13129                         111   1e-24   
gb|AAD54312.1|  elongation factor eEF1 gamma chain                      104   1e-24   
gb|KEQ85130.1|  eEF1-gamma domain-containing protein                    111   1e-24   
gb|EXX52333.1|  Tef4p                                                   110   2e-24   
ref|XP_007755740.1|  elongation factor 1-gamma                          110   2e-24   
ref|XP_009157113.1|  elongation factor EF-1 gamma subunit               110   2e-24   
gb|EIE85200.1|  hypothetical protein RO3G_09910                         110   2e-24   
ref|XP_003679479.1|  elongation factor 1 gamma domain-containing ...    110   3e-24   
gb|AAS55634.1|  elongation factor 1B gamma 1                            109   4e-24   
ref|XP_008605170.1|  hypothetical protein SDRG_01423                    109   4e-24   
ref|XP_007736285.1|  elongation factor 1-gamma                          109   4e-24   
gb|KEQ58308.1|  eEF1-gamma domain-containing protein                    109   5e-24   
ref|XP_007375336.1|  hypothetical protein SPAPADRAFT_61149              109   5e-24   
emb|CAK42245.1|  unnamed protein product                                105   6e-24   
ref|XP_007727684.1|  elongation factor 1-gamma                          108   7e-24   
ref|XP_002419498.1|  elongation factor 1 gamma domain-containing ...    108   7e-24   
ref|XP_001382613.1|  elongation factor 1 gamma domain-containing ...    108   8e-24   
ref|XP_007387562.1|  elongation factor 1-gamma                          108   9e-24   
ref|XP_002618567.1|  conserved hypothetical protein                     107   1e-23   
gb|KIW71582.1|  hypothetical protein PV04_03729                         108   1e-23   
ref|XP_008716958.1|  hypothetical protein HMPREF1541_04390              108   1e-23   
ref|XP_002420602.1|  elongation factor 1 gamma domain-containing ...    108   1e-23   
gb|KGR09240.1|  elongation factor 1-gamma                               108   1e-23   
gb|EEQ44636.1|  elongation factor 1-gamma 1                             108   1e-23   
ref|XP_001526253.1|  elongation factor 1-gamma 1                        108   1e-23   
gb|KIW17213.1|  hypothetical protein PV08_04404                         108   1e-23   
ref|XP_004199475.1|  Piso0_001255                                       108   1e-23   
gb|KGU06197.1|  elongation factor 1-gamma                               108   1e-23   
ref|XP_001524775.1|  conserved hypothetical protein                     108   1e-23   
gb|EFW16904.1|  elongation factor 1-gamma                               108   1e-23   
ref|XP_001248928.1|  elongation factor 1 gamma domain-containing ...    108   1e-23   
gb|KGU26884.1|  elongation factor 1-gamma                               108   1e-23   
gb|KGQ91245.1|  elongation factor 1-gamma                               108   1e-23   
gb|EEQ46357.1|  conserved hypothetical protein                          108   1e-23   
gb|KGU06273.1|  elongation factor 1-gamma                               108   1e-23   
gb|KDO34814.1|  hypothetical protein SPRG_00875                         108   1e-23   
gb|KHC32906.1|  elongation factor 1-gamma                               108   1e-23   
gb|KGQ84572.1|  elongation factor 1-gamma                               108   1e-23   
gb|KGR11185.1|  elongation factor 1-gamma                               108   1e-23   
gb|KGR05763.1|  elongation factor 1-gamma                               108   1e-23   
gb|KHC32837.1|  elongation factor 1-gamma                               108   1e-23   
ref|XP_712054.1|  potential translation elongation factor Cam1p         108   2e-23   
ref|XP_003970321.1|  PREDICTED: elongation factor 1-gamma-like          108   2e-23   
gb|ABG88953.1|  elongation factor-1 gamma                               108   2e-23   
gb|EWM21126.1|  elongation factor 1                                     107   2e-23   
emb|CDH55790.1|  glutathione s-transferase                              106   2e-23   
ref|XP_007743206.1|  elongation factor 1-gamma                          107   2e-23   
gb|EPS96197.1|  hypothetical protein FOMPIDRAFT_1025472                 107   2e-23   
gb|KIW96849.1|  hypothetical protein Z519_02240                         107   2e-23   
ref|XP_008727405.1|  hypothetical protein G647_04846                    107   2e-23   
gb|KEP46305.1|  elongation factor 1-gamma                               107   3e-23   
gb|EUC62963.1|  elongation factor 1-gamma                               107   3e-23   
gb|KIK66373.1|  hypothetical protein GYMLUDRAFT_1025824                 107   3e-23   
gb|KIW26889.1|  hypothetical protein PV07_06682                         107   3e-23   
gb|ABG88951.1|  elongation factor-1 gamma                               107   4e-23   
gb|KIW57420.1|  hypothetical protein PV05_05970                         107   4e-23   
gb|ABG88954.1|  elongation factor-1 gamma                               107   4e-23   
ref|XP_007376481.1|  elongation factor 1-gamma 1                        106   4e-23   
emb|CCO33107.1|  Elongation factor 1-gamma Short=EF-1-gamma             106   5e-23   
gb|KIW75623.1|  hypothetical protein Z517_10365                         106   5e-23   
ref|XP_001396615.2|  hypothetical protein ANI_1_1132134                 105   5e-23   
gb|KIW37511.1|  hypothetical protein PV06_10164                         106   5e-23   
gb|KFX50153.1|  Elongation factor 1-gamma 2                             105   7e-23   
gb|KIX93645.1|  hypothetical protein Z520_10551                         106   7e-23   
ref|XP_007805315.1|  hypothetical protein EPUS_08392                    106   7e-23   
ref|XP_001598134.1|  elongation factor 1 gamma domain-containing ...    105   9e-23   
ref|XP_002153321.1|  elongation factor 1 gamma domain-containing ...    105   9e-23   
gb|KIV85484.1|  hypothetical protein PV11_01176                         105   1e-22   
gb|EPS26219.1|  hypothetical protein PDE_01155                          105   1e-22   
gb|KEQ93378.1|  hypothetical protein AUEXF2481DRAFT_42115               105   1e-22   
gb|KFY71067.1|  hypothetical protein V499_08719                         105   1e-22   
ref|XP_003956526.1|  hypothetical protein KAFR_0C04000                  105   1e-22   
gb|KEQ75846.1|  eEF1-gamma domain-containing protein                    105   1e-22   
gb|KFZ04743.1|  hypothetical protein V501_09006                         105   1e-22   
dbj|GAM40842.1|  Tef4 homolog                                           105   1e-22   
ref|XP_005707114.1|  elongation factor EF-1 gamma subunit               108   1e-22   
ref|XP_003744624.1|  PREDICTED: elongation factor 1-gamma-like          105   1e-22   
emb|CDR38853.1|  CYFA0S02e07140g1_1                                     105   1e-22   
ref|XP_003980245.1|  hypothetical protein NDAI_0G05860                  105   1e-22   
gb|EHA24459.1|  hypothetical protein ASPNIDRAFT_210029                  105   2e-22   
emb|CCO33241.1|  Elongation factor 1-gamma Short=EF-1-gamma             105   2e-22   
gb|KGU22970.1|  elongation factor 1-gamma                               105   2e-22   
ref|XP_009009109.1|  hypothetical protein HELRODRAFT_105304             105   2e-22   
gb|KEF61767.1|  elongation factor 1-gamma                               105   2e-22   
emb|CCO33106.1|  Elongation factor 1-gamma-A Short=EF-1-gamma-A         105   2e-22   
emb|CCE41259.1|  hypothetical protein CPAR2_302480                      104   2e-22   
ref|XP_004202421.1|  Piso0_001255                                       104   2e-22   
emb|CCE42133.1|  hypothetical protein CPAR2_806820                      104   2e-22   
emb|CCM01656.1|  predicted protein                                      104   2e-22   
gb|KIV91053.1|  hypothetical protein PV10_05638                         104   2e-22   
gb|KFZ07694.1|  hypothetical protein V502_09840                         104   2e-22   
gb|AEG78432.1|  elongation factor-1 gamma                               102   2e-22   
ref|XP_006684814.1|  eEF1-gamma domain-containing protein               104   3e-22   
ref|XP_003645716.1|  hypothetical protein Ecym_3413                     104   3e-22   
ref|XP_003668941.1|  hypothetical protein NDAI_0C00370                  104   3e-22   
ref|XP_002548408.1|  elongation factor 1-gamma 1                        103   3e-22   
ref|XP_001643583.1|  hypothetical protein Kpol_1073p11                  104   3e-22   
ref|XP_001642592.1|  hypothetical protein Kpol_333p4                    103   4e-22   
ref|XP_002259965.1|  elongation factor 1-gamma                          103   4e-22   
emb|CCO33242.1|  Elongation factor 1-gamma Short=EF-1-gamma             103   4e-22   
ref|XP_003670363.1|  hypothetical protein NDAI_0E03030                  103   4e-22   
gb|KFY32718.1|  hypothetical protein V495_08808                         103   4e-22   
emb|CCO33105.1|  Elongation factor 1-gamma Short=EF-1-gamma             103   5e-22   
gb|KDQ23974.1|  hypothetical protein PLEOSDRAFT_1067979                 103   5e-22   
gb|KFY33526.1|  hypothetical protein V494_07539                         103   5e-22   
gb|KFY07012.1|  hypothetical protein V492_07522                         103   5e-22   
gb|KFX87110.1|  hypothetical protein V490_08542                         103   6e-22   
ref|XP_007001088.1|  hypothetical protein TREMEDRAFT_56155              103   6e-22   
ref|XP_011277482.1|  Elongation factor 1-gamma                          103   6e-22   
gb|KFX90510.1|  hypothetical protein O988_08171                         103   7e-22   
gb|ETL96579.1|  hypothetical protein L917_05965                         102   7e-22   
gb|KIX10612.1|  hypothetical protein Z518_01696                         103   7e-22   
emb|CCO33240.1|  Elongation factor 1-gamma Short=EF-1-gamma             103   7e-22   
ref|XP_004363777.1|  eukaryotic translation elongation factor 1 g...    103   7e-22   
ref|XP_002410199.1|  elongation factor 1 gamma, putative              99.0    8e-22   
gb|KFH71059.1|  hypothetical protein MVEG_03905                         103   8e-22   
gb|ELR10406.1|  hypothetical protein GMDG_00818                         103   8e-22   
emb|CCK67906.1|  hypothetical protein KNAG_0A02170                      102   8e-22   
gb|EWC45095.1|  hypothetical protein DRE_06234                          102   9e-22   
gb|KFY62519.1|  hypothetical protein V496_04550                         102   1e-21   
ref|XP_007922713.1|  hypothetical protein MYCFIDRAFT_70922              102   1e-21   
ref|XP_008081375.1|  eEF1-gamma                                         102   1e-21   
gb|EMF15588.1|  eEF1-gamma domain-containing protein                    102   1e-21   
gb|EUN29355.1|  hypothetical protein COCVIDRAFT_24648                   105   1e-21   
ref|XP_007707915.1|  hypothetical protein COCCADRAFT_1433               105   1e-21   
gb|ENI01501.1|  hypothetical protein COCC4DRAFT_43377                   105   1e-21   
ref|XP_007692467.1|  hypothetical protein COCMIDRAFT_107326             105   1e-21   
gb|EHL02475.1|  putative Elongation factor 1-gamma 2                    102   1e-21   
ref|XP_003023789.1|  glutathione S-transferase, putative                102   1e-21   
ref|XP_006220052.1|  PREDICTED: probable elongation factor 1-gamm...  99.0    1e-21   
ref|XP_007705773.1|  hypothetical protein COCSADRAFT_185747             105   1e-21   
dbj|GAD91456.1|  elongation factor 1 gamma domain-containing protein    102   1e-21   
ref|XP_449323.1|  elongation factor 1 gamma domain-containing pro...    102   1e-21   
ref|XP_448998.1|  elongation factor 1 gamma domain-containing pro...    102   1e-21   
gb|KDQ08948.1|  hypothetical protein BOTBODRAFT_37468                   102   1e-21   
gb|KFH74042.1|  hypothetical protein MVEG_01255                         102   1e-21   
gb|EZF26004.1|  hypothetical protein H100_01805                         101   1e-21   
ref|XP_003290965.1|  hypothetical protein DICPUDRAFT_49566              102   2e-21   
ref|XP_459180.2|  elongation factor 1 gamma domain-containing pro...    102   2e-21   
gb|EZF28996.1|  hypothetical protein H101_07317                         102   2e-21   
gb|EGD96347.1|  elongation factor 1-gamma                               102   2e-21   
ref|XP_003232586.1|  elongation factor 1 gamma domain-containing ...    102   2e-21   
ref|XP_003292098.1|  hypothetical protein DICPUDRAFT_156785             102   2e-21   
ref|XP_011388729.1|  hypothetical protein UMAG_02442                    102   2e-21   
gb|ABG11961.1|  tail muscle elongation factor 1 gamma                   102   2e-21   
ref|XP_003017269.1|  glutathione S-transferase, putative                102   2e-21   
ref|XP_005089146.1|  PREDICTED: elongation factor 1-gamma-like          102   2e-21   
gb|EMD34943.1|  hypothetical protein CERSUDRAFT_116469                  102   2e-21   
gb|ESZ99426.1|  40S ribosomal protein S3aE                              102   2e-21   
ref|XP_003297795.1|  hypothetical protein PTT_08317                     104   2e-21   
ref|XP_003289626.1|  hypothetical protein DICPUDRAFT_92342              100   2e-21   
ref|XP_001560910.1|  elongation factor 1 gamma domain-containing ...    101   2e-21   
ref|XP_005913461.1|  PREDICTED: elongation factor 1-gamma-like          101   3e-21   
ref|XP_005723183.1|  PREDICTED: elongation factor 1-gamma-like          101   3e-21   
gb|AIL25493.1|  EF1Bgamma1                                              101   3e-21   
gb|EGA82035.1|  Tef4p                                                 99.4    3e-21   
dbj|GAA86285.1|  translation elongation factor eEF-1 subunit gamma      101   3e-21   
ref|XP_004545571.1|  PREDICTED: elongation factor 1-gamma-like          101   3e-21   
gb|EGA60310.1|  Cam1p                                                   100   3e-21   
sp|Q90YC0.1|EF1G_CARAU  RecName: Full=Elongation factor 1-gamma; ...    101   3e-21   
gb|KFM62317.1|  Elongation factor 1-gamma                             99.4    3e-21   
ref|XP_001614168.1|  elongation factor 1-gamma                          101   3e-21   
gb|EGA85925.1|  Tef4p                                                 99.4    4e-21   
gb|KIH56458.1|  elongation factor 1 gamma, hypothetical protein         101   4e-21   
gb|EYC11955.1|  hypothetical protein Y032_0049g1870                     101   4e-21   
ref|XP_008325378.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    101   4e-21   
ref|XP_500806.1|  elongation factor 1 gamma domain-containing pro...    100   4e-21   
ref|XP_004223626.1|  elongation factor 1-gamma                          100   4e-21   
gb|KDQ08950.1|  hypothetical protein BOTBODRAFT_59000                   100   5e-21   
gb|ERG81045.1|  putative elongation factor 1-gamma                      100   5e-21   
emb|CDH08824.1|  probable Elongation factor 1-gamma 1                   100   5e-21   
gb|KFY21400.1|  hypothetical protein V493_07447                         100   5e-21   
emb|CEL61253.1|  Elongation factor 1-gamma OS=Schizosaccharomyces...    100   5e-21   
emb|CDH14124.1|  probable Elongation factor 1-gamma 1                   100   5e-21   
gb|EWH15445.1|  Cam1p                                                   100   5e-21   
ref|NP_015277.1|  Cam1p                                                 100   5e-21   
ref|XP_001733005.1|  glutathione S-transferase domain-containing ...    100   5e-21   
ref|XP_003444636.1|  PREDICTED: elongation factor 1-gamma-like          100   5e-21   
gb|ADX97113.1|  elongation factor 1-gamma                             99.8    6e-21   
ref|XP_005988901.1|  PREDICTED: elongation factor 1-gamma-like          100   6e-21   
gb|AAA16892.1|  elongation growth 1-gamma                               100   6e-21   
ref|XP_007387563.1|  EF1G-domain-containing protein                     100   7e-21   
gb|KHN78250.1|  putative elongation factor 1-gamma                      102   7e-21   
gb|EDZ70964.1|  YKL081Wp-like protein                                 99.8    7e-21   
ref|XP_003028482.1|  hypothetical protein SCHCODRAFT_86015              100   7e-21   
gb|EGA77962.1|  Tef4p                                                 99.8    7e-21   
ref|XP_003171907.1|  elongation factor 1 gamma domain-containing ...    100   7e-21   
ref|XP_007777470.1|  elongation factor EF-1 gamma subunit               100   7e-21   
gb|EHN06108.1|  Tef4p                                                 99.4    7e-21   
emb|CDF91100.1|  ZYBA0S09-04786g1_1                                     100   8e-21   
gb|AJS54022.1|  Tef4p                                                   100   8e-21   
emb|CBQ71185.1|  related to translation elongation factor eEF1, g...    100   9e-21   
gb|KFO72580.1|  Elongation factor 1-gamma                             96.3    9e-21   
emb|CAA81918.1|  TEF4                                                 99.4    9e-21   
gb|KGB33601.1|  putative elongation factor 1-gamma                    95.9    9e-21   
ref|XP_003662028.1|  hypothetical protein MYCTH_2302076               99.8    1e-20   
ref|XP_008027706.1|  hypothetical protein SETTUDRAFT_91803              102   1e-20   
emb|CCF48051.1|  related to translation elongation factor eEF1, g...    100   1e-20   
ref|XP_006781412.1|  PREDICTED: elongation factor 1-gamma-like is...    100   1e-20   
gb|KIL64615.1|  hypothetical protein M378DRAFT_24485                  99.8    1e-20   
ref|XP_011105847.1|  cam1p                                            99.8    1e-20   
gb|ETW29468.1|  hypothetical protein PFFCH_03121                      97.4    1e-20   
gb|ELT98041.1|  hypothetical protein CAPTEDRAFT_173297                99.8    1e-20   
ref|XP_502225.1|  elongation factor 1 gamma domain-containing pro...  99.4    1e-20   
ref|XP_007865989.1|  eEF1-gamma domain-containing protein             99.8    1e-20   
gb|KGG52346.1|  hypothetical protein DI09_185p10                        100   1e-20   



>gb|KDO42760.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=387

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  237  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  296

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIP+F++DECYDMELY+WK+VDI
Sbjct  297  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDI  356

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  357  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  387



>gb|KDO42759.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=422

 Score =   307 bits (787),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  272  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIP+F++DECYDMELY+WK+VDI
Sbjct  332  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDI  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  392  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  422



>ref|XP_006441587.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
 gb|ESR54827.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
Length=422

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENT+SFVT+NKVG
Sbjct  272  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTISFVTLNKVG  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIP+F++DECYDMELY+WK+VDI
Sbjct  332  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDI  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  392  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  422



>ref|XP_007041181.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
 gb|EOX97012.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
Length=422

 Score =   305 bits (780),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMNKVG
Sbjct  272  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FVLDECYDMELYEWK+VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVLDECYDMELYEWKKVDI  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGE LLDAKCFK
Sbjct  392  SDEAQKERVSQMIEDCEPFEGEPLLDAKCFK  422



>ref|XP_010686883.1| PREDICTED: elongation factor 1-gamma-like [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMNKVG
Sbjct  266  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  325

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FVLDECYDMELYEW +VD+
Sbjct  326  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVLDECYDMELYEWTKVDL  385

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  386  SDEAQKERVSQMIEDYEPFEGEALLDAKCFK  416



>ref|XP_010683294.1| PREDICTED: elongation factor 1-gamma 2-like [Beta vulgaris subsp. 
vulgaris]
Length=418

 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMNKVG
Sbjct  268  SKMVLDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG EIP+FVLDECYDMELYEW +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPQFVLDECYDMELYEWTKVDI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  388  SDEAQKERVSQMIEDFEPFEGEALLDAKCFK  418



>gb|KEH34076.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  269  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYDMELYEW +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIMDECYDMELYEWTKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  389  SDEAQKERVSQMIEDFEPFEGEALLDAKCFK  419



>ref|XP_010030200.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 ref|XP_010030201.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 gb|KCW57149.1| hypothetical protein EUGRSUZ_I02782 [Eucalyptus grandis]
Length=419

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+E+P+FV+DECYDMELYEWK+VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEVPQFVIDECYDMELYEWKKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  389  SDEAQKERVSQMIEDQEPFEGEALLDAKCFK  419



>ref|XP_004485430.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Cicer arietinum]
 ref|XP_004485431.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Cicer arietinum]
Length=420

 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  270  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKFV++ECYDMELYEW +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFVMEECYDMELYEWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKER SQMIED EPFEGEALLDAKCFK
Sbjct  390  SDEAQKERASQMIEDFEPFEGEALLDAKCFK  420



>ref|XP_002264400.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
 ref|XP_010657965.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
Length=423

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  273  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  332

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYDMELYEWK+VDI
Sbjct  333  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKKVDI  392

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  393  SDEAQKERVNQMIEDQEPFEGEALLDAKCFK  423



>ref|XP_006478210.1| PREDICTED: elongation factor 1-gamma-like [Citrus sinensis]
Length=422

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  272  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+ IP+F++ ECYDMELY+WK+VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECYDMELYDWKKVDI  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  392  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  422



>gb|ACU24330.1| unknown [Glycine max]
Length=255

 Score =   296 bits (757),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  105  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  164

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +VDI
Sbjct  165  GFLQRMDLARKYAFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTKVDI  224

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  225  SDEAQKERVNQMIEDYEPFEGEALLDAKCFK  255



>ref|XP_003592902.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|AES63153.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  268  SKMILDDWKRLYSNTKRNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYDMELYEW +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTKVDI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  388  SDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|XP_003592901.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|ABE91935.1| Elongation factor 1, gamma chain; Glutathione S-transferase, 
C-terminal; Thioredoxin-like fold [Medicago truncatula]
 gb|AES63152.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  268  SKMILDDWKRLYSNTKRNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYDMELYEW +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTKVDI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  388  SDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|XP_009610260.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=417

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_009774942.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_009774948.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_010553691.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=415

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVT+NKVG
Sbjct  265  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTLNKVG  324

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV GSEPPFKVKGLWLFRG+EIPKFV+DE YDMELYEWK+VDI
Sbjct  325  GFLQRMDLTRKYAFGKMLVCGSEPPFKVKGLWLFRGQEIPKFVMDEVYDMELYEWKKVDI  384

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>ref|XP_009610261.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=417

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/151 (94%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_007222556.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
 gb|EMJ23755.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
Length=421

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  271  SKMILDEWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKF++DECYDMELY+W++VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYDWRKVDI  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  391  TDEDQKERVNQMIEDQEPFEGEALLDAKCFK  421



>ref|XP_011047878.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
 ref|XP_011047880.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
Length=421

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  271  SKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FV+DECYDMELYEW +VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  391  SDEAQKERVSQMIEDHEPFEGDALLDAKCFK  421



>ref|XP_010544111.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=416

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  266  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  325

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKY FGKMLV GSEPPFKVKGLWLFRG+EIPKFV+DE YDMELYEWK+VDI
Sbjct  326  GFLQRMDLVRKYGFGKMLVCGSEPPFKVKGLWLFRGQEIPKFVMDEVYDMELYEWKKVDI  385

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  386  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  416



>dbj|BAP19108.1| elongation factor 1 gamma-like protein, partial [Ipomoea nil]
Length=170

 Score =   291 bits (745),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  20   SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  79

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRGKEIPKF++DE YDMELYEW++ DI
Sbjct  80   GFLQRMDLARKYAFGKMLVIGSQPPFKVKGLWLFRGKEIPKFIMDEVYDMELYEWREADI  139

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  140  NDEAQKERVNQMIEDHEPFEGEDLLDAKCFK  170



>ref|XP_002526432.1| elongation factor 1 gamma, putative [Ricinus communis]
 gb|EEF35927.1| elongation factor 1 gamma, putative [Ricinus communis]
Length=307

 Score =   296 bits (758),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  157  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  216

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PP+KVKGLWLFRG+EIP+FV+DECYDMELY+WK+VD+
Sbjct  217  GFLQRMDLARKYAFGKMLVIGSNPPYKVKGLWLFRGQEIPQFVIDECYDMELYDWKKVDL  276

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  277  SDEAQKERVNQMIEDFEPFEGEALLDAKCFK  307



>ref|XP_008219063.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=421

 Score =   300 bits (768),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFRE+A+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  271  SKMILDEWKRLYSNTKTNFREIAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKF++DECYDMELY+W++VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYDWRKVDI  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  391  TDEDQKERVNQMIEDQEPFEGEALLDAKCFK  421



>ref|XP_007148576.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
 gb|ESW20570.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
Length=419

 Score =   300 bits (767),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIPKFV+DECYDMELYEW +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGE+LLDAKCFK
Sbjct  389  SDEAQKERVSQMIEDYEPFEGESLLDAKCFK  419



>gb|AFK34308.1| unknown [Medicago truncatula]
Length=418

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENT SFVT+NKVG
Sbjct  268  SKMILDDWKRLYSNTKRNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTASFVTLNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYDMELYEW +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTKVDI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  388  SDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|XP_007153909.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
 gb|ESW25903.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
Length=420

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVTMNKVG
Sbjct  270  SPMILDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCNYKYNDENTVSFVTMNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSNPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  390  SDEAQKERVSQMIEDYEPFEGEALLDAKCFK  420



>emb|CAN75785.1| hypothetical protein VITISV_021574 [Vitis vinifera]
Length=423

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNF EVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  273  SKMILDEWKRLYSNTKTNFHEVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  332

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYDMELYEWK+VDI
Sbjct  333  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKKVDI  392

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  393  SDEAQKERVNQMIEDQEPFEGEALLDAKCFK  423



>gb|ACB72462.1| elongation factor 1 gamma-like protein [Nicotiana tabacum]
Length=417

 Score =   299 bits (766),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND +QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  NDESQKERVNQMIEDYEPFEGEALLDAKCFK  417



>emb|CDP10743.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  271  SKMILDEWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKF+LDE YDMELY+WK+VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFILDEVYDMELYDWKEVDI  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGE LLDAKCFK
Sbjct  391  SDEAQKERVSQMIEDYEPFEGEPLLDAKCFK  421



>gb|ADB11388.1| gamma class glutathione transferase EF1Bgamma3 [Populus trichocarpa]
Length=421

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  271  SKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FV+DECYDMELYEW +VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  391  SDEAQKERVSQMIEDYEPFEGDALLDAKCFK  421



>ref|XP_006600242.1| PREDICTED: elongation factor 1-gamma isoform X1 [Glycine max]
 gb|AJE59628.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  270  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDEAQKERVNQMIEDYEPFEGEALLDAKCFK  420



>ref|XP_009759974.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGESLLDAKCFK  417



>ref|XP_009759973.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVSFVT+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYDMELYEWK+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGESLLDAKCFK  417



>ref|XP_010272551.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Nelumbo 
nucifera]
Length=423

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTK+NFREVAIKGFWDM+DP+GYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  273  SKMILDEWKRLYSNTKSNFREVAIKGFWDMFDPDGYSLWFCDYKYNDENTVSFVTLNKVS  332

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGK+LVIGSEPP+KVKGLWLFRG+EIP+FVLDECYDMELY+W++VDI
Sbjct  333  GFLQRMDLARKYAFGKILVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYDWRKVDI  392

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  393  NDEAQKERVNQMIEDAEPFEGEALLDAKCFK  423



>gb|ACA50518.1| elongation factor 1-gamma [Oryza sativa Japonica Group]
Length=414

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  264  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  324  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVSAMIEDLEPFEGEALLDAKCFK  414



>ref|XP_006647077.1| PREDICTED: elongation factor 1-gamma 2-like [Oryza brachyantha]
Length=418

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  328  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  388  SDEAQKERVSAMIEDLEPFEGEALLDAKCFK  418



>ref|XP_010272550.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Nelumbo 
nucifera]
Length=487

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTK+NFREVAIKGFWDM+DP+GYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  337  SKMILDEWKRLYSNTKSNFREVAIKGFWDMFDPDGYSLWFCDYKYNDENTVSFVTLNKVS  396

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGK+LVIGSEPP+KVKGLWLFRG+EIP+FVLDECYDMELY+W++VDI
Sbjct  397  GFLQRMDLARKYAFGKILVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYDWRKVDI  456

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  457  NDEAQKERVNQMIEDAEPFEGEALLDAKCFK  487



>gb|AHZ94964.1| elongation factor 1, partial [Lilium regale]
Length=405

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  255  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  314

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIP+FV+DECYDMELYEW +VDI
Sbjct  315  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPQFVIDECYDMELYEWTRVDI  374

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  375  SDEAQKERVSAMIEDQEPFEGEALLDAKCFK  405



>ref|NP_001046318.1| Os02g0220600 [Oryza sativa Japonica Group]
 sp|Q9ZRI7.1|EF1G1_ORYSJ RecName: Full=Elongation factor 1-gamma 1; Short=EF-1-gamma 1; 
AltName: Full=eEF-1B gamma 1 [Oryza sativa Japonica Group]
 dbj|BAA34206.1| elongation factor 1B gamma [Oryza sativa]
 dbj|BAD17615.1| Elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08232.1| Os02g0220600 [Oryza sativa Japonica Group]
Length=418

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  328  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  388  SDEAQKERVSAMIEDLEPFEGEALLDAKCFK  418



>gb|KEH32762.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  269  SKMILDDWKRLYSNTKNNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV QMIED EPFEGE LLDAKCFK
Sbjct  389  SDEAQKERVGQMIEDFEPFEGEPLLDAKCFK  419



>gb|KJB47884.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=259

 Score =   292 bits (748),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMNKVG
Sbjct  109  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  168

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+VD+
Sbjct  169  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  228

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  229  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  259



>ref|XP_004155227.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Cucumis sativus]
Length=409

 Score =   297 bits (761),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  259  SSMILDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  318

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRG EIP+FVLDECYDMELYEWK+VDI
Sbjct  319  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGXEIPQFVLDECYDMELYEWKKVDI  378

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  379  SDEAQKERVSQMIEDQEPFEGEALLDAKCFK  409



>gb|ABA81876.1| unknown [Solanum tuberosum]
Length=413

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  263  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV+DE YDMELYEWK+VDI
Sbjct  323  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMDEVYDMELYEWKEVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  383  NDEAQKERVSQMIEDHEPFEGQALLDAKCFK  413



>gb|KEH32761.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=384

 Score =   296 bits (758),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  234  SKMILDDWKRLYSNTKNNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  293

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +VDI
Sbjct  294  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTKVDI  353

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV QMIED EPFEGE LLDAKCFK
Sbjct  354  SDEAQKERVGQMIEDFEPFEGEPLLDAKCFK  384



>ref|NP_001046317.1| Os02g0220500 [Oryza sativa Japonica Group]
 dbj|BAD17614.1| putative elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08231.1| Os02g0220500 [Oryza sativa Japonica Group]
 gb|EEC72756.1| hypothetical protein OsI_06401 [Oryza sativa Indica Group]
 gb|EEE56571.1| hypothetical protein OsJ_05922 [Oryza sativa Japonica Group]
Length=414

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  264  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  324  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEGE+LLDAKCFK
Sbjct  384  SDEAQKERVSAMIEDLEPFEGESLLDAKCFK  414



>sp|Q6YW46.2|EF1G2_ORYSJ RecName: Full=Elongation factor 1-gamma 2; Short=EF-1-gamma 2; 
AltName: Full=eEF-1B gamma 2 [Oryza sativa Japonica Group]
Length=418

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  328  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEGE+LLDAKCFK
Sbjct  388  SDEAQKERVSAMIEDLEPFEGESLLDAKCFK  418



>ref|XP_008452240.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=409

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  259  SSMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  318

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+FVLDECYDMELYEWK+VD+
Sbjct  319  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQFVLDECYDMELYEWKKVDV  378

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  379  SDEAQKERVNQMIEDQEPFEGEALLDAKCFK  409



>ref|XP_008456982.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=422

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  272  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENIVSFVTLNKVG  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKF+LDECYDMELYEW++VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFILDECYDMELYEWRKVDI  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKE V+QMIED EPFEGEALLDAKCFK
Sbjct  392  SDEVQKECVNQMIEDQEPFEGEALLDAKCFK  422



>ref|XP_010242290.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
 ref|XP_010242291.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
Length=424

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYD EGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  274  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDAEGYSLWFCDYKYNDENTVSFVTLNKVS  333

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+++P+FVLDECYDMELY+W++VDI
Sbjct  334  GFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQDVPQFVLDECYDMELYDWRKVDI  393

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  394  NDEAQKERVNQMIEDAEPFEGEALLDAKCFK  424



>ref|XP_008452241.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=410

 Score =   297 bits (760),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  260  SSMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  319

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+FVLDECYDMELYEWK+VDI
Sbjct  320  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQFVLDECYDMELYEWKKVDI  379

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  380  SDEAQKERVNQMIEDQEPFEGEVLLDAKCFK  410



>gb|KHN03584.1| Elongation factor 1-gamma [Glycine soja]
Length=420

 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN ENTVSFVT+NKVG
Sbjct  270  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNQENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDEAQKERVNQMIEDYEPFEGEALLDAKCFK  420



>gb|AAO72574.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=409

 Score =   297 bits (760),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  259  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  318

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  319  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  378

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEGE+LLDAKCFK
Sbjct  379  SDEAQKERVSAMIEDLEPFEGESLLDAKCFK  409



>gb|EEE56572.1| hypothetical protein OsJ_05923 [Oryza sativa Japonica Group]
Length=479

 Score =   299 bits (765),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  329  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  388

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  389  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  448

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  449  SDEAQKERVSAMIEDLEPFEGEALLDAKCFK  479



>gb|KJB47885.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=319

 Score =   293 bits (751),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMNKVG
Sbjct  169  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  228

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+VD+
Sbjct  229  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  288

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  289  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  319



>gb|EEC72757.1| hypothetical protein OsI_06402 [Oryza sativa Indica Group]
Length=479

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  329  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  388

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  389  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  448

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  449  SDEAQKERVSAMIEDLEPFEGEALLDAKCFK  479



>ref|XP_010928857.1| PREDICTED: elongation factor 1-gamma 2 [Elaeis guineensis]
Length=419

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKV 
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVS  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+EIP+FVLDECYDMELYEW +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYEWTKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  389  TDEAQKERVNAMIEDQEPFEGEALLDAKCFK  419



>gb|KJB47897.1| hypothetical protein B456_008G046200 [Gossypium raimondii]
Length=421

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMNKVG
Sbjct  271  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+VD+
Sbjct  331  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  391  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>ref|NP_001274793.1| elongation factor 1-gamma 2-like [Solanum tuberosum]
 gb|ABB87108.1| putative elongation factor 1-gamma-like [Solanum tuberosum]
Length=414

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV+DE YDMELYEWK+VDI
Sbjct  324  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMDEVYDMELYEWKEVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  384  NDEAQKERVSQMIEDHEPFEGQALLDAKCFK  414



>ref|XP_008378997.1| PREDICTED: elongation factor 1-gamma, partial [Malus domestica]
Length=157

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  7    SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  66

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYDMELY W +VDI
Sbjct  67   GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYNWTKVDI  126

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  127  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  157



>gb|AIZ68134.1| translation elongation factor 1-gamma [Ornithogalum saundersiae]
Length=414

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYN+ENTVSFVT+NKVG
Sbjct  264  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNEENTVSFVTLNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRGKEIP FV++ECYDMELYEW +VD+
Sbjct  324  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGKEIPPFVVEECYDMELYEWTKVDL  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  NDEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_006385057.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ABK94655.1| unknown [Populus trichocarpa]
 gb|ADB11387.1| gamma class glutathione transferase EF1Bgamma2 [Populus trichocarpa]
 gb|ERP62854.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=422

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFC+YKYN+ENTVSFVT+NKVG
Sbjct  272  SKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCNYKYNEENTVSFVTLNKVG  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FV+DECYDMELYEW +VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKER SQMIED EPFEGEALLDAKCFK
Sbjct  392  SDEAQKERASQMIEDCEPFEGEALLDAKCFK  422



>ref|XP_008789740.1| PREDICTED: elongation factor 1-gamma 1 isoform X2 [Phoenix dactylifera]
Length=384

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  234  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  293

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+EIP+FVLDECYDMELYEW + DI
Sbjct  294  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYEWTKADI  353

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D AQKER++ MIED EPFEGEALLDAKCFK
Sbjct  354  TDEAQKERINAMIEDQEPFEGEALLDAKCFK  384



>ref|XP_004133719.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus]
Length=409

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWK LYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  259  SSMILDEWKCLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  318

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+FVLDECYDMELYEWK+VDI
Sbjct  319  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQFVLDECYDMELYEWKKVDI  378

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  379  SDEAQKERVSQMIEDQEPFEGEALLDAKCFK  409



>ref|XP_006389499.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ERP48413.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=421

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  271  SKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+FV+DECYDMELYEW +VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  391  SDEAQKERVSQMIEDYEPFEGDALLDAKCFK  421



>ref|XP_006339362.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
tuberosum]
Length=416

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  266  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  325

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV++E YDMELYEWK+VDI
Sbjct  326  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMEEVYDMELYEWKEVDI  385

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  386  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  416



>ref|XP_008789739.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Phoenix dactylifera]
Length=419

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+EIP+FVLDECYDMELYEW + DI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYEWTKADI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D AQKER++ MIED EPFEGEALLDAKCFK
Sbjct  389  TDEAQKERINAMIEDQEPFEGEALLDAKCFK  419



>ref|XP_006339363.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
tuberosum]
Length=414

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV++E YDMELYEWK+VDI
Sbjct  324  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMEEVYDMELYEWKEVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  384  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  414



>ref|XP_011028370.1| PREDICTED: elongation factor 1-gamma 2-like [Populus euphratica]
Length=422

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFC+YKYN+ENTVSFVT+NKVG
Sbjct  272  SKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCNYKYNEENTVSFVTLNKVG  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+F++DECYDMELYEW +VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFIIDECYDMELYEWTKVDI  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKER SQMIED EPFEGEALLDAKCFK
Sbjct  392  SDEAQKERASQMIEDCEPFEGEALLDAKCFK  422



>gb|ADR70876.1| eukaryotic translation elongation factor 1B gamma-subunit [Hevea 
brasiliensis]
Length=424

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  274  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  333

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIG  PP+KVKGLWLFRG+EIP+FV+DECYDMELYEWK+VDI
Sbjct  334  GFLQRMDLARKYAFGKMLVIGENPPYKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDI  393

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  394  SDEAQKERVNQMIEDQEPFEGEPLLDAKCFK  424



>gb|KHG12420.1| hypothetical protein F383_17048 [Gossypium arboreum]
Length=421

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMNKVG
Sbjct  271  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+VD+
Sbjct  331  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  391  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>gb|KJB47883.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47887.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47888.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=421

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMNKVG
Sbjct  271  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+VD+
Sbjct  331  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  391  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>ref|NP_001242737.1| uncharacterized protein LOC100810452 [Glycine max]
 gb|ACU18062.1| unknown [Glycine max]
Length=420

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN ENTVSFVT+NKVG
Sbjct  270  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNQENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRG+EIP+FV+DECYDMELYEW +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSDPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDEPQKERVNQMIEDCEPFEGEALLDAKCFK  420



>gb|KHN40193.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59625.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN ENTVSFVT+NKVG
Sbjct  270  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNQENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRG+EIP+FV+DECYDMELYEW +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSDPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDEPQKERVNQMIEDCEPFEGEALLDAKCFK  420



>ref|XP_011074970.1| PREDICTED: elongation factor 1-gamma-like [Sesamum indicum]
Length=420

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDP GYSLWFC+YKYNDENTVSFVT+NKV 
Sbjct  270  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPAGYSLWFCNYKYNDENTVSFVTLNKVS  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRG EIP+FVLDECYDMELY+W +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGTEIPQFVLDECYDMELYDWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  390  NDEAQKERVNQMIEDAEPFEGEALLDAKCFK  420



>gb|KHG04277.1| hypothetical protein F383_29497 [Gossypium arboreum]
Length=421

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVSFVTMNKVG
Sbjct  271  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+VD+
Sbjct  331  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGE LLDAKCFK
Sbjct  391  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>ref|XP_010907209.1| PREDICTED: elongation factor 1-gamma 2-like [Elaeis guineensis]
Length=419

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+ IP+FVLDECYDMELYEW +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQHIPQFVLDECYDMELYEWTKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  389  TDEAQKERVNAMIEDQEPFEGEALLDAKCFK  419



>ref|XP_011031541.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031542.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031543.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
Length=426

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  276  SKMILDEWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  335

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+VDI
Sbjct  336  GFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDI  395

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D  QKER SQMIED EPFEGE LLDAKCFK
Sbjct  396  TDEEQKERASQMIEDYEPFEGEPLLDAKCFK  426



>ref|XP_002325529.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|EEE99910.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|ADB11386.1| gamma class glutathione transferase EF1Bgamma1 [Populus trichocarpa]
Length=426

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  276  SKMILDEWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  335

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+VDI
Sbjct  336  GFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDI  395

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D  QKER SQMIED EPFEGE LLDAKCFK
Sbjct  396  TDEEQKERASQMIEDYEPFEGEPLLDAKCFK  426



>emb|CBI29690.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = -2

Query  660  MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGF  481
            MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVGGF
Sbjct  1    MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGF  60

Query  480  LQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDIND  301
            LQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYDMELYEWK+VDI+D
Sbjct  61   LQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKKVDISD  120

Query  300  PAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  121  EAQKERVNQMIEDQEPFEGEALLDAKCFK  149



>ref|XP_004966044.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YDMELYEW +VDI
Sbjct  324  GFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTKVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQ+ERVS MIED EPFEGEALLDAKCFK
Sbjct  384  SDEAQRERVSAMIEDQEPFEGEALLDAKCFK  414



>gb|KHN39680.1| Elongation factor 1-gamma [Glycine soja]
Length=331

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  181  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  240

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIPKFV+DECYDMELY+W +VDI
Sbjct  241  GFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPKFVIDECYDMELYDWTKVDI  300

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  301  SDETQKERVNQMIEDFEPFEGESLLDAKCFK  331



>ref|XP_004966045.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   295 bits (754),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YDMELYEW +VDI
Sbjct  324  GFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTKVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQ+ERVS MIED EPFEGEALLDAKCFK
Sbjct  384  SDEAQRERVSAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_004240589.1| PREDICTED: elongation factor 1-gamma 2-like [Solanum lycopersicum]
Length=413

 Score =   295 bits (754),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  263  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRM+L RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV++E YDMELYEWK+VDI
Sbjct  323  GFLQRMELVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMEEVYDMELYEWKEVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  383  NDEAQKERVSQMIEDHEPFEGQALLDAKCFK  413



>ref|XP_002278756.2| PREDICTED: elongation factor 1-gamma [Vitis vinifera]
Length=424

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  274  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVT  333

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML++GSE PFKVKGLWLFRG+EIP+FV+DECYDMELYEWK+VD+
Sbjct  334  GFLQRMDLARKYAFGKMLIVGSEAPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  393

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+QMIED EPFEGEALLDAKCFK
Sbjct  394  SDEAQKERVNQMIEDQEPFEGEALLDAKCFK  424



>ref|NP_001131533.1| uncharacterized protein LOC100192872 [Zea mays]
 gb|ACF79973.1| unknown [Zea mays]
Length=307

 Score =   291 bits (745),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  157  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  216

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YDMELYEW +VDI
Sbjct  217  GFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTKVDI  276

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  277  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  307



>ref|NP_001241223.1| uncharacterized protein LOC100787125 [Glycine max]
 gb|ACU24574.1| unknown [Glycine max]
 gb|AJE59627.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=419

 Score =   295 bits (754),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  269  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIPKFV+DECYDMELY+W +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPKFVIDECYDMELYDWTKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  389  SDETQKERVNQMIEDFEPFEGESLLDAKCFK  419



>gb|EYU22759.1| hypothetical protein MIMGU_mgv1a007114mg [Erythranthe guttata]
Length=419

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  269  SKMVLDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIG+E PFKVKGLWLFRG EIP+FV+DECYDMELY W +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGTEAPFKVKGLWLFRGTEIPQFVMDECYDMELYHWTKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKER SQMIEDAEPFEGE LLDAKCFK
Sbjct  389  NDEAQKERASQMIEDAEPFEGEGLLDAKCFK  419



>ref|XP_008677347.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008677348.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008679834.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 ref|XP_008679835.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 gb|AFW66035.1| elongation factor 1-gamma 2 [Zea mays]
 gb|AFW66036.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   294 bits (753),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VD+
Sbjct  324  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWTKVDL  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>gb|KDO40980.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
Length=287

 Score =   290 bits (742),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  137  SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  196

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYDMELY+WK+ DI
Sbjct  197  GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI  256

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  257  SDEEQKERVNQMIEDHEPFEGEALLDAKCFK  287



>ref|XP_004951452.1| PREDICTED: elongation factor 1-gamma 2-like [Setaria italica]
Length=417

 Score =   294 bits (753),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  267  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VD+
Sbjct  327  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWTKVDL  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  387  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_004250642.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
lycopersicum]
Length=414

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIP FV++E YDMELYEWK+VDI
Sbjct  324  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPMFVMEEVYDMELYEWKEVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  384  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  414



>ref|XP_004250641.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
lycopersicum]
Length=414

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIP FV++E YDMELYEWK+VDI
Sbjct  324  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPMFVMEEVYDMELYEWKEVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  384  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  414



>ref|XP_006392372.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29658.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=350

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  200  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  259

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  260  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  319

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  320  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  350



>ref|XP_004294500.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=419

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  269  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRG+E+P+F++DECYDMELY+W +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSDPPFKVKGLWLFRGQEVPQFIIDECYDMELYDWCKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  389  TDENQKERVNQMIEDHEPFEGEALLDAKCFK  419



>gb|ACJ85171.1| unknown [Medicago truncatula]
Length=418

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK NFREVAIKGFWDMY PEGYSLWFCDYKYNDENT SFVT+NKVG
Sbjct  268  SKMILDDWKRLYSNTKRNFREVAIKGFWDMYVPEGYSLWFCDYKYNDENTASFVTLNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRM LARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYDMELYEW +VDI
Sbjct  328  GFLQRMALARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTKVDI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  388  SDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>gb|AFW71312.1| hypothetical protein ZEAMMB73_547198 [Zea mays]
Length=317

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SK+ILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  167  SKLILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  226

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VD+
Sbjct  227  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDL  286

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  287  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  317



>ref|XP_002451782.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
 gb|EES04758.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
Length=418

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  268  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VD+
Sbjct  328  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWTKVDL  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  388  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  418



>ref|XP_006392370.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 ref|XP_006392371.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29656.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29657.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=414

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  264  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  324  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>gb|KDO40983.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
 gb|KDO40984.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
 gb|KDO40985.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
Length=256

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  106  SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  165

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYDMELY+WK+ DI
Sbjct  166  GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI  225

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  226  SDEEQKERVNQMIEDHEPFEGEALLDAKCFK  256



>gb|KDO40981.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
 gb|KDO40982.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
Length=316

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  166  SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  225

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYDMELY+WK+ DI
Sbjct  226  GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI  285

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  286  SDEEQKERVNQMIEDHEPFEGEALLDAKCFK  316



>ref|XP_003540135.1| PREDICTED: elongation factor 1-gamma-like [Glycine max]
 gb|KHN11054.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59626.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=418

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN+VSFVT+NKVG
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENSVSFVTLNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIP+FV+DECYDMELY+W +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPQFVIDECYDMELYDWTKVDI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  388  SDETQKERVNQMIEDYEPFEGEPLLDAKCFK  418



>ref|XP_008643919.1| PREDICTED: uncharacterized protein LOC100381466 isoform X1 [Zea 
mays]
 gb|AFW71313.1| hypothetical protein ZEAMMB73_547198 [Zea mays]
Length=414

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SK+ILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  264  SKLILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VD+
Sbjct  324  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDL  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>gb|KDP42461.1| hypothetical protein JCGZ_00258 [Jatropha curcas]
Length=423

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  273  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  332

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIG+ PP+KVKGLWLFRG EIP+FV+DECYDMELY+WK+VDI
Sbjct  333  GFLQRMDLARKYAFGKMLVIGANPPYKVKGLWLFRGSEIPQFVIDECYDMELYDWKKVDI  392

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  393  SDEEQKERVNQMIEDFEPFEGEPLLDAKCFK  423



>gb|AFW76477.1| elongation factor gamma1 [Zea mays]
Length=291

 Score =   288 bits (737),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  141  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  200

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YDMELYEW +VDI
Sbjct  201  GFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTKVDI  260

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  261  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  291



>ref|XP_008352808.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=424

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  274  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  333

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKF++DECYDM LYEW++VDI
Sbjct  334  GFLQRMDLARKYAFGKMLVIGSAPPFKVKGLWLFRGQEIPKFIIDECYDMXLYEWRKVDI  393

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  394  TDEDQKERVNQMIEDHEPFEGEDLLDAKCFK  424



>ref|XP_008804357.1| PREDICTED: elongation factor 1-gamma 2-like [Phoenix dactylifera]
Length=461

 Score =   294 bits (752),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFW+MYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  311  SKMILDEWKRLYSNTKTNFREVAIKGFWNMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  370

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG++IP+FVLDECYDMELYEW +VDI
Sbjct  371  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQQIPQFVLDECYDMELYEWTKVDI  430

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  431  ADEVQKERVNAMIEDQEPFEGEALLDAKCFK  461



>ref|XP_002438602.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
 gb|EER89969.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
Length=417

 Score =   292 bits (748),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  267  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFK+KGLWLFRG+E+PKFV+DE YDMELYEW +VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTKVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  387  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>gb|AFW87006.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
 gb|AFW87007.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
Length=382

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  232  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  291

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YDMELYEW +VDI
Sbjct  292  GFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTKVDI  351

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  352  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  382



>ref|XP_010101278.1| Elongation factor 1-gamma [Morus notabilis]
 gb|EXB88213.1| Elongation factor 1-gamma [Morus notabilis]
Length=460

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN+ENTVS+VT+NKV 
Sbjct  310  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSYVTLNKVS  369

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG++IP+FV+DECYDMELYEW++VDI
Sbjct  370  GFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQQIPQFVIDECYDMELYEWQKVDI  429

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D AQKERV+QMIED EPFEGEALLD+KCFK
Sbjct  430  TDEAQKERVNQMIEDHEPFEGEALLDSKCFK  460



>ref|XP_009417204.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=419

 Score =   292 bits (748),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS+PPFKVKG+WLFRG EIPKFVLDE YDMELY+W +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSDPPFKVKGVWLFRGLEIPKFVLDEVYDMELYDWAKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  389  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  419



>gb|AFW76480.1| elongation factor gamma1 [Zea mays]
Length=382

 Score =   291 bits (744),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  232  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  291

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YDMELYEW +VDI
Sbjct  292  GFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTKVDI  351

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  352  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  382



>ref|NP_001148829.1| elongation factor 1-gamma 3 [Zea mays]
 gb|ACG33050.1| elongation factor 1-gamma 3 [Zea mays]
 gb|AFW87009.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   292 bits (747),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  267  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YDMELYEW +VDI
Sbjct  327  GFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTKVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  387  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_009353791.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
 ref|XP_009353792.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   292 bits (747),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  270  SKMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYDMELY W +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYSWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>ref|NP_001151229.1| elongation factor 1-gamma 2 [Zea mays]
 gb|ACG42059.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   291 bits (746),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW +VD+
Sbjct  324  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWAKVDL  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +  AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  SAEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_009362385.1| PREDICTED: elongation factor 1-gamma-like [Pyrus x bretschneideri]
Length=422

 Score =   292 bits (747),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVA+KGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  272  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKF+++ECYDM+LYEW++VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSAPPFKVKGLWLFRGQEIPKFIINECYDMDLYEWRKVDI  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D  QKERV QMIED EPFEGE LLDAKCFK
Sbjct  392  TDEDQKERVCQMIEDHEPFEGEDLLDAKCFK  422



>ref|XP_008647353.1| PREDICTED: uncharacterized protein LOC100192872 isoform X1 [Zea 
mays]
 gb|AFW76478.1| elongation factor gamma1 [Zea mays]
Length=417

 Score =   291 bits (746),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  267  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YDMELYEW +VDI
Sbjct  327  GFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTKVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  387  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_009355338.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   292 bits (747),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  270  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYDMELY W +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYNWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>ref|XP_006431568.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
 gb|ESR44808.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
Length=418

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  268  SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYDMELY+WK+ DI
Sbjct  328  GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  388  SDEEQKERVNQMIEDHEPFEGEALLDAKCFK  418



>emb|CDY22629.1| BnaC08g42630D [Brassica napus]
Length=415

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  265  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  324

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  325  GFLQRMDLARKYAFGKMLICGSEAPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  384

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>ref|XP_009110814.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=412

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  262  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  321

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  322  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  381

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  382  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  412



>emb|CDY31074.1| BnaA08g26240D [Brassica napus]
Length=412

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  262  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  321

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  322  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  381

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  382  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  412



>emb|CDX93494.1| BnaA06g05540D [Brassica napus]
Length=413

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>gb|ACU24584.1| unknown [Glycine max]
Length=418

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN+VSFVT+NKVG
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENSVSFVTLNKVG  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIP+FV+DECYDMELY+W +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPQFVIDECYDMELYDWTKVDI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  388  FDETQKERVNQMIEDYEPFEGEPLLDAKCFK  418



>ref|XP_006494223.1| PREDICTED: elongation factor 1-gamma 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494224.1| PREDICTED: elongation factor 1-gamma 3-like isoform X2 [Citrus 
sinensis]
 gb|ACP43319.1| translation elongation factor [Citrus maxima]
Length=418

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  268  SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYDMELY+WK+ DI
Sbjct  328  GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI  387

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  388  SDEEQKERVNQMIEDHEPFEGEALLDAKCFK  418



>ref|XP_008365322.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Malus domestica]
Length=419

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  269  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYDMELY W +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYNWTKVDI  388

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  389  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  419



>ref|XP_004300001.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=420

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  270  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG+ PP+KVKGLWLFRG EIP+FV+ ECYDMELYEW +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLIIGANPPYKVKGLWLFRGPEIPEFVMQECYDMELYEWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  390  SDENQKERVSQMIEDQEPFEGEPLLDAKCFK  420



>gb|ACG36145.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  267  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YD+ELYEW +VDI
Sbjct  327  GFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDIELYEWTKVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  387  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_008218696.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
 ref|XP_008218697.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
Length=422

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  272  SSMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYDMELY W +VD+
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTKVDL  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  392  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  422



>ref|XP_009418787.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=421

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  271  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKG+WLFRG+EIPKFVLDE YDMELY+W +VDI
Sbjct  331  GFLQRMDLTRKYAFGKMLVIGSEPPFKVKGVWLFRGQEIPKFVLDEVYDMELYDWAKVDI  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKE V+ MIED EPFEGEALLDAKCFK
Sbjct  391  SDEAQKELVNAMIEDQEPFEGEALLDAKCFK  421



>gb|ACJ84953.1| unknown [Medicago truncatula]
Length=149

 Score =   280 bits (717),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  660  MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGF  481
            MILD+WKRLYSNTK NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFV +NKVGGF
Sbjct  1    MILDDWKRLYSNTKNNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENAVSFVALNKVGGF  60

Query  480  LQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDIND  301
            LQRMDLARKYAFGKMLVIG EPPFKVKGLWLFRG+EIPKFV+DECYDMELYEW +VDI+D
Sbjct  61   LQRMDLARKYAFGKMLVIGFEPPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTKVDISD  120

Query  300  PAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             AQKERV QMIED EPFEGE LLDAKCFK
Sbjct  121  EAQKERVGQMIEDFEPFEGEPLLDAKCFK  149



>ref|XP_009148264.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   290 bits (741),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            + M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  TPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_008218698.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=420

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  270  SSMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYDMELY+W +VD+
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYKWTKVDL  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>ref|XP_006845799.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
 gb|ERN07474.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
Length=430

 Score =   290 bits (743),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVS+VT+NKV 
Sbjct  280  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSYVTLNKVA  339

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGK+L+IGSEPP+K+KG+WLFRG+EIP+FVLDECYDMELYEW +VDI
Sbjct  340  GFLQRMDLARKYAFGKVLIIGSEPPYKLKGVWLFRGQEIPQFVLDECYDMELYEWTKVDI  399

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  400  NDETQKERVNAMIEDQEPFEGEALLDAKCFK  430



>ref|XP_004308137.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=420

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  270  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG+ PP+KVKGLWLFRG E+P+FV+ ECYDMELYEW +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLIIGANPPYKVKGLWLFRGPEVPEFVMQECYDMELYEWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  390  SDENQKERVSQMIEDQEPFEGEPLLDAKCFK  420



>ref|XP_006417552.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
 gb|ESQ35905.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
Length=413

 Score =   290 bits (741),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>dbj|BAD94347.1| hypothetical protein [Arabidopsis thaliana]
Length=149

 Score =   280 bits (716),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  660  MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGF  481
            M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVGGF
Sbjct  1    MVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVGGF  60

Query  480  LQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDIND  301
            LQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI+D
Sbjct  61   LQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDISD  120

Query  300  PAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  121  EAQKERVSQMIEDAEPFEGEALLDAKCFK  149



>gb|EPS67955.1| elongation factor 1 gamma-like protein, partial [Genlisea aurea]
Length=422

 Score =   290 bits (741),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 144/152 (95%), Gaps = 1/152 (1%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  271  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIG  PP+KVKGLWLFRG EIP+FV+DECYD+ELY+W +VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGGNPPYKVKGLWLFRGTEIPQFVIDECYDVELYDWAKVDI  390

Query  306  NDPAQKERVSQMIEDAEPFE-GEALLDAKCFK  214
            ND AQKERV+QMIEDAEPFE GE LLDAKCFK
Sbjct  391  NDEAQKERVNQMIEDAEPFEGGEPLLDAKCFK  422



>gb|AAL87298.1| unknown protein [Arabidopsis thaliana]
Length=345

 Score =   287 bits (734),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  195  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  254

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  255  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  314

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  315  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  345



>emb|CDY50887.1| BnaCnng19790D [Brassica napus]
Length=413

 Score =   289 bits (740),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ G+E PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGAEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>emb|CDY06365.1| BnaA09g48380D [Brassica napus]
Length=413

 Score =   289 bits (739),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW + DI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEAPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKADI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>gb|AAO72563.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=413

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  263  SKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELYEW +VD+
Sbjct  323  GFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDL  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGE LLDAKCFK
Sbjct  383  SDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  413



>ref|NP_001057916.1| Os06g0571400 [Oryza sativa Japonica Group]
 sp|Q5Z627.1|EF1G3_ORYSJ RecName: Full=Elongation factor 1-gamma 3; Short=EF-1-gamma 3; 
AltName: Full=eEF-1B gamma 3 [Oryza sativa Japonica Group]
 dbj|BAD61828.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAD61932.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAF19830.1| Os06g0571400 [Oryza sativa Japonica Group]
 dbj|BAG90811.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96325.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  266  SKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  325

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELYEW +VD+
Sbjct  326  GFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDL  385

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGE LLDAKCFK
Sbjct  386  SDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  416



>ref|XP_009118302.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKV+GLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEAPFKVEGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>gb|EYU28215.1| hypothetical protein MIMGU_mgv1a007176mg [Erythranthe guttata]
Length=416

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDEN VSFVT+NKV 
Sbjct  266  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENKVSFVTLNKVS  325

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG EIP+F++DECYDMELY+W +VDI
Sbjct  326  GFLQRMDLARKYAFGKMLVIGSEGPFKVKGLWLFRGTEIPQFIIDECYDMELYDWTKVDI  385

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND A KERV+QMIEDAEPFEGE LLDAKCFK
Sbjct  386  NDEAHKERVNQMIEDAEPFEGEPLLDAKCFK  416



>ref|XP_006302321.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
 gb|EOA35219.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
Length=413

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>gb|EAZ37421.1| hypothetical protein OsJ_21756 [Oryza sativa Japonica Group]
Length=440

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  290  SKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  349

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELYEW +VD+
Sbjct  350  GFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDL  409

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGE LLDAKCFK
Sbjct  410  SDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  440



>ref|XP_011470423.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  329  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  388

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG+ PP+KVKGLWLFRG E+P+FV+ ECYDMELYEW +VDI
Sbjct  389  GFLQRMDLARKYAFGKMLIIGANPPYKVKGLWLFRGPEVPEFVMQECYDMELYEWTKVDI  448

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  449  SDENQKERVSQMIEDQEPFEGEPLLDAKCFK  479



>ref|NP_563848.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|O04487.1|EF1G1_ARATH RecName: Full=Probable elongation factor 1-gamma 1; Short=EF-1-gamma 
1; AltName: Full=eEF-1B gamma 1 [Arabidopsis thaliana]
 gb|AAB60721.1| Similar to elongation factor 1-gamma (gb|EF1G_XENLA). ESTs gb|T20564,gb|T45940,gb|T04527 
come from this gene [Arabidopsis 
thaliana]
 dbj|BAH20206.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28472.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=414

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  264  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  324  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>ref|XP_008339412.1| PREDICTED: elongation factor 1-gamma [Malus domestica]
Length=420

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  270  SKMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+ ECYDMELY W +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMXECYDMELYSWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>gb|AAK59587.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
Length=413

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_002892012.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68271.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
Length=413

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_006656177.1| PREDICTED: elongation factor 1-gamma 3-like [Oryza brachyantha]
Length=416

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG
Sbjct  266  SKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  325

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELY+W +VD+
Sbjct  326  GFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYDWTKVDL  385

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERV+ MIED EPFEGE LLDAKCFK
Sbjct  386  SDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  416



>ref|NP_176084.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 ref|NP_001031202.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|Q9FVT2.1|EF1G2_ARATH RecName: Full=Probable elongation factor 1-gamma 2; Short=EF-1-gamma 
2; AltName: Full=eEF-1B gamma 2 [Arabidopsis thaliana]
 gb|AAG50755.1|AC079733_23 elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAK43879.1|AF370502_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL11623.1|AF424630_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL16277.1|AF428347_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL47343.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47351.1| At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAM62488.1| elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAN41373.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
 gb|AEE33455.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 gb|AEE33456.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=413

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_010490215.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  265  SSMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  324

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  325  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  384

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>ref|XP_006307657.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
 gb|EOA40555.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
Length=415

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  265  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  324

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLW+FRG EIPKF++DE YDMELYEW +VDI
Sbjct  325  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWIFRGPEIPKFIMDEVYDMELYEWTKVDI  384

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>ref|XP_010511351.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=414

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  264  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLW+FRG EIPKF++DE YDMELYEW +VDI
Sbjct  324  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWIFRGPEIPKFIMDEVYDMELYEWTKVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>ref|XP_010470318.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=413

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLW+FRG EIPKF++DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWIFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_007222927.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
 gb|EMJ24126.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
Length=472

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  322  SGMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  381

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYDMELY W +VD+
Sbjct  382  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTKVDL  441

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  442  SDENQKERVNQMIEDQEPFEGEVLLDAKCFK  472



>sp|Q9FUM1.1|EF1G_PRUAV RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: 
Full=eEF-1B gamma [Prunus avium]
 gb|AAG17901.1|AF297712_1 translation elongation factor 1-gamma [Prunus avium]
Length=422

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKVG
Sbjct  272  SNMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYDMELY W +VD+
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTKVDL  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D  QKERV+Q+IED EPFEGEALLDAKCFK
Sbjct  392  SDENQKERVNQVIEDQEPFEGEALLDAKCFK  422



>ref|XP_002889762.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66021.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
Length=414

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  264  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  324  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  383

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>ref|XP_010475805.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X2 [Camelina 
sativa]
Length=435

 Score =   287 bits (735),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  285  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  344

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  345  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  404

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  405  TDEAQKERVSQMIEDAEPFEGEALLDAKCFK  435



>gb|AGC13144.1| EF1Bgamma class glutathione S-transferase [Pinus tabuliformis]
Length=421

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKV 
Sbjct  271  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVT  330

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG E PFKVKGLWLFRG EIPKFV+DECYDMELYEW +VDI
Sbjct  331  GFLQRMDLARKYAFGKMLIIGKEGPFKVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDI  390

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQ+ER + MIED EPFEGE LLDAKCFK
Sbjct  391  NDDAQRERANAMIEDQEPFEGEPLLDAKCFK  421



>emb|CBI29691.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   276 bits (706),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  660  MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGF  481
            MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYN ENTVSFVT+ KV GF
Sbjct  1    MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNAENTVSFVTLIKVDGF  60

Query  480  LQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDIND  301
            LQRMDLA KYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYDME YEWK+VDI+D
Sbjct  61   LQRMDLAHKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMEHYEWKKVDISD  120

Query  300  PAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             AQK RV QMIED EPFEGEALLDAKCFK
Sbjct  121  EAQKGRVIQMIEDQEPFEGEALLDAKCFK  149



>ref|XP_003563720.1| PREDICTED: elongation factor 1-gamma 3 [Brachypodium distachyon]
Length=413

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY DENTVS+VT+NKVG
Sbjct  263  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSYVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIG+E PFKVKGLWLFRG++IPKFV+DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLCRKYAFGKMLVIGTEAPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDI  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEG+ALLDAKCFK
Sbjct  383  SDEAQKERVSAMIEDLEPFEGQALLDAKCFK  413



>ref|XP_010475804.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X1 [Camelina 
sativa]
Length=415

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFR VAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  265  SPMVLDDWKRLYSNTKSNFRGVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  324

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  325  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  384

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  TDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>gb|AHC03515.1| gamma class glutathione S-transferase [Larix kaempferi]
Length=422

 Score =   284 bits (727),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYN+ENTVSFVT+NKV 
Sbjct  272  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNEENTVSFVTLNKVT  331

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG   PFKVKGLWLFRG EIPKFV+DECYDMELYEW +VDI
Sbjct  332  GFLQRMDLARKYAFGKMLIIGENGPFKVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDI  391

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQ+ERV+ MIED EPFEGE LLDAKCFK
Sbjct  392  NDEAQRERVNTMIEDQEPFEGEPLLDAKCFK  422



>ref|XP_010458260.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFR VAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  265  SPMVLDDWKRLYSNTKSNFRGVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  324

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKML+ GSE PFKV GLWLFRG EIPKF++DE YDMELYEW +VDI
Sbjct  325  GFLQRMDLARKYSFGKMLICGSEGPFKVTGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  384

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>emb|CDY20681.1| BnaC08g13770D [Brassica napus]
Length=558

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  262  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  321

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+ GSE PFK KGLWLFRG EIPKFV+DE YDMELYEW +VDI
Sbjct  322  GFLQRMDLARKYAFGKMLICGSEGPFKAKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  381

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCF  217
            +D AQKERVSQMIEDAEPFEGEALLDAKCF
Sbjct  382  SDEAQKERVSQMIEDAEPFEGEALLDAKCF  411



>ref|XP_003571724.1| PREDICTED: elongation factor 1-gamma 2 [Brachypodium distachyon]
Length=417

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WK+LYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKY++ENTVS+VT+NKVG
Sbjct  267  SKMILDDWKKLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYDEENTVSYVTLNKVG  326

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSE PFKVKGLWLFRG EIPKFVL+E YDMELYEW +VDI
Sbjct  327  GFLQRMDLCRKYAFGKMLVIGSEAPFKVKGLWLFRGTEIPKFVLEEVYDMELYEWTKVDI  386

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKER S MIED EPF+GEALLDAKCFK
Sbjct  387  SDEAQKERASAMIEDLEPFDGEALLDAKCFK  417



>gb|ABK25057.1| unknown [Picea sitchensis]
Length=424

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NKV 
Sbjct  274  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVT  333

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG E PFKVKGLWLFRG EIPKF +DECYDMELYEW +VD+
Sbjct  334  GFLQRMDLARKYAFGKMLIIGKEGPFKVKGLWLFRGPEIPKFFVDECYDMELYEWTKVDL  393

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKE V+ MIED EPFEGE LLDAKCFK
Sbjct  394  NDEAQKELVNAMIEDQEPFEGEPLLDAKCFK  424



>gb|EMT01475.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=604

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWK+LYSNTKTNFREVAIKGFWDMYDPEGYSLWFCD+KYN+ENTVSFVTMNKVG
Sbjct  454  SKMILDEWKKLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDFKYNEENTVSFVTMNKVG  513

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFL RMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG +IPKFV++E YDM LY+W +VD+
Sbjct  514  GFLLRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPKIPKFVMEEVYDMALYDWAKVDL  573

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVS MIED EPFEGEALLDAKCFK
Sbjct  574  SDAAQKERVSAMIEDLEPFEGEALLDAKCFK  604



>ref|NP_001235707.1| elongation factor 1-gamma [Glycine max]
 gb|AAL82617.1|AF475939_1 elongation factor 1-gamma [Glycine max]
Length=420

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYK +DENTVSFVT+NKVG
Sbjct  270  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKNHDENTVSFVTLNKVG  329

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFL RMDLA KY FGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYDM+L+ W +VDI
Sbjct  330  GFLHRMDLAPKYPFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMDLHGWTKVDI  389

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D A KER +QMIED EPFEGEALLDAKCFK
Sbjct  390  SDEAPKERFNQMIEDYEPFEGEALLDAKCFK  420



>gb|KGN56266.1| hypothetical protein Csa_3G110630 [Cucumis sativus]
Length=402

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 138/151 (91%), Gaps = 7/151 (5%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  259  SSMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  318

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMD+ARKYA G MLVI       + GLWLFRGKEIP+FVLDECYDMELYEWK+VDI
Sbjct  319  GFLQRMDIARKYALGNMLVI-------LSGLWLFRGKEIPQFVLDECYDMELYEWKKVDI  371

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  372  SDEAQKERVSQMIEDQEPFEGEALLDAKCFK  402



>gb|EMS60520.1| Elongation factor 1-gamma 2 [Triticum urartu]
Length=413

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTK+NF +VAIKGFW+MYDPEGYSLWFCDYKY +ENTVS+VT+NKVG
Sbjct  263  SKMVLDDWKRLYSNTKSNFHDVAIKGFWEMYDPEGYSLWFCDYKYQEENTVSYVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSE PFKVKGLWLFRG++IP+FV++E YDMELYEW +VD+
Sbjct  323  GFLQRMDLCRKYAFGKMLVIGSEAPFKVKGLWLFRGQDIPEFVMNEVYDMELYEWTKVDL  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQK+RV  MIED EPFEG+ALLDAKCFK
Sbjct  383  SDEAQKKRVEAMIEDLEPFEGQALLDAKCFK  413



>gb|AIW07751.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07752.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07753.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07754.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07755.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07756.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07757.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07758.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07761.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07762.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07763.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07764.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07765.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07766.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07767.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07768.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07771.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07772.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07773.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07774.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07775.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07776.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07779.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07780.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07783.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07784.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07785.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07786.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07787.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07788.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07789.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07790.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07791.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07792.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07793.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07794.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07795.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07796.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07797.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07798.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07799.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07800.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07801.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07802.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07803.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07804.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07805.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07806.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07807.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07808.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07809.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07810.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07811.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07813.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07814.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07815.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07816.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07817.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07818.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07819.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07820.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07821.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07822.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07823.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07824.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07825.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07826.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07827.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07828.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07829.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07830.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07831.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07832.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07833.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07834.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07837.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07838.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07841.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07842.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07844.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07845.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07846.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07847.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07848.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07849.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07850.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07851.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07852.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07853.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07854.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07855.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07856.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07857.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07858.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07859.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07860.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07861.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07862.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07864.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
Length=182

 Score =   262 bits (669),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV 
Sbjct  43   SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVT  102

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG + PFKVKGLWLFRG EIPKFV+DECYDMELYEW +VDI
Sbjct  103  GFLQRMDLARKYAFGKMLIIGEKGPFKVKGLWLFRGPEIPKFVIDECYDMELYEWTKVDI  162

Query  306  NDPAQKERVSQMIEDAEPFE  247
            ND AQKERV+ MIED EPFE
Sbjct  163  NDEAQKERVNAMIEDQEPFE  182



>gb|AIW07759.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07760.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07769.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07770.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07781.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07782.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07812.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07835.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07836.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07839.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07840.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07843.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07863.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
Length=182

 Score =   261 bits (668),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV 
Sbjct  43   SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVT  102

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IG + PFKVKGLWLFRG EIPKFV+DECYDMELYEW +VDI
Sbjct  103  GFLQRMDLARKYAFGKMLIIGEKGPFKVKGLWLFRGPEIPKFVIDECYDMELYEWTKVDI  162

Query  306  NDPAQKERVSQMIEDAEPFE  247
            ND AQKERV+ MIED EPFE
Sbjct  163  NDDAQKERVNAMIEDQEPFE  182



>gb|EMT20600.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=413

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLYSNTK+NF +VA+KGFW+MYDPEGYSLWFCDYKY +ENTVS+VT+NKVG
Sbjct  263  SKMVLDDWKRLYSNTKSNFHDVAVKGFWEMYDPEGYSLWFCDYKYQEENTVSYVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKMLVIGSE PFKVKGLWLFRG++IP+FV++E YDMELYEW +VD+
Sbjct  323  GFLQRMDLCRKYAFGKMLVIGSEAPFKVKGLWLFRGQDIPEFVMNEVYDMELYEWTKVDL  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQK+RV  MIED EPFEG+ALLDAKCFK
Sbjct  383  SDEAQKKRVEAMIEDLEPFEGQALLDAKCFK  413



>gb|AIW07777.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07778.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
Length=182

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV 
Sbjct  43   SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVT  102

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAF KML+IG + PFKVKGLWLFRG EIPKFV+DECYDMELYEW +VDI
Sbjct  103  GFLQRMDLARKYAFAKMLIIGEKGPFKVKGLWLFRGPEIPKFVIDECYDMELYEWTKVDI  162

Query  306  NDPAQKERVSQMIEDAEPFE  247
            ND AQKERV+ MIED EPFE
Sbjct  163  NDEAQKERVNAMIEDQEPFE  182



>gb|EEC80835.1| hypothetical protein OsI_23436 [Oryza sativa Indica Group]
Length=458

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 143/193 (74%), Gaps = 42/193 (22%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIK-----------------------------------  592
            SKMILDEWKRLYSNTKTNFRE+AIK                                   
Sbjct  266  SKMILDEWKRLYSNTKTNFREIAIKAPAPAPPLLELELSQTVSAPPKLGVELGGALSQNR  325

Query  591  -------GFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKML  433
                   GFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDL RKYAFGKML
Sbjct  326  HYHVYFPGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKML  385

Query  432  VIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEP  253
            VIGS PPFKVKGLWLFRG++IPKFV+DE YDMELYEW +VD++D AQKERV+ MIED EP
Sbjct  386  VIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDLSDEAQKERVNAMIEDQEP  445

Query  252  FEGEALLDAKCFK  214
            FEGE LLDAKCFK
Sbjct  446  FEGEDLLDAKCFK  458



>dbj|BAH56923.1| AT1G57720 [Arabidopsis thaliana]
Length=391

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 124/151 (82%), Gaps = 22/151 (15%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVT+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGK                      IPKF++DE YDMELYEW +VDI
Sbjct  323  GFLQRMDLARKYSFGK----------------------IPKFIMDEVYDMELYEWTKVDI  360

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  361  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  391



>ref|XP_011099002.1| PREDICTED: elongation factor 1-gamma 2-like [Sesamum indicum]
Length=391

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 121/151 (80%), Gaps = 27/151 (18%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV 
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKML+IGSE P+K                           WK+VD+
Sbjct  328  GFLQRMDLARKYAFGKMLIIGSEAPYK---------------------------WKKVDV  360

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ND AQKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  361  NDEAQKERVNQMIEDAEPFEGEALLDAKCFK  391



>ref|XP_002973046.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
 gb|EFJ26267.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
Length=418

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKT-NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  490
            S M+LD+WKRLYSNTK  +F EVA+KGFWDMYDPEGYSLWFCDYKYNDENTV FVTMNKV
Sbjct  267  SPMVLDDWKRLYSNTKAKDFAEVALKGFWDMYDPEGYSLWFCDYKYNDENTVPFVTMNKV  326

Query  489  GGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
             GFLQRMD  RKYAF K+ ++G +PP+K+KG+WLFRG EIP+ V DECYD+ELYEW + D
Sbjct  327  SGFLQRMDFIRKYAFAKICILGDQPPYKIKGVWLFRGPEIPQQVRDECYDLELYEWTKAD  386

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
              D   KER++   E+ +  EGE LL+AKCFK
Sbjct  387  PTDHVHKERINAYFEEPDVIEGEKLLEAKCFK  418



>ref|XP_002984514.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
 gb|EFJ14564.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
Length=430

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKT-NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKV  490
            S M+LD+WKRLYSNTK  +F EVA+KGFW+MYDPEGYSLWFCDYKYNDENTV FVTMNKV
Sbjct  279  SPMVLDDWKRLYSNTKAKDFAEVALKGFWEMYDPEGYSLWFCDYKYNDENTVPFVTMNKV  338

Query  489  GGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
             GFLQRMD  RKYAF K+ ++G +PPFK+KG+WLFRG EIP+ V DECYD+ELYEW + D
Sbjct  339  SGFLQRMDFIRKYAFAKICILGDQPPFKIKGVWLFRGPEIPQQVRDECYDLELYEWTKAD  398

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
              D   KER++   E+ +  EGE LL+AKCFK
Sbjct  399  PTDHVHKERINAYFEEPDVIEGEKLLEAKCFK  430



>gb|AFP90271.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKAPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90278.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKSPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90281.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   213 bits (543),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDQAQKERVNAMIEDQEPFEGE  116



>gb|AFP90241.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90242.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90243.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90245.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90248.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90249.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90250.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90251.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90252.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90256.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90257.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90259.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90260.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90261.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
 gb|AFP90262.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90263.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90266.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90267.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90269.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90270.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90272.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90273.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90274.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90279.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90280.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
 gb|AFP90283.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90284.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90285.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90286.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90287.1| elongation factor 1-gamma 1, partial [Pinus armandii]
Length=117

 Score =   213 bits (542),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90255.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   212 bits (540),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDME+YEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMEMYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90268.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV  MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVYAMIEDQEPFEGE  116



>ref|XP_001771013.1| predicted protein [Physcomitrella patens]
 gb|EDQ64168.1| predicted protein [Physcomitrella patens]
 gb|AFZ39147.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=431

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD WKRLYSNTK     +AI GFW+M+D EGYSLWFCDYKYNDEN V+FVTMNKVG
Sbjct  281  SPMVLDNWKRLYSNTKAKDFHLAISGFWEMFDAEGYSLWFCDYKYNDENQVTFVTMNKVG  340

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKM ++G E P+K+KG+WLFRG E+P+ VLDE YD ELY+W +VDI
Sbjct  341  GFLQRMDLMRKYAFGKMCILGEEAPYKIKGVWLFRGLEMPQMVLDEVYDAELYDWTKVDI  400

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            N+  QK  V+   E+ +  +GE LL+AKCFK
Sbjct  401  NNEEQKALVNAYFEEPDTIQGEKLLEAKCFK  431



>gb|AFP90265.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML++G + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIMGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90276.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90277.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   212 bits (539),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND A KERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAHKERVNAMIEDQEPFEGE  116



>gb|AFP90258.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   211 bits (537),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLW C+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWICEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|KGN56265.1| hypothetical protein Csa_3G110620 [Cucumis sativus]
Length=379

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 115/151 (76%), Gaps = 31/151 (21%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWK LYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  260  SSMILDEWKCLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  319

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMD+AR                                VLDECYDMELYEWK+VDI
Sbjct  320  GFLQRMDIARN-------------------------------VLDECYDMELYEWKKVDI  348

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +D AQKERVSQMIED EPFEGEALLDAKCFK
Sbjct  349  SDEAQKERVSQMIEDQEPFEGEALLDAKCFK  379



>gb|AFP90264.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELY W +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYGWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90247.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYD ELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDKELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90253.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   210 bits (535),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLF G EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFLGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90275.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   210 bits (534),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DEC DMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECNDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>ref|XP_001758671.1| predicted protein [Physcomitrella patens]
 gb|EDQ76649.1| predicted protein [Physcomitrella patens]
 gb|AFZ39148.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LD WKRLYSNTK     +AI GFW+M+D EGYSLWFCDYKYNDEN V+FVTMNKVG
Sbjct  278  SPMVLDNWKRLYSNTKAKDFHLAISGFWEMFDAEGYSLWFCDYKYNDENQVTFVTMNKVG  337

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDL RKYAFGKM ++G E PFK++G+WLFRG+++P+ V+DE YD ELY+W +VDI
Sbjct  338  GFLQRMDLVRKYAFGKMCILGEEAPFKIRGVWLFRGQDMPQMVMDEVYDAELYDWTKVDI  397

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ++  QK  V+   E+ +  +GE LL+AKCFK
Sbjct  398  SNEEQKTLVNAYFEEPDTIQGEKLLEAKCFK  428



>gb|AFP90246.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   210 bits (534),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG +  F
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGLF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90254.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   209 bits (533),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW +VDIND AQKE V+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKECVNAMIEDQEPFEGE  116



>gb|AFP90282.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLWLFRG EIPKFV+DECYDMELYEW  VDIND AQKERV+ MIED E FEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTNVDINDEAQKERVNAMIEDQELFEGE  116



>ref|XP_001774148.1| predicted protein [Physcomitrella patens]
 gb|EDQ61062.1| predicted protein [Physcomitrella patens]
 gb|AFZ39149.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            + M+LD WKRLYSNTK     +AI GFW+M+D EG+SLWFCDYKYNDEN V+FVTMNKVG
Sbjct  278  TPMVLDNWKRLYSNTKAKDFHLAISGFWEMFDAEGWSLWFCDYKYNDENQVTFVTMNKVG  337

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKY+FGKM ++G  PP+K+KG+WLFRG ++P+ VLDE YD ELYEW +VDI
Sbjct  338  GFLQRMDLARKYSFGKMCILGENPPYKIKGVWLFRGLDVPQMVLDEVYDAELYEWTKVDI  397

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             +  QK  V+   E+ +  +GE LL+AKCFK
Sbjct  398  TNEEQKALVNAYFEEPDTIQGEKLLEAKCFK  428



>gb|AFP90244.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  588  FWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  409
            FWDMYDPEGYSLWFC+YKYNDENTVS+VT+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  408  KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGE  241
            KVKGLW FRG EIPKFV+DECYD+ELYEW +VDIND AQKERV+ MIED EPFEGE
Sbjct  61   KVKGLWPFRGPEIPKFVMDECYDVELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>ref|XP_004172027.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like, 
partial [Cucumis sativus]
Length=363

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/105 (95%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  259  SSMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  318

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLD  352
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFVLD
Sbjct  319  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVLD  363



>ref|XP_004134257.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus]
Length=364

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/102 (92%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S MILDEWK LYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVG
Sbjct  260  SSMILDEWKCLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  319

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKF  361
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+F
Sbjct  320  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQF  361



>dbj|BAD94101.1| hypothetical protein [Arabidopsis thaliana]
Length=102

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -2

Query  516  VSFVTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDM  337
            VSFVT+NKVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YDM
Sbjct  2    VSFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDM  61

Query  336  ELYEWKQVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            ELYEW +VDI+D AQKERVSQ+IEDAEPFEGEALLDAKCFK
Sbjct  62   ELYEWTKVDISDEAQKERVSQVIEDAEPFEGEALLDAKCFK  102



>ref|NP_001167773.1| hypothetical protein [Zea mays]
 gb|ACN26025.1| unknown [Zea mays]
Length=96

 Score =   174 bits (440),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = -2

Query  501  MNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEW  322
            MNKVGGFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YDMELYEW
Sbjct  1    MNKVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEW  60

Query  321  KQVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             +VD++D AQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  61   TKVDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK  96



>gb|ABR25394.1| elongation factor 1-gamma 3 [Oryza sativa Indica Group]
Length=94

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -2

Query  495  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQ  316
            KVGGFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YDMELYEW +
Sbjct  1    KVGGFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTK  60

Query  315  VDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            VD++D AQKERV+ MIED EPFEGE LLDAKCFK
Sbjct  61   VDLSDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  94



>ref|XP_007041191.1| Elongation factor 1-gamma 3, putative [Theobroma cacao]
 gb|EOX97022.1| Elongation factor 1-gamma 3, putative [Theobroma cacao]
Length=231

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 92/130 (71%), Gaps = 34/130 (26%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKMILDEWKR YSNT+TNFREVAIKG                                  
Sbjct  136  SKMILDEWKRPYSNTETNFREVAIKG----------------------------------  161

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGL LFRG+EIP+FVLDECYD+ELYEWK+VDI
Sbjct  162  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLLLFRGQEIPQFVLDECYDVELYEWKKVDI  221

Query  306  NDPAQKERVS  277
            +  AQKERVS
Sbjct  222  SAEAQKERVS  231



>ref|XP_005645852.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE21308.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
Length=441

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 114/170 (67%), Gaps = 19/170 (11%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTK-TNFREVAIKGFWDM-----------YDPEGYSLWFCDYKYNDE  523
            SKMI+D WKRLYSNT    F+E+ + G W+            +DPEGYS+WFC+YKY +E
Sbjct  272  SKMIMDSWKRLYSNTPGAKFKEICVNGLWNGADIPNSPNNEGFDPEGYSIWFCEYKYPEE  331

Query  522  NTVSFVTMNK------VGGFLQRMDLARKYAFGKMLVIGSEP-PFKVKGLWLFRGKEIPK  364
            NTV+F+ MNK      VGGFLQR+D  RK+AF  M ++  +   F ++G+W+FRG+EIP 
Sbjct  332  NTVNFIVMNKACTSPPVGGFLQRIDYVRKHAFAVMSILKDDKGQFPIRGMWIFRGQEIPA  391

Query  363  FVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             +++EC+D+ LYEW +VD +D A +ER+S ++ + +  +G   ++ K FK
Sbjct  392  IMVEECFDLPLYEWNKVDTSDAAVRERISSLLCEEDKIDGLENVEVKVFK  441



>ref|XP_004341586.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR19500.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
Length=408

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            +K+ LDEWKR YSN   +  +VA+  FW+ +D EG+SLW  DYKYNDE T  F+T N VG
Sbjct  260  TKLDLDEWKRTYSNN--DILKVAMPWFWEHFDAEGWSLWLSDYKYNDELTKMFMTSNLVG  317

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GFLQRMD  RKY FG +L+ G EP  ++ GLWLFRG E+P+  L E  D E + W +VD 
Sbjct  318  GFLQRMDKLRKYGFGSLLIFGEEPKLQIGGLWLFRGTELPE-ELWENPDAEHHTWTKVDH  376

Query  306  NDPAQKERV  280
             DPAQ++ V
Sbjct  377  ADPAQRKLV  385



>gb|ETL96568.1| hypothetical protein L917_05966, partial [Phytophthora parasitica]
Length=149

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N VG
Sbjct  2    SSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVG  59

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ +
Sbjct  60   GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  118

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  119  LNDET-KARVAAYWCNEDELEGKPIADSKVFK  149



>emb|CCI44608.1| unnamed protein product [Albugo candida]
Length=407

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 92/152 (61%), Gaps = 4/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LDEWK  YSNTK      ++K FWD +D EGYS+W CDY YNDEN V F+T N + 
Sbjct  259  SKMVLDEWKVQYSNTKPVID--SMKWFWDNFDSEGYSIWMCDYNYNDENKVLFMTSNAIN  316

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GF+QR +  RK+AFG M + G E     + G WLFRG  I   +++   D E Y WK+V 
Sbjct  317  GFIQRSEGVRKFAFGVMHICGKEGSKLNITGCWLFRGDTI-DHMMEANPDAEYYTWKRVA  375

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
              D A K R++    +    EGE L D++ FK
Sbjct  376  TFDDASKARIAAYWCNDNELEGEPLADSRVFK  407



>gb|ETM49712.1| hypothetical protein L914_06089, partial [Phytophthora parasitica]
Length=191

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N VG
Sbjct  44   SSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVG  101

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ +
Sbjct  102  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  160

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  161  LNDET-KARVAAYWCNEDELEGKPIADSKVFK  191



>gb|EXX52334.1| Tef4p [Rhizophagus irregularis DAOM 197198w]
Length=292

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 92/151 (61%), Gaps = 3/151 (2%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S + L+EWKR+YSN  T  R  AI  FW+ +DPEGYS+W  DYKYNDE T  F++ N +G
Sbjct  145  SSLNLEEWKRVYSNNDT--RPTAINWFWENFDPEGYSIWRVDYKYNDELTKVFMSSNLIG  202

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GF  R++ ARKYAFG ++V+G +    + G ++ RG+E+P+ V D   D E Y + +VD 
Sbjct  203  GFFNRLERARKYAFGSLVVLGEDNANSIAGYFVIRGQEVPEEVYDAA-DFESYTFNKVDH  261

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             DP+ K      I      +G+   D K FK
Sbjct  262  TDPSVKSSFEDYIAWDGHLDGKKYADGKIFK  292



>emb|CCA15330.1| calciumdependent protein 1 putative [Albugo laibachii Nc14]
Length=422

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 94/153 (61%), Gaps = 6/153 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LDEWK  YSNTK      ++K FWD +D EGYS+W CDY YN+EN V F+T N V 
Sbjct  274  SKMVLDEWKVQYSNTKP--VSDSMKWFWDNFDSEGYSIWMCDYNYNEENKVLFMTSNAVN  331

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GF+QR +  RK+AFG M + G E     + G WLFRG  + + +++   D E Y WK+V 
Sbjct  332  GFIQRSEGVRKFAFGVMHICGEEGSKLDITGCWLFRGDTV-EHIMEANPDAEYYTWKRVT  390

Query  309  INDPAQKERVSQM-IEDAEPFEGEALLDAKCFK  214
              D A K R++     DAE  EG  L D++ FK
Sbjct  391  TFDDASKARIAAYWCNDAE-LEGRPLADSRVFK  422



>gb|ETK89973.1| hypothetical protein L915_06156, partial [Phytophthora parasitica]
 gb|ETL43374.1| hypothetical protein L916_06091, partial [Phytophthora parasitica]
Length=235

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N VG
Sbjct  88   SSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVG  145

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ +
Sbjct  146  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  204

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  205  LNDET-KARVAAYWCNEDELEGKPIADSKVFK  235



>emb|CBK20805.2| unnamed protein product [Blastocystis hominis]
Length=248

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 94/149 (63%), Gaps = 4/149 (3%)
 Frame = -2

Query  654  LDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQ  475
            LD WKR+YSNT ++F  V  K FW MYD EG+S W CDY YN+ENT  F+T N V GF+Q
Sbjct  102  LDNWKRIYSNTHSDFYSVMDK-FWPMYDQEGWSCWICDYMYNEENTRGFMTANLVSGFIQ  160

Query  474  RMDLARKYAFGKMLVI--GSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDIND  301
            R D  RKYAFG M ++   +EP ++V G WL RG  I + +LDE  D   Y W++VD+ +
Sbjct  161  RSDSLRKYAFGNMNILKDANEPFYRVMGGWLIRGTAI-QPMLDENPDAAYYNWRKVDVTN  219

Query  300  PAQKERVSQMIEDAEPFEGEALLDAKCFK  214
               K+ ++ +   +E  +G+ +   + FK
Sbjct  220  EDDKKLLADLWCASETIQGKEINSNEVFK  248



>gb|ESA05922.1| hypothetical protein GLOINDRAFT_349960 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52332.1| Tef4p [Rhizophagus irregularis DAOM 197198w]
Length=413

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 92/151 (61%), Gaps = 3/151 (2%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S + L+EWKR+YSN  T  R  AI  FW+ +DPEGYS+W  DYKYNDE T  F++ N +G
Sbjct  266  SSLNLEEWKRVYSNNDT--RPTAINWFWENFDPEGYSIWRVDYKYNDELTKVFMSSNLIG  323

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GF  R++ ARKYAFG ++V+G +    + G ++ RG+E+P+ V D   D E Y + +VD 
Sbjct  324  GFFNRLERARKYAFGSLVVLGEDNANSIAGYFVIRGQEVPEEVYDAA-DFESYTFNKVDH  382

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             DP+ K      I      +G+   D K FK
Sbjct  383  TDPSVKSSFEDYIAWDGHLDGKKYADGKIFK  413



>ref|XP_008867564.1| hypothetical protein H310_04829 [Aphanomyces invadans]
 gb|ETW03335.1| hypothetical protein H310_04829 [Aphanomyces invadans]
Length=418

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 93/152 (61%), Gaps = 4/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SK+  D+WK  YSNTK   +  A++  WD YDPEGYS WFC Y YN ENT  F+T N V 
Sbjct  270  SKLKFDDWKVTYSNTKPLSK--AMQWLWDNYDPEGYSFWFCTYNYNQENTKLFMTCNAVS  327

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPF-KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RK++FG   V+G+E    ++ G W+FRG+ + + +L+   D E Y W +V+
Sbjct  328  GFLQRSEAMRKFSFGVQSVLGAEGGLIEIVGCWMFRGQSV-EHMLEANPDAEYYTWTKVE  386

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            + D A K R+ +     E  +G+ + D K FK
Sbjct  387  VLDDAAKARIEEYFCSEETIDGKVIADGKVFK  418



>emb|CBK21757.2| unnamed protein product [Blastocystis hominis]
Length=392

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 94/149 (63%), Gaps = 4/149 (3%)
 Frame = -2

Query  654  LDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQ  475
            LD WKR+YSNT ++F  V  K FW MYD EG+S W CDY YN+ENT  F+T N V GF+Q
Sbjct  246  LDNWKRIYSNTHSDFYSVMDK-FWPMYDQEGWSCWICDYMYNEENTRGFMTANLVSGFIQ  304

Query  474  RMDLARKYAFGKMLVI--GSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDIND  301
            R D  RKYAFG M ++   +EP ++V G WL RG  I + +LDE  D   Y W++VD+ +
Sbjct  305  RSDSLRKYAFGNMNILKDANEPFYRVMGGWLIRGTAI-QPMLDENPDAAYYNWRKVDVTN  363

Query  300  PAQKERVSQMIEDAEPFEGEALLDAKCFK  214
               K+ ++ +   +E  +G+ +   + FK
Sbjct  364  EDDKKLLADLWCASETIQGKEINSNEVFK  392



>ref|NP_001184949.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 dbj|BAH56947.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28473.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=265

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = -2

Query  432  VIGSEPPF-KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDINDPAQKERVSQMIEDAE  256
             + ++P F KVKGLWLFRG EIPKF++DE YDMELYEW +VDI+D AQKERVSQMIEDAE
Sbjct  192  TVVNQPNFTKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDISDEAQKERVSQMIEDAE  251

Query  255  PFEGEALLDAKCFK  214
            PFEGEALLDAKCFK
Sbjct  252  PFEGEALLDAKCFK  265



>gb|ETK89994.1| hypothetical protein L915_06152 [Phytophthora parasitica]
 gb|ETL43394.1| hypothetical protein L916_06088 [Phytophthora parasitica]
Length=404

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N VG
Sbjct  257  SSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVG  314

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ +
Sbjct  315  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  373

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  374  LND-ETKARVAAYWCNEDELEGKPIADSKVFK  404



>gb|ETP19871.1| hypothetical protein F441_06281 [Phytophthora parasitica CJ01A1]
Length=407

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N VG
Sbjct  260  SSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVG  317

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ +
Sbjct  318  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  376

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  377  LND-ETKARVAAYWCNEDELEGKPIADSKVFK  407



>ref|XP_008891718.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETL43385.1| hypothetical protein L916_06090 [Phytophthora parasitica]
 gb|ETN22469.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETO78816.1| hypothetical protein F444_06339 [Phytophthora parasitica P1976]
 gb|ETP19873.1| hypothetical protein F441_06283 [Phytophthora parasitica CJ01A1]
Length=406

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S + LD WK  YSNTK N  + A+  FW+  D EGYSLWFCDY YN ENT  F+T N VG
Sbjct  259  SSLNLDAWKVQYSNTK-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVG  316

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ +
Sbjct  317  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  375

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  376  LNDET-KARVAAYWCNEDELEGKPIADSKVFK  406



>ref|XP_002901767.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
 gb|EEY57157.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
Length=406

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 95/152 (63%), Gaps = 5/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S + LD WK  YSNT+ N  + A+  FW+  D EGYSLWFCDY YN+ENT  F+T N VG
Sbjct  259  SSLNLDAWKVQYSNTR-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNNENTKMFMTCNAVG  316

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ +
Sbjct  317  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  375

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  376  LNDET-KARVAAYWCNEDELEGKPIADSKVFK  406



>ref|XP_006680023.1| hypothetical protein BATDEDRAFT_37118 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79252.1| hypothetical protein BATDEDRAFT_37118 [Batrachochytrium dendrobatidis 
JAM81]
Length=411

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 95/151 (63%), Gaps = 3/151 (2%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M+LDEWKR+YSN  T  R  A+  FW  +DP+GYS++  DYKYN E  + F++ N VG
Sbjct  264  SSMVLDEWKRVYSNNDT--RPTAVDWFWANFDPQGYSIYKVDYKYNSELAMVFMSSNLVG  321

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GF QR++ +RKYAFG ++++G +   ++ G ++FRG+ IP F + +C D E Y++ +VD 
Sbjct  322  GFFQRLESSRKYAFGSLVILGEDGNNQITGYFVFRGQGIP-FEVSDCPDFESYDFVKVDH  380

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             D A +     ++   E   G+   D K FK
Sbjct  381  TDSAVRAEFEAVLAWDETINGKKCADGKIFK  411



>ref|XP_002901771.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
 gb|EEY57161.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
Length=367

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 6/155 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S + LD WK  YSNT+ N  + A+  FW+  D EGYSLWFCDY YN+ENT  F+T N VG
Sbjct  218  SSLNLDAWKVQYSNTR-NLAD-AMTWFWEHLDTEGYSLWFCDYNYNNENTKMFMTCNAVG  275

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y WK+ +
Sbjct  276  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  334

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK*AH  205
            +ND   K RV+    + +  EG+ + D+K F  AH
Sbjct  335  LND-ETKARVAAYWCNEDELEGKPIADSKVFN-AH  367



>ref|XP_009519315.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
 gb|ACH68459.1| calcium-dependent protein 1 [Phytophthora sojae]
 gb|EGZ24027.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
Length=405

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 92/152 (61%), Gaps = 5/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M LD WK  YSNTK      A+K FW+  D EGYSLWFCDY YN ENT  F+T N VG
Sbjct  258  SSMNLDAWKVQYSNTKD--LADAMKWFWEHLDTEGYSLWFCDYNYNKENTKMFMTCNAVG  315

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y W + +
Sbjct  316  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMVEANPDAEYYTWTKAE  374

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +ND   K R++    + +  EG+ + D+K FK
Sbjct  375  LNDET-KARIAAYWCNEDELEGKPIADSKVFK  405



>ref|XP_009519320.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
 gb|EGZ24032.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
Length=451

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 92/152 (61%), Gaps = 5/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S M LD WK  YSNTK      A+K FW+  D EGYSLWFCDY YN ENT  F+T N VG
Sbjct  304  SSMNLDAWKVQYSNTKD--LADAMKWFWEHLDTEGYSLWFCDYNYNKENTKMFMTCNAVG  361

Query  486  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y W + +
Sbjct  362  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMVEANPDAEYYTWTKAE  420

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +ND   K R++    + +  EG+ + D+K FK
Sbjct  421  LNDET-KARIAAYWCNEDELEGKPIADSKVFK  451



>emb|CDH60277.1| elongation factor 1 gamma domain-containingprotein [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=399

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 91/151 (60%), Gaps = 7/151 (5%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S  +LDEWKR+YSN  T   +VA+K FW+ +D EG+S+W  DY+YNDE T+ F++ N +G
Sbjct  256  SSFVLDEWKRMYSNNDT---DVAMKWFWENFDKEGWSIWRVDYRYNDELTLVFMSNNLIG  312

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GF  R++ ARKYAFG MLV G+     + G ++ RG+E+P     E YD   Y   + + 
Sbjct  313  GFFARLERARKYAFGSMLVTGTNNNNAISGYFIIRGQEVPY----EIYDAADYPSYKFEK  368

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             +P+Q E     IE    +E E   D K FK
Sbjct  369  IEPSQYEEKKDEIEKYMAWEVEGFADGKIFK  399



>gb|EPY23706.1| elongation factor 1-gamma [Strigomonas culicis]
Length=254

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 96/152 (63%), Gaps = 6/152 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SK++LD +KR YSN  T  R VA   F++ YDPEGY+ ++C YKYN++N V F+T N V 
Sbjct  108  SKLVLDAFKREYSNNDT--RAVAAPWFFNNYDPEGYTCFWCKYKYNEDNKVPFMTANLVR  165

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV-D  310
            G+ QRM+  RKYAFG  L+IG E   ++ G W+FRGK +P+ V  E  D E ++W ++ D
Sbjct  166  GWFQRMEHTRKYAFGVALIIGEEKGHEIVGFWVFRGKGMPEIVT-EVVDTENFDWTEIAD  224

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            I    +KE+++  +    P     +L+ + FK
Sbjct  225  IQ--KEKEQITDYLAWEGPTIPRPVLEGRVFK  254



>ref|XP_001562716.1| elongation factor-1 gamma [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM41841.1| elongation factor-1 gamma [Leishmania braziliensis MHOM/BR/75/M2904]
Length=403

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 96/151 (64%), Gaps = 4/151 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S  +LD +KR YSNT T  R VA   F++ YD EGY+ ++  YKYN+EN   F+T N V 
Sbjct  257  SNFVLDAYKREYSNTDT--RTVAAPYFFEHYDAEGYTCFWARYKYNEENKKQFMTANLVR  314

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            G+ QRM+  RKYAFG  L+IG +   ++ G W+FRGK +P+ V +E  D EL+EW+++  
Sbjct  315  GWFQRMEHLRKYAFGIALIIGEDTAHELMGFWVFRGKGMPEIV-NEVVDTELFEWEEIK-  372

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            N  A+KE+++  +    P     +L+ +CFK
Sbjct  373  NVQAEKEKITDYLCWEGPTIPRPVLEGRCFK  403



>emb|CDS05969.1| hypothetical protein LRAMOSA08497 [Absidia idahoensis var. thermophila]
Length=401

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 93/151 (62%), Gaps = 7/151 (5%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S  +LDEWKR+YSN  T   +VA+K FW+ +D EG+S+W  DY+YNDE T+ F++ N +G
Sbjct  258  SSFVLDEWKRMYSNNDT---DVAMKWFWENFDNEGWSIWRVDYRYNDELTLVFMSNNLIG  314

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GF  R++ ARKYAFG MLV G+     + G ++ RG+E+P  + D   D   Y++++V  
Sbjct  315  GFFARLERARKYAFGSMLVTGTNNNNAISGYFIIRGQEVPYEIYDAA-DYPSYKFEKV--  371

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             +P+Q       IE    +E E   D K FK
Sbjct  372  -EPSQYAEKKDEIEKYMAWEVEGFADGKIFK  401



>emb|CEP19706.1| hypothetical protein [Parasitella parasitica]
Length=411

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 93/151 (62%), Gaps = 7/151 (5%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SK I+D+WKR YSN  TN   VAIK FWD +DPEGYS+W  DYKYNDE T++F++ N +G
Sbjct  268  SKFIMDQWKREYSNNDTN---VAIKWFWDNFDPEGYSIWKVDYKYNDELTLTFMSNNLIG  324

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQVDI  307
            GF  R++ A KYAFG M+V G      + G ++ RG+E+P F + +  D   Y ++++  
Sbjct  325  GFYARLERAHKYAFGSMIVRGENNKNTISGYFVVRGQEVP-FEIYDAADYGSYNFQKI--  381

Query  306  NDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
             +PAQ E           ++ E  +D K FK
Sbjct  382  -EPAQYEEKKDEFYKYLAWDFEDCVDGKVFK  411



>gb|EPY29488.1| elongation factor 1-gamma [Strigomonas culicis]
Length=408

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 96/152 (63%), Gaps = 6/152 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SK++LD +KR YSN  T  R VA   F++ YDPEGY+ ++C YKYN++N V F+T N V 
Sbjct  262  SKLVLDAFKREYSNNDT--RAVAAPWFFNNYDPEGYTCFWCKYKYNEDNKVPFMTANLVR  319

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV-D  310
            G+ QRM+  RKYAFG  L+IG E   ++ G W+FRGK +P+ V  E  D E ++W ++ D
Sbjct  320  GWFQRMEHTRKYAFGVALIIGEEKGHEIVGFWVFRGKGMPEIVT-EVVDTENFDWTEIAD  378

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            I    +KE+++  +    P     +L+ + FK
Sbjct  379  IQK--EKEQITDYLAWEGPTIPRPVLEGRVFK  408



>gb|EPY20606.1| elongation factor 1-gamma [Strigomonas culicis]
Length=483

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 96/152 (63%), Gaps = 6/152 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SK++LD +KR YSN  T  R VA   F++ YDPEGY+ ++C YKYN++N V F+T N V 
Sbjct  337  SKLVLDAFKREYSNNDT--RAVAAPWFFNNYDPEGYTCFWCKYKYNEDNKVPFMTANLVR  394

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV-D  310
            G+ QRM+  RKYAFG  L+IG E   ++ G W+FRGK +P+ V  E  D E ++W ++ D
Sbjct  395  GWFQRMEHTRKYAFGVALIIGEEKGHEIVGFWVFRGKGMPEIV-TEVVDTENFDWTEIAD  453

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            I    +KE+++  +    P     +L+ + FK
Sbjct  454  IQK--EKEQITDYLAWEGPTIPRPVLEGRVFK  483



>ref|XP_008365338.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=331

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SKM+LD+WKRLY NTK  FREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVT+NK  
Sbjct  270  SKMVLDDWKRLYXNTKXYFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKTT  329

Query  486  G  484
            G
Sbjct  330  G  330



>ref|XP_003872780.1| elongation factor-1 gamma [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ24254.1| elongation factor-1 gamma [Leishmania mexicana MHOM/GT/2001/U1103]
Length=404

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 6/152 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S  +LD +KR YSNT T  R VA   F++ YD EGY+ ++  YKYN++N   F+T N V 
Sbjct  258  SSFVLDAYKREYSNTDT--RTVAAPYFFEHYDAEGYTCFWARYKYNEDNKKQFMTANLVR  315

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV-D  310
            G+ QRM+  RKYAFG  L+IG +   ++  LW+FRGK +P+ V  E  D EL+EW+++ D
Sbjct  316  GWFQRMEHVRKYAFGIALIIGEDAAHELTSLWVFRGKGMPEIV-SEVVDTELFEWEEIKD  374

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +   A+KE+++  +    P     +L+ +CFK
Sbjct  375  VQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  404



>ref|XP_010704334.1| elongation factor-1 gamma [Leishmania panamensis]
 gb|AIN96012.1| elongation factor-1 gamma [Leishmania panamensis]
Length=403

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 6/152 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S  +LD +KR YSNT T  R VA   F++ YD EGY+ ++  YKYN+EN   F+T N V 
Sbjct  257  SNFVLDAYKREYSNTDT--RTVAAPYFFEHYDAEGYTCFWARYKYNEENKKQFMTANLVR  314

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV-D  310
            G+ QRM+  RKYAFG  L+IG +   ++ G W+FRG  +P+ V +E  D EL+EW+++ D
Sbjct  315  GWFQRMEHLRKYAFGVALIIGEDTAHELMGFWVFRGTGMPEIV-NEVVDTELFEWEEIKD  373

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +   A+KE+++  +    P     +L+ +CFK
Sbjct  374  VQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  403



>ref|XP_009825362.1| hypothetical protein H257_03107 [Aphanomyces astaci]
 gb|ETV85344.1| hypothetical protein H257_03107 [Aphanomyces astaci]
Length=419

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 91/152 (60%), Gaps = 4/152 (3%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SK+  D+WK  YSNTK   +  A++  W+ +D EGYS WF  Y YN+EN   F+T N V 
Sbjct  271  SKLKFDDWKVTYSNTKPLSK--AMEWLWEHFDAEGYSFWFNKYNYNEENKKMFMTCNAVS  328

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPF-KVKGLWLFRGKEIPKFVLDECYDMELYEWKQVD  310
            GF+QR +  RK++FG   V+G E    ++ G WLFRG+EI + +L+   D E Y W +VD
Sbjct  329  GFIQRSEAMRKFSFGVQSVVGVEGGLIEIVGCWLFRGQEI-EHMLEANPDAEYYTWTKVD  387

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            + D A K R+ +     +  +G+ + D K FK
Sbjct  388  VLDDAAKARIEEYFCSEDTIDGKPIADGKVFK  419



>gb|EFA79702.1| glutathione S-transferase domain-containing protein [Polysphondylium 
pallidum PN500]
Length=432

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 89/156 (57%), Gaps = 8/156 (5%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            SK  L+EWKR+YSN  T  R VA+  FW+ YD EG+S++F  YKYN E    F+T N +G
Sbjct  261  SKFNLEEWKRMYSNNDT--RSVALPWFWENYDAEGFSVYFATYKYNSELGAQFMTSNLIG  318

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFK-----VKGLWLFRGKEIPKFVLDECYDMELYEW  322
            G  QR++   K+AF  +L+ G +   K     V G+W+FRG ++P+  L EC D  +Y+W
Sbjct  319  GMFQRLETLHKWAFASVLITGEDVEGKINNQEVTGIWIFRGADLPE-DLKECDDSIVYDW  377

Query  321  KQVDINDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            K +D+ DPA K  +           G   +  K +K
Sbjct  378  KLLDVKDPATKTLIDDYFAWDGALGGRKFIQGKLYK  413



>gb|EPY38232.1| elongation factor 1-gamma [Angomonas deanei]
Length=286

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 92/152 (61%), Gaps = 6/152 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S   LD +KR YSNT T  R VA    +  +D  G++ ++C YKYNDEN V F+T N   
Sbjct  140  SSFDLDSFKREYSNTDT--RTVAAPYLFSHFDAAGFTCFWCKYKYNDENKVPFMTANLCR  197

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV-D  310
            G+ QRM+  RKYAFG  L+IG E    + GLW+FRGK +P+ V D   D E ++W ++ D
Sbjct  198  GWFQRMEHTRKYAFGVALIIGEEKQHDIVGLWVFRGKGMPEIVTD-VVDTENFDWTEIKD  256

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            IN  A+KE+++  +    P  G  +L+ + FK
Sbjct  257  IN--AEKEKITDYLCWEGPTIGRPVLEGRTFK  286



>emb|CCC95849.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=406

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 94/152 (62%), Gaps = 6/152 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S  +LD +KR YSNT T  R VA   F+  YDP GY+ ++C YKYN++N + F+T N V 
Sbjct  260  SPFVLDNFKREYSNTDT--RTVAAPYFFSNYDPNGYTTFWCRYKYNEDNKMQFMTANLVR  317

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV-D  310
            G+ QRM+  RKYAFG  L+IG E    +  LW+FRGK +P  V D   D EL++W+++ D
Sbjct  318  GWFQRMEHTRKYAFGVALIIGEEKRHDIVALWVFRGKGMPDIVKD-VEDTELFDWEEIPD  376

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +   AQ+ER++       P   + +L+ + FK
Sbjct  377  VK--AQRERITDYFCWEGPTIPKPVLEGRVFK  406



>gb|AAS55635.1| elongation factor 1B gamma 2 [Crithidia fasciculata]
Length=407

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 6/152 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S  +LD +KR YSNT T  R VA   F+  YD EGY+ ++C YKYN+EN + F+T N V 
Sbjct  261  SSFVLDAFKREYSNTDT--RTVAAPYFFANYDAEGYTCYWCRYKYNEENKMQFMTANMVR  318

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV-D  310
            G+ QRM+  RKYAFG  L+IG +    + G+W+FRGK +P+ V  E  D EL++W+++ D
Sbjct  319  GWFQRMEHVRKYAFGIALLIGEDKKHDLVGMWVFRGKGMPEIV-SEVVDTELFDWEEIAD  377

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            +   A K++++  +    P     +L+ +CFK
Sbjct  378  VQ--AAKDKITDYLCWEGPTIPLPVLEGRCFK  407



>emb|CCC95841.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=406

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 93/152 (61%), Gaps = 6/152 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S  +LD +KR YSNT T  R VA   F+  YDP GY+ ++C YKYN++N + F+T N V 
Sbjct  260  SPFVLDNFKREYSNTDT--RTVAAPYFFSNYDPNGYTTFWCRYKYNEDNKMQFMTANLVR  317

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV-D  310
            G+ QRM+  RKYAFG  L+IG E    +  LW+FRGK +P  V D   D EL++W+++ D
Sbjct  318  GWFQRMEHTRKYAFGVALIIGEEKRHDIVALWVFRGKGMPDIVKD-VEDTELFDWEEIPD  376

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            I   AQ ER++       P   + +L+ + FK
Sbjct  377  IK--AQSERITDYFCWEGPTIPKPVLEGRVFK  406



>gb|EPY35413.1| elongation factor 1-gamma [Angomonas deanei]
Length=405

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 92/152 (61%), Gaps = 6/152 (4%)
 Frame = -2

Query  666  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  487
            S   LD +KR YSNT T  R VA    +  +D  G++ ++C YKYNDEN V F+T N   
Sbjct  259  SSFDLDSFKREYSNTDT--RTVAAPYLFSHFDAAGFTCFWCKYKYNDENKVPFMTANLCR  316

Query  486  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDMELYEWKQV-D  310
            G+ QRM+  RKYAFG  L+IG E    + GLW+FRGK +P+ V D   D E ++W ++ D
Sbjct  317  GWFQRMEHTRKYAFGVALIIGEEKQHDIVGLWVFRGKGMPEIVTD-VVDTENFDWTEIKD  375

Query  309  INDPAQKERVSQMIEDAEPFEGEALLDAKCFK  214
            IN  A+KE+++  +    P  G  +L+ + FK
Sbjct  376  IN--AEKEKITDYLCWEGPTIGRPVLEGRTFK  405



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566999573790