BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF018E07

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        293   3e-88   Sesamum indicum [beniseed]
dbj|BAD94991.1|  cytoplasmic aconitate hydratase                        276   3e-88   Arabidopsis thaliana [mouse-ear cress]
gb|KCW88791.1|  hypothetical protein EUGRSUZ_A01129                     285   9e-87   Eucalyptus grandis [rose gum]
emb|CDP10817.1|  unnamed protein product                                289   9e-87   Coffea canephora [robusta coffee]
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        288   1e-86   Solanum lycopersicum
dbj|BAE71240.1|  putative cytoplasmic aconitate hydratase               272   1e-86   Trifolium pratense [peavine clover]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        288   2e-86   Nicotiana tomentosiformis
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    286   6e-86   Solanum tuberosum [potatoes]
sp|O04916.1|ACOC_SOLTU  RecName: Full=Aconitate hydratase, cytopl...    279   6e-86   Solanum tuberosum [potatoes]
ref|XP_004158846.1|  PREDICTED: aconitate hydratase-like                265   7e-86   
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        286   1e-85   Nicotiana sylvestris
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        285   1e-85   Eucalyptus grandis [rose gum]
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           284   2e-85   Nicotiana tabacum [American tobacco]
ref|XP_010046453.1|  PREDICTED: aconitate hydratase, cytoplasmic        262   3e-85   
gb|EEC83021.1|  hypothetical protein OsI_28098                          278   3e-85   Oryza sativa Indica Group [Indian rice]
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             284   3e-85   Phaseolus vulgaris [French bean]
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    285   3e-85   Nicotiana sylvestris
dbj|BAG16527.1|  putative aconitase                                     285   3e-85   Capsicum chinense [bonnet pepper]
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      283   3e-85   Gossypium arboreum [tree cotton]
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        284   4e-85   Cucumis melo [Oriental melon]
gb|KHG08189.1|  hypothetical protein F383_11434                         282   5e-85   Gossypium arboreum [tree cotton]
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         284   6e-85   Jatropha curcas
gb|KJB30565.1|  hypothetical protein B456_005G149700                    282   6e-85   Gossypium raimondii
gb|KJB62843.1|  hypothetical protein B456_009G439700                    271   6e-85   Gossypium raimondii
gb|ADZ57218.1|  aconitase protein                                       282   7e-85   Litchi chinensis [litchi]
gb|KJB60835.1|  hypothetical protein B456_009G327800                    283   7e-85   Gossypium raimondii
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    283   1e-84   Gossypium arboreum [tree cotton]
ref|XP_010100637.1|  Aconitate hydratase                                282   1e-84   
gb|KJB30569.1|  hypothetical protein B456_005G149700                    283   1e-84   Gossypium raimondii
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        283   1e-84   Nelumbo nucifera [Indian lotus]
gb|KJB30566.1|  hypothetical protein B456_005G149700                    283   1e-84   Gossypium raimondii
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    281   3e-84   
ref|XP_003605929.1|  Aconitate hydratase                                281   3e-84   Medicago truncatula
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        281   4e-84   Fragaria vesca subsp. vesca
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    281   4e-84   Cucumis sativus [cucumbers]
emb|CAN62964.1|  hypothetical protein VITISV_029521                     271   5e-84   Vitis vinifera
ref|XP_010533008.1|  PREDICTED: aconitate hydratase 2, mitochondr...    275   6e-84   
gb|KDO62732.1|  hypothetical protein CISIN_1g001863mg                   278   6e-84   Citrus sinensis [apfelsine]
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    281   7e-84   Glycine max [soybeans]
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    281   7e-84   
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                        280   8e-84   Glycine soja [wild soybean]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    280   1e-83   Glycine max [soybeans]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    280   1e-83   Nicotiana tomentosiformis
gb|KHG02134.1|  hypothetical protein F383_25649                         280   1e-83   Gossypium arboreum [tree cotton]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        280   2e-83   Solanum lycopersicum
gb|KJB50479.1|  hypothetical protein B456_008G173400                    280   2e-83   Gossypium raimondii
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    280   2e-83   Glycine max [soybeans]
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        280   2e-83   Glycine soja [wild soybean]
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    278   2e-83   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    279   3e-83   Solanum tuberosum [potatoes]
gb|AAO62410.1|  aconitase                                               278   3e-83   Solanum pennellii
gb|KJB62847.1|  hypothetical protein B456_009G440000                    279   3e-83   Gossypium raimondii
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        278   3e-83   Glycine soja [wild soybean]
gb|AAP30039.1|  aconitase                                               278   3e-83   Solanum pennellii
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    279   4e-83   Cicer arietinum [garbanzo]
emb|CBE71057.1|  aconitate hydratase 3                                  277   4e-83   Citrus clementina [clementine]
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    278   4e-83   Glycine max [soybeans]
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                278   5e-83   Erythranthe guttata [common monkey flower]
gb|EEE68177.1|  hypothetical protein OsJ_26310                          278   6e-83   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008785076.1|  PREDICTED: putative aconitate hydratase, cyt...    266   6e-83   
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             278   6e-83   Citrus clementina [clementine]
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         277   7e-83   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001159192.1|  uncharacterized protein LOC100304277               261   8e-83   
gb|KDO54658.1|  hypothetical protein CISIN_1g001917mg                   275   8e-83   Citrus sinensis [apfelsine]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             278   8e-83   
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    278   9e-83   Nelumbo nucifera [Indian lotus]
ref|XP_007132547.1|  hypothetical protein PHAVU_011G1037000g            255   1e-82   Phaseolus vulgaris [French bean]
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    278   1e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001136484.1|  uncharacterized protein LOC100216599               269   1e-82   
gb|AFW61053.1|  hypothetical protein ZEAMMB73_482448                    270   1e-82   
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        277   2e-82   Vitis vinifera
emb|CDX97969.1|  BnaA06g07200D                                          277   2e-82   
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             277   2e-82   Eutrema salsugineum [saltwater cress]
ref|NP_178634.2|  aconitate hydratase 3                                 277   2e-82   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93088.1|  BnaA03g38100D                                          277   2e-82   
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    277   2e-82   Camelina sativa [gold-of-pleasure]
ref|XP_007045642.1|  Aconitase 3                                        276   2e-82   
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400          276   2e-82   Amborella trichopoda
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    276   3e-82   Arabis alpina [alpine rockcress]
ref|XP_003596988.1|  Aconitate hydratase                                276   4e-82   Medicago truncatula
emb|CDY18054.1|  BnaC07g04160D                                          276   4e-82   Brassica napus [oilseed rape]
gb|AAC26045.1|  aconitase-iron regulated protein 1                      275   4e-82   Citrus limon [lemon]
emb|CBE71058.1|  aconitate hydratase 2                                  275   4e-82   Citrus clementina [clementine]
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    276   5e-82   
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             276   5e-82   Prunus persica
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             275   6e-82   Populus trichocarpa [western balsam poplar]
emb|CDY50945.1|  BnaC03g74450D                                          275   6e-82   Brassica napus [oilseed rape]
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    275   7e-82   Tarenaya hassleriana [spider flower]
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        275   8e-82   Prunus mume [ume]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   275   9e-82   Citrus sinensis [apfelsine]
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             275   9e-82   Citrus clementina [clementine]
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    276   9e-82   Nicotiana tomentosiformis
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        275   1e-81   Vitis vinifera
gb|ADP03320.1|  aconitate hydratase                                     261   1e-81   Pinus pinaster [cluster pine]
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    275   1e-81   Brassica rapa
ref|XP_006376779.1|  aconitate hydratase family protein                 274   2e-81   Populus trichocarpa [western balsam poplar]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    274   2e-81   Populus euphratica
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        274   2e-81   Populus euphratica
gb|KJB48278.1|  hypothetical protein B456_008G061900                    273   2e-81   Gossypium raimondii
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    274   2e-81   Cicer arietinum [garbanzo]
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    274   2e-81   Camelina sativa [gold-of-pleasure]
gb|ADM34980.1|  cytosolic aconitase                                     272   3e-81   Pyrus pyrifolia [sha li]
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          273   4e-81   Sorghum bicolor [broomcorn]
gb|ADP03120.1|  aconitate hydratase                                     259   4e-81   Pinus sylvestris [Scotch pine]
gb|ADP03143.1|  aconitate hydratase                                     259   4e-81   Pinus sylvestris [Scotch pine]
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    272   5e-81   Cucurbita maxima [Boston marrow]
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    273   6e-81   
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        273   6e-81   Pyrus x bretschneideri [bai li]
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        273   7e-81   
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             273   7e-81   Eutrema salsugineum [saltwater cress]
gb|AFW61054.1|  hypothetical protein ZEAMMB73_482448                    270   8e-81   
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             272   8e-81   Capsella rubella
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   271   9e-81   Nelumbo nucifera [Indian lotus]
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        271   1e-80   Gossypium arboreum [tree cotton]
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                272   1e-80   Erythranthe guttata [common monkey flower]
gb|ADP03151.1|  aconitate hydratase                                     258   1e-80   Pinus sylvestris [Scotch pine]
ref|XP_002524184.1|  aconitase, putative                                272   1e-80   Ricinus communis
gb|ADP03123.1|  aconitate hydratase                                     258   1e-80   Pinus sylvestris [Scotch pine]
gb|ADP03134.1|  aconitate hydratase                                     258   1e-80   Pinus sylvestris [Scotch pine]
gb|ADP03144.1|  aconitate hydratase                                     258   1e-80   Pinus sylvestris [Scotch pine]
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    272   1e-80   Phoenix dactylifera
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        271   1e-80   Gossypium arboreum [tree cotton]
gb|ABK25210.1|  unknown                                                 264   1e-80   Picea sitchensis
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    271   2e-80   Sesamum indicum [beniseed]
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   271   2e-80   Citrus sinensis [apfelsine]
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    271   2e-80   Brassica rapa
ref|XP_002870438.1|  predicted protein                                  271   3e-80   Arabidopsis lyrata subsp. lyrata
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    271   3e-80   Elaeis guineensis
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    271   3e-80   Nicotiana sylvestris
ref|XP_002530635.1|  aconitase, putative                                270   4e-80   Ricinus communis
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    270   5e-80   
ref|XP_002532564.1|  aconitase, putative                                270   5e-80   
ref|XP_010438674.1|  PREDICTED: aconitate hydratase 3, mitochondr...    267   7e-80   Camelina sativa [gold-of-pleasure]
ref|XP_007046597.1|  Aconitase 1                                        269   7e-80   
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             269   8e-80   
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         269   2e-79   Jatropha curcas
ref|NP_001159229.1|  uncharacterized protein LOC100304315               264   2e-79   
emb|CDY66424.1|  BnaAnng22230D                                          268   3e-79   Brassica napus [oilseed rape]
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    268   3e-79   Camelina sativa [gold-of-pleasure]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    268   3e-79   Brassica rapa
gb|KDO71349.1|  hypothetical protein CISIN_1g002610mg                   260   3e-79   Citrus sinensis [apfelsine]
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    268   3e-79   Elaeis guineensis
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    268   4e-79   Camelina sativa [gold-of-pleasure]
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    268   5e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    267   6e-79   Phoenix dactylifera
emb|CDY14291.1|  BnaA08g14220D                                          267   7e-79   Brassica napus [oilseed rape]
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    267   7e-79   Elaeis guineensis
gb|KEH27599.1|  cytoplasmic-like aconitate hydratase                    264   8e-79   Medicago truncatula
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    266   8e-79   Camelina sativa [gold-of-pleasure]
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                     266   1e-78   Cucumis melo [Oriental melon]
emb|CDP05740.1|  unnamed protein product                                266   1e-78   Coffea canephora [robusta coffee]
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   265   1e-78   Vitis vinifera
emb|CBI24446.3|  unnamed protein product                                266   1e-78   Vitis vinifera
tpg|DAA43249.1|  TPA: hypothetical protein ZEAMMB73_889153              261   1e-78   
gb|KGN48958.1|  Aconitase                                               265   2e-78   
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    266   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like              265   2e-78   Cucumis sativus [cucumbers]
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    266   2e-78   Arabis alpina [alpine rockcress]
gb|KHG24816.1|  Aconitate hydratase 1 -like protein                     263   2e-78   Gossypium arboreum [tree cotton]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    266   2e-78   Solanum tuberosum [potatoes]
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    265   2e-78   Setaria italica
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             265   3e-78   
emb|CAB36543.1|  putative aconitase                                     265   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    265   3e-78   Camelina sativa [gold-of-pleasure]
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    265   3e-78   Phoenix dactylifera
gb|KDO71348.1|  hypothetical protein CISIN_1g002610mg                   261   4e-78   Citrus sinensis [apfelsine]
ref|XP_003612247.1|  Aconitate hydratase                                264   4e-78   Medicago truncatula
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             265   4e-78   Capsella rubella
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    265   4e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    265   4e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_567763.2|  aconitase 2                                           265   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   263   7e-78   
sp|Q42669.1|ACOC_CUCMC  RecName: Full=Aconitate hydratase; Short=...    261   8e-78   Cucumis melo var. conomon [snake cucumber]
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...    264   1e-77   
gb|KDO71347.1|  hypothetical protein CISIN_1g002610mg                   261   1e-77   Citrus sinensis [apfelsine]
gb|KDP23953.1|  hypothetical protein JCGZ_25341                         263   1e-77   Jatropha curcas
ref|XP_008363078.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    261   1e-77   
ref|XP_008344247.1|  PREDICTED: aconitate hydratase 1                   260   2e-77   
ref|XP_008393748.1|  PREDICTED: aconitate hydratase 1-like              261   2e-77   
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850          263   2e-77   Sorghum bicolor [broomcorn]
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic               261   2e-77   Triticum urartu
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              262   2e-77   Pyrus x bretschneideri [bai li]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              262   2e-77   Pyrus x bretschneideri [bai li]
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   262   2e-77   Pyrus x bretschneideri [bai li]
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    263   2e-77   Brachypodium distachyon [annual false brome]
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic               261   3e-77   Triticum urartu
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                   261   4e-77   Citrus sinensis [apfelsine]
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   261   4e-77   Citrus sinensis [apfelsine]
emb|CBE71056.1|  aconitate hydratase 1                                  261   4e-77   Citrus clementina [clementine]
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             261   5e-77   Citrus clementina [clementine]
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   261   5e-77   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   261   5e-77   Citrus sinensis [apfelsine]
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               261   7e-77   
gb|AAK91447.1|  AT4g26970/F10M23_310                                    261   8e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...    261   1e-76   Brachypodium distachyon [annual false brome]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   260   1e-76   Citrus sinensis [apfelsine]
dbj|BAJ85661.1|  predicted protein                                      260   2e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW56578.1|  hypothetical protein EUGRSUZ_I02307                     258   2e-76   Eucalyptus grandis [rose gum]
gb|AAL13084.1|  putative aconitase                                      259   2e-76   Prunus avium [gean]
ref|XP_006383042.1|  aconitate hydratase family protein                 259   2e-76   Populus trichocarpa [western balsam poplar]
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    259   3e-76   Arabis alpina [alpine rockcress]
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...    259   3e-76   
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             259   3e-76   Prunus persica
ref|NP_001119125.1|  aconitate hydratase 1                              257   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   258   4e-76   Populus euphratica
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             258   4e-76   Populus trichocarpa [western balsam poplar]
ref|XP_007020807.1|  Aconitase 3                                        258   5e-76   
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   258   6e-76   Brassica rapa
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              258   8e-76   Camelina sativa [gold-of-pleasure]
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   258   8e-76   Prunus mume [ume]
dbj|BAJ92965.1|  predicted protein                                      258   8e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX69174.1|  BnaC01g02790D                                          258   8e-76   
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   258   8e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              258   9e-76   Camelina sativa [gold-of-pleasure]
ref|NP_195308.1|  aconitate hydratase 1                                 257   1e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CAA58046.1|  aconitase                                              258   1e-75   Arabidopsis thaliana [mouse-ear cress]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                     257   1e-75   Eucalyptus grandis [rose gum]
gb|ACK56134.1|  putative aconitase                                      238   1e-75   Dimocarpus longan [longan]
gb|EEE58288.1|  hypothetical protein OsJ_09326                          257   1e-75   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                   257   1e-75   Eucalyptus grandis [rose gum]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             257   1e-75   Phaseolus vulgaris [French bean]
gb|EEC74472.1|  hypothetical protein OsI_09921                          257   2e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              256   2e-75   Brassica rapa
ref|NP_001048898.1|  Os03g0136900                                       257   2e-75   
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               261   2e-75   
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             256   3e-75   Capsella rubella
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             256   3e-75   Eutrema salsugineum [saltwater cress]
emb|CDY24823.1|  BnaA08g14870D                                          256   4e-75   Brassica napus [oilseed rape]
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    255   5e-75   Glycine max [soybeans]
emb|CDX75532.1|  BnaA01g01700D                                          255   7e-75   
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   255   7e-75   Glycine max [soybeans]
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   254   1e-74   Fragaria vesca subsp. vesca
ref|XP_010113288.1|  Aconitate hydratase 1                              255   2e-74   
emb|CDY41626.1|  BnaC03g62580D                                          254   2e-74   Brassica napus [oilseed rape]
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                        253   4e-74   Glycine soja [wild soybean]
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   253   5e-74   Tarenaya hassleriana [spider flower]
gb|KHN41868.1|  Aconitate hydratase 1                                   253   6e-74   Glycine soja [wild soybean]
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like              250   5e-73   Cicer arietinum [garbanzo]
ref|XP_007020811.1|  Aconitase 3                                        249   2e-72   
gb|ACR36825.1|  unknown                                                 242   4e-72   Zea mays [maize]
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907             246   2e-71   
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like              246   2e-71   Eucalyptus grandis [rose gum]
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...    246   2e-71   Zea mays [maize]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...    246   2e-71   Zea mays [maize]
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like              246   2e-71   Tarenaya hassleriana [spider flower]
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                     246   2e-71   Eucalyptus grandis [rose gum]
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          246   2e-71   Sorghum bicolor [broomcorn]
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937             245   3e-71   
gb|ACU19654.1|  unknown                                                 226   3e-71   Glycine max [soybeans]
ref|NP_001147431.1|  aconitase2                                         242   3e-70   Zea mays [maize]
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    241   6e-70   Zea mays [maize]
ref|XP_010443094.1|  PREDICTED: aconitate hydratase 3, mitochondr...    239   1e-69   
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    241   1e-69   Zea mays [maize]
ref|XP_010443093.1|  PREDICTED: aconitate hydratase 3, mitochondr...    239   2e-69   
ref|XP_002866068.1|  hypothetical protein ARALYDRAFT_918634             225   2e-69   
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    239   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006830449.1|  hypothetical protein AMTR_s00115p00015570          239   5e-69   
gb|KEH38306.1|  cytoplasmic-like aconitate hydratase                    238   8e-69   Medicago truncatula
ref|XP_009361096.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    233   5e-68   
gb|EMS62033.1|  Putative aconitate hydratase, cytoplasmic               236   1e-67   Triticum urartu
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    234   2e-67   Medicago truncatula
ref|XP_003590814.1|  Aconitate hydratase                                234   2e-67   
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic               233   6e-67   
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    233   1e-66   
ref|XP_001780674.1|  predicted protein                                  231   2e-66   
tpg|DAA43248.1|  TPA: hypothetical protein ZEAMMB73_889153              228   4e-66   
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572             231   5e-66   
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331             231   5e-66   
ref|XP_001779205.1|  predicted protein                                  229   1e-65   
gb|KJB17578.1|  hypothetical protein B456_003G006000                    229   2e-65   Gossypium raimondii
emb|CAN83844.1|  hypothetical protein VITISV_003004                     229   2e-65   Vitis vinifera
ref|XP_001770969.1|  predicted protein                                  223   2e-63   
ref|XP_008355339.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    218   3e-63   
emb|CDY56501.1|  BnaAnng14360D                                          213   1e-59   Brassica napus [oilseed rape]
ref|XP_010290546.1|  PREDICTED: cytoplasmic aconitate hydratase         196   4e-59   Phaethon lepturus
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   209   2e-58   
gb|EPQ05177.1|  Cytoplasmic aconitate hydratase                         195   5e-58   Myotis brandtii
ref|XP_006108771.1|  PREDICTED: cytoplasmic aconitate hydratase-like    196   6e-58   Myotis lucifugus
ref|XP_005862173.1|  PREDICTED: cytoplasmic aconitate hydratase-like    194   7e-58   
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                   206   3e-57   
gb|AAH90777.1|  LOC100150527 protein                                    189   4e-56   
ref|XP_002784977.1|  aconitase, putative                                188   8e-56   
gb|EYC17817.1|  hypothetical protein Y032_0029g1886                     188   8e-56   
ref|XP_008586142.1|  PREDICTED: cytoplasmic aconitate hydratase         190   3e-55   
gb|AAF29447.1|AF127457_1  aconitase                                     186   4e-55   
gb|AGC69746.1|  putative iron regulatory protein                        197   2e-54   
ref|XP_004658446.1|  PREDICTED: cytoplasmic aconitate hydratase         197   3e-54   
gb|EGV97063.1|  Cytoplasmic aconitate hydratase                         196   4e-54   
ref|XP_003506017.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    196   6e-54   
ref|XP_005326228.1|  PREDICTED: cytoplasmic aconitate hydratase         196   7e-54   
ref|XP_005401176.1|  PREDICTED: cytoplasmic aconitate hydratase         196   7e-54   
ref|XP_007614514.1|  PREDICTED: cytoplasmic aconitate hydratase         196   7e-54   
gb|AAH05454.1|  Aconitase 1                                             196   8e-54   
emb|CAA43455.1|  iron response element binding protein                  196   8e-54   
ref|NP_031412.2|  cytoplasmic aconitate hydratase                       196   9e-54   
gb|ERE84356.1|  cytoplasmic aconitate hydratase-like protein            196   1e-53   
ref|XP_010081789.1|  PREDICTED: cytoplasmic aconitate hydratase         193   1e-53   
ref|XP_006975385.1|  PREDICTED: cytoplasmic aconitate hydratase         196   1e-53   
emb|CAD20353.1|  cytoplasmic aconitase                                  196   1e-53   
ref|XP_008494051.1|  PREDICTED: cytoplasmic aconitate hydratase         196   1e-53   
ref|XP_010013993.1|  PREDICTED: cytoplasmic aconitate hydratase         194   1e-53   
gb|KFV01523.1|  Cytoplasmic aconitate hydratase                         192   1e-53   
ref|XP_005530013.1|  PREDICTED: cytoplasmic aconitate hydratase         195   1e-53   
ref|XP_009675962.1|  PREDICTED: cytoplasmic aconitate hydratase i...    195   1e-53   
gb|KFZ58431.1|  Cytoplasmic aconitate hydratase                         194   1e-53   
gb|KFQ42707.1|  Cytoplasmic aconitate hydratase                         194   1e-53   
gb|KFQ88200.1|  Cytoplasmic aconitate hydratase                         195   1e-53   
ref|XP_009675961.1|  PREDICTED: cytoplasmic aconitate hydratase i...    195   2e-53   
ref|XP_005141537.1|  PREDICTED: cytoplasmic aconitate hydratase         195   2e-53   
ref|XP_008154889.1|  PREDICTED: cytoplasmic aconitate hydratase         195   2e-53   
ref|XP_003407686.1|  PREDICTED: cytoplasmic aconitate hydratase         195   2e-53   
ref|XP_001464867.1|  putative aconitase                                 195   2e-53   
gb|ELU03714.1|  hypothetical protein CAPTEDRAFT_153788                  194   2e-53   
ref|XP_009094283.1|  PREDICTED: cytoplasmic aconitate hydratase         195   2e-53   
gb|EDL98627.1|  rCG55067                                                195   2e-53   
ref|XP_001563981.1|  putative aconitase                                 195   2e-53   
ref|XP_005061122.1|  PREDICTED: cytoplasmic aconitate hydratase         195   2e-53   
ref|XP_001682457.1|  putative aconitase                                 195   2e-53   
ref|XP_009968191.1|  PREDICTED: cytoplasmic aconitate hydratase         194   2e-53   
ref|XP_004581280.1|  PREDICTED: cytoplasmic aconitate hydratase         194   2e-53   
gb|KFP56261.1|  Cytoplasmic aconitate hydratase                         194   3e-53   
ref|XP_009485700.1|  PREDICTED: cytoplasmic aconitate hydratase         194   3e-53   
gb|KFV55230.1|  Cytoplasmic aconitate hydratase                         194   3e-53   
ref|XP_005078925.1|  PREDICTED: cytoplasmic aconitate hydratase         194   3e-53   
ref|XP_009872328.1|  PREDICTED: cytoplasmic aconitate hydratase         194   3e-53   
ref|XP_005425054.1|  PREDICTED: cytoplasmic aconitate hydratase         194   3e-53   
ref|XP_005362039.1|  PREDICTED: cytoplasmic aconitate hydratase         194   3e-53   
ref|XP_010151037.1|  PREDICTED: cytoplasmic aconitate hydratase         194   3e-53   
ref|XP_008849314.1|  PREDICTED: cytoplasmic aconitate hydratase         194   3e-53   
ref|XP_002766275.1|  Aconitate hydratase, cytoplasmic, putative         185   4e-53   
ref|XP_005492744.1|  PREDICTED: cytoplasmic aconitate hydratase         194   4e-53   
ref|XP_009462533.1|  PREDICTED: cytoplasmic aconitate hydratase         194   4e-53   
ref|XP_009573519.1|  PREDICTED: cytoplasmic aconitate hydratase         194   4e-53   
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase         194   4e-53   
ref|XP_008921492.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    194   4e-53   
ref|XP_010724498.1|  PREDICTED: cytoplasmic aconitate hydratase         194   4e-53   
ref|XP_009818682.1|  PREDICTED: cytoplasmic aconitate hydratase         193   4e-53   
ref|XP_006759955.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    194   4e-53   
ref|XP_005963977.1|  PREDICTED: cytoplasmic aconitate hydratase         194   4e-53   
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase         194   4e-53   
gb|KFQ12070.1|  Cytoplasmic aconitate hydratase                         192   4e-53   
emb|CCW69174.1|  unnamed protein product                                194   4e-53   
ref|XP_009898602.1|  PREDICTED: cytoplasmic aconitate hydratase         194   4e-53   
ref|XP_009946591.1|  PREDICTED: cytoplasmic aconitate hydratase         193   5e-53   
ref|XP_003357777.1|  PREDICTED: cytoplasmic aconitate hydratase         194   5e-53   
ref|XP_005510592.1|  PREDICTED: cytoplasmic aconitate hydratase         194   5e-53   
ref|XP_010398395.1|  PREDICTED: cytoplasmic aconitate hydratase         194   5e-53   
ref|XP_008939123.1|  PREDICTED: cytoplasmic aconitate hydratase         194   5e-53   
tpg|DAA27049.1|  TPA: cytoplasmic aconitate hydratase                   194   5e-53   
ref|XP_006759954.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    194   5e-53   
ref|XP_009927267.1|  PREDICTED: cytoplasmic aconitate hydratase         192   5e-53   
ref|XP_009075233.1|  PREDICTED: cytoplasmic aconitate hydratase         194   5e-53   
ref|XP_010307150.1|  PREDICTED: cytoplasmic aconitate hydratase         194   5e-53   
ref|XP_004905303.1|  PREDICTED: cytoplasmic aconitate hydratase i...    194   5e-53   
ref|NP_001069059.1|  cytoplasmic aconitate hydratase                    194   5e-53   
ref|XP_006123150.1|  PREDICTED: cytoplasmic aconitate hydratase i...    194   6e-53   
ref|XP_005909205.1|  PREDICTED: cytoplasmic aconitate hydratase         194   6e-53   
gb|KFQ08457.1|  Cytoplasmic aconitate hydratase                         193   6e-53   
ref|XP_004600431.1|  PREDICTED: cytoplasmic aconitate hydratase         193   6e-53   
ref|XP_010787894.1|  PREDICTED: cytoplasmic aconitate hydratase-like    185   6e-53   
ref|XP_009646981.1|  PREDICTED: cytoplasmic aconitate hydratase         194   6e-53   
ref|XP_010697897.1|  aconitase, putative                                194   6e-53   
ref|XP_006060333.1|  PREDICTED: cytoplasmic aconitate hydratase i...    194   6e-53   
ref|XP_010806017.1|  PREDICTED: cytoplasmic aconitate hydratase i...    194   6e-53   
ref|XP_004482427.1|  PREDICTED: cytoplasmic aconitate hydratase         193   7e-53   
ref|XP_005209909.1|  PREDICTED: cytoplasmic aconitate hydratase i...    193   7e-53   
ref|XP_010837907.1|  PREDICTED: cytoplasmic aconitate hydratase         193   7e-53   
ref|XP_008632753.1|  PREDICTED: cytoplasmic aconitate hydratase         193   7e-53   
gb|KFP02434.1|  Cytoplasmic aconitate hydratase                         193   8e-53   
ref|XP_011404037.1|  PREDICTED: cytoplasmic aconitate hydratase         192   8e-53   
ref|XP_008517260.1|  PREDICTED: cytoplasmic aconitate hydratase         193   8e-53   
ref|NP_001025707.1|  cytoplasmic aconitate hydratase                    193   8e-53   
ref|XP_009942226.1|  PREDICTED: cytoplasmic aconitate hydratase         193   9e-53   
ref|XP_009997773.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    193   9e-53   
ref|XP_009698540.1|  PREDICTED: cytoplasmic aconitate hydratase         193   1e-52   
gb|KFP65041.1|  Cytoplasmic aconitate hydratase                         193   1e-52   
ref|XP_006759953.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    194   1e-52   
ref|XP_002194651.1|  PREDICTED: cytoplasmic aconitate hydratase         193   1e-52   
ref|XP_004004476.1|  PREDICTED: cytoplasmic aconitate hydratase i...    193   1e-52   
gb|ELR46544.1|  Cytoplasmic aconitate hydratase                         194   1e-52   
ref|XP_010122172.1|  PREDICTED: cytoplasmic aconitate hydratase         191   1e-52   
ref|XP_010169631.1|  PREDICTED: cytoplasmic aconitate hydratase         193   1e-52   
ref|XP_010746424.1|  PREDICTED: cytoplasmic aconitate hydratase         193   1e-52   
ref|XP_010611189.1|  PREDICTED: cytoplasmic aconitate hydratase         193   1e-52   
gb|ELK33131.1|  Cytoplasmic aconitate hydratase                         194   1e-52   
ref|XP_004428436.1|  PREDICTED: cytoplasmic aconitate hydratase i...    193   1e-52   
ref|XP_010177495.1|  PREDICTED: cytoplasmic aconitate hydratase         192   1e-52   
ref|XP_004004477.1|  PREDICTED: cytoplasmic aconitate hydratase i...    192   1e-52   
ref|XP_004428435.1|  PREDICTED: cytoplasmic aconitate hydratase i...    192   1e-52   
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase         192   1e-52   
ref|XP_004632076.1|  PREDICTED: cytoplasmic aconitate hydratase         192   1e-52   
ref|XP_010224488.1|  PREDICTED: cytoplasmic aconitate hydratase         192   1e-52   
ref|XP_003874065.1|  putative aconitase                                 192   1e-52   
ref|XP_003761451.1|  PREDICTED: cytoplasmic aconitate hydratase         192   2e-52   
ref|XP_010965659.1|  PREDICTED: cytoplasmic aconitate hydratase i...    191   2e-52   
gb|EGT30572.1|  CBN-ACO-1 protein                                       192   2e-52   
ref|XP_010974111.1|  PREDICTED: cytoplasmic aconitate hydratase i...    191   2e-52   
ref|XP_010136118.1|  PREDICTED: cytoplasmic aconitate hydratase i...    192   2e-52   
ref|XP_007531304.1|  PREDICTED: cytoplasmic aconitate hydratase         192   2e-52   
ref|XP_006216897.1|  PREDICTED: cytoplasmic aconitate hydratase         192   2e-52   
ref|XP_010136119.1|  PREDICTED: cytoplasmic aconitate hydratase i...    192   2e-52   
ref|XP_009327206.1|  PREDICTED: cytoplasmic aconitate hydratase         192   2e-52   
ref|XP_009283305.1|  PREDICTED: cytoplasmic aconitate hydratase         192   2e-52   
ref|XP_009986012.1|  PREDICTED: cytoplasmic aconitate hydratase         192   2e-52   
ref|XP_006025029.1|  PREDICTED: cytoplasmic aconitate hydratase         192   2e-52   
ref|XP_006265526.1|  PREDICTED: cytoplasmic aconitate hydratase         192   2e-52   
ref|XP_010974110.1|  PREDICTED: cytoplasmic aconitate hydratase i...    192   3e-52   
ref|XP_010965658.1|  PREDICTED: cytoplasmic aconitate hydratase i...    192   3e-52   
gb|ENN73657.1|  hypothetical protein YQE_09735                          181   3e-52   
ref|XP_007464993.1|  PREDICTED: cytoplasmic aconitate hydratase i...    191   4e-52   
gb|KFO19757.1|  Cytoplasmic aconitate hydratase                         192   4e-52   
ref|XP_004275114.1|  PREDICTED: cytoplasmic aconitate hydratase i...    191   4e-52   
ref|XP_009883571.1|  PREDICTED: cytoplasmic aconitate hydratase         191   4e-52   
ref|XP_004390991.1|  PREDICTED: cytoplasmic aconitate hydratase         191   4e-52   
ref|XP_003800343.1|  PREDICTED: cytoplasmic aconitate hydratase         191   4e-52   
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137              191   5e-52   
ref|XP_010576405.1|  PREDICTED: cytoplasmic aconitate hydratase         191   5e-52   
ref|XP_001016756.1|  aconitate hydratase                                191   5e-52   
ref|XP_008200453.1|  PREDICTED: cytoplasmic aconitate hydratase-like    191   5e-52   
ref|XP_007464992.1|  PREDICTED: cytoplasmic aconitate hydratase i...    191   6e-52   
gb|ETN69391.1|  aconitase domain protein                                178   6e-52   
ref|XP_007116533.1|  PREDICTED: cytoplasmic aconitate hydratase i...    191   6e-52   
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase         191   6e-52   
ref|XP_010888583.1|  PREDICTED: cytoplasmic aconitate hydratase-like    189   7e-52   
pdb|3SNP|A  Chain A, Crystal Structure Analysis Of Iron Regulator...    191   7e-52   
ref|XP_008246563.1|  PREDICTED: cytoplasmic aconitate hydratase i...    191   8e-52   
ref|XP_008693317.1|  PREDICTED: cytoplasmic aconitate hydratase         191   8e-52   
ref|XP_003109738.1|  CRE-ACO-1 protein                                  191   8e-52   
ref|XP_005234855.1|  PREDICTED: cytoplasmic aconitate hydratase         191   8e-52   
ref|XP_008660164.1|  PREDICTED: aconitate hydratase, cytoplasmic        175   9e-52   
gb|ETE68888.1|  Iron-responsive element-binding protein 2               190   1e-51   
ref|XP_007116532.1|  PREDICTED: cytoplasmic aconitate hydratase i...    190   1e-51   
gb|KIH47318.1|  putative aconitate hydratase 1                          189   1e-51   
ref|XP_002643981.1|  C. briggsae CBR-ACO-1 protein                      190   1e-51   
emb|CCW61236.1|  unnamed protein product                                190   1e-51   
ref|XP_010197370.1|  PREDICTED: cytoplasmic aconitate hydratase         190   1e-51   
ref|XP_007065257.1|  PREDICTED: cytoplasmic aconitate hydratase         190   1e-51   
ref|XP_001365420.1|  PREDICTED: cytoplasmic aconitate hydratase         190   1e-51   
ref|XP_008166967.1|  PREDICTED: cytoplasmic aconitate hydratase         190   1e-51   
gb|EPY31043.1|  aconitase                                               190   1e-51   
ref|XP_002928311.1|  PREDICTED: cytoplasmic aconitate hydratase         190   1e-51   
gb|EPY23614.1|  aconitate hydratase 1                                   190   2e-51   
emb|CAP35039.2|  Protein CBR-ACO-1                                      190   2e-51   
ref|NP_509898.1|  Protein ACO-1                                         189   2e-51   
gb|AFI44047.1|  iron regulatory protein                                 189   2e-51   
ref|XP_004765422.1|  PREDICTED: cytoplasmic aconitate hydratase         189   2e-51   
ref|XP_006863078.1|  PREDICTED: cytoplasmic aconitate hydratase         189   2e-51   
ref|XP_004392229.1|  PREDICTED: cytoplasmic aconitate hydratase         189   2e-51   
ref|XP_006143153.1|  PREDICTED: cytoplasmic aconitate hydratase         189   2e-51   
ref|XP_006939263.1|  PREDICTED: cytoplasmic aconitate hydratase         189   2e-51   
gb|AAF99681.1|AF261088_1  iron regulatory protein 1                     189   2e-51   
ref|XP_003470870.1|  PREDICTED: cytoplasmic aconitate hydratase         189   2e-51   
gb|AAA69900.1|  iron-responsive regulatory protein/iron regulator...    189   2e-51   
gb|KHN74276.1|  putative cytoplasmic aconitate hydratase                190   2e-51   
ref|XP_007076652.1|  PREDICTED: cytoplasmic aconitate hydratase         189   2e-51   
ref|XP_007948891.1|  PREDICTED: cytoplasmic aconitate hydratase         189   3e-51   
ref|XP_004047955.1|  PREDICTED: cytoplasmic aconitate hydratase         189   3e-51   
gb|AAA03251.1|  chimeric iron-responsive element-binding protein,...    189   3e-51   
ref|XP_006716840.1|  PREDICTED: cytoplasmic aconitate hydratase i...    189   3e-51   
pdb|2B3X|A  Chain A, Structure Of An Orthorhombic Crystal Form Of...    189   3e-51   
ref|XP_003830146.1|  PREDICTED: cytoplasmic aconitate hydratase i...    189   3e-51   
ref|NP_002188.1|  cytoplasmic aconitate hydratase                       189   3e-51   
ref|XP_538698.2|  PREDICTED: cytoplasmic aconitate hydratase            189   4e-51   
ref|XP_005433002.1|  PREDICTED: cytoplasmic aconitate hydratase         189   4e-51   
ref|XP_006629784.1|  PREDICTED: cytoplasmic aconitate hydratase-like    189   4e-51   
gb|EHH57327.1|  hypothetical protein EGM_06925                          189   4e-51   
ref|XP_006913749.1|  PREDICTED: cytoplasmic aconitate hydratase-like    189   4e-51   
ref|NP_001244794.1|  cytoplasmic aconitate hydratase                    189   4e-51   
gb|EHH24050.1|  hypothetical protein EGK_07631                          189   4e-51   
ref|XP_007176909.1|  PREDICTED: cytoplasmic aconitate hydratase         188   4e-51   
ref|XP_005172430.1|  PREDICTED: cytoplasmic aconitate hydratase i...    188   5e-51   
ref|NP_001075784.1|  cytoplasmic aconitate hydratase                    188   5e-51   
ref|XP_001509375.1|  PREDICTED: cytoplasmic aconitate hydratase         188   5e-51   
ref|XP_003911667.1|  PREDICTED: cytoplasmic aconitate hydratase         188   6e-51   
ref|XP_003263352.1|  PREDICTED: cytoplasmic aconitate hydratase         188   6e-51   
ref|XP_010352748.1|  PREDICTED: cytoplasmic aconitate hydratase         188   7e-51   
gb|ACF33175.1|  aconitase-1                                             188   7e-51   
ref|XP_002765934.1|  aconitase, putative                                188   8e-51   
ref|XP_006727401.1|  PREDICTED: cytoplasmic aconitate hydratase         187   9e-51   
emb|CBY22746.1|  unnamed protein product                                188   9e-51   
gb|KFM82338.1|  hypothetical protein X975_14216                         189   9e-51   
ref|NP_001135643.1|  cytoplasmic aconitate hydratase                    187   9e-51   
ref|XP_008059371.1|  PREDICTED: cytoplasmic aconitate hydratase         187   1e-50   
ref|XP_004677765.1|  PREDICTED: cytoplasmic aconitate hydratase         187   1e-50   
ref|XP_007967222.1|  PREDICTED: cytoplasmic aconitate hydratase         188   1e-50   
ref|XP_008996396.1|  PREDICTED: cytoplasmic aconitate hydratase         187   2e-50   
ref|NP_001030155.1|  cytoplasmic aconitate hydratase                    187   2e-50   
emb|CBH16617.1|  aconitase, putative                                    187   2e-50   
ref|XP_827883.1|  aconitase                                             187   2e-50   
dbj|BAM18054.1|  iron regulatory protein 1A                             181   2e-50   
ref|NP_059017.1|  cytoplasmic aconitate hydratase                       187   2e-50   
ref|XP_004086812.1|  PREDICTED: cytoplasmic aconitate hydratase i...    186   2e-50   
ref|NP_001080577.1|  aconitase 1, soluble                               186   2e-50   
ref|XP_011471732.1|  PREDICTED: cytoplasmic aconitate hydratase i...    186   2e-50   
ref|XP_008303429.1|  PREDICTED: cytoplasmic aconitate hydratase         186   2e-50   
ref|XP_002126781.1|  PREDICTED: cytoplasmic aconitate hydratase         186   3e-50   
ref|XP_005581618.1|  PREDICTED: cytoplasmic aconitate hydratase i...    186   3e-50   
emb|CDQ69390.1|  unnamed protein product                                186   3e-50   
ref|XP_004362727.1|  putative iron regulatory protein                   186   3e-50   
ref|NP_001133702.1|  Iron-responsive element-binding protein 1          186   3e-50   



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   293 bits (750),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYVFDAAM+YKSAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  855   GEKLYVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  914

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGIIPLCFK GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTV TD+GK FTCT 
Sbjct  915   NLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVVTDSGKQFTCTV  974

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQQ  307
             RFDTEVELAYFNHGGILPYVIRQLT+Q
Sbjct  975   RFDTEVELAYFNHGGILPYVIRQLTKQ  1001



>dbj|BAD94991.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=328

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  182  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  241

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  242  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTV  301

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  302  RFDTEVELAYFNHGGILPYVIRNLSKQ  328



>gb|KCW88791.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=795

 Score =   285 bits (730),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAM+YKSAG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  649  GEKLYVFDAAMKYKSAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGED DTLGLTGHERY+IDLPS IS+IRPGQDVTV TDTGK FTCTA
Sbjct  709  NLVGMGIIPLCFKAGEDTDTLGLTGHERYSIDLPSNISEIRPGQDVTVTTDTGKSFTCTA  768

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L  Q
Sbjct  769  RFDTEVELAYFNHGGILPYVIRNLINQ  795



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   289 bits (739),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYVFDAAMRYK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  863   GEKLYVFDAAMRYKADGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  922

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKI +IRPGQDVTV TDTGK FTCTA
Sbjct  923   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKIDEIRPGQDVTVTTDTGKSFTCTA  982

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQQ  307
             RFDTEVELAYFNHGGILPYV+RQLT+Q
Sbjct  983   RFDTEVELAYFNHGGILPYVVRQLTKQ  1009



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   288 bits (738),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  835  GEKLSVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  894

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDAD+LGLTGHERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  
Sbjct  895  NLVGMGIVPLCFKAGEDADSLGLTGHERYTIDLPDNISEIRPGQDVTVQTDTGKSFTCVV  954

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIRQL+QQ
Sbjct  955  RFDTEVELAYFNHGGILPYVIRQLSQQ  981



>dbj|BAE71240.1| putative cytoplasmic aconitate hydratase [Trifolium pratense]
Length=316

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL+VFDAA RYK+AG  T++LAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  169  GEKLFVFDAAERYKAAGHATIVLAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  228

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLP+KIS+I+PGQDVTV TD GK FTCTA
Sbjct  229  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISEIKPGQDVTVTTDNGKSFTCTA  288

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YFNHGGILPYVIR L  +
Sbjct  289  RFDTEVELEYFNHGGILPYVIRNLINK  315



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   288 bits (737),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  851  GEKLSVFDAAMKYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  910

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTGHERYTIDLP  IS+IRPGQDVTV+T+TGK FTCT 
Sbjct  911  NLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPENISEIRPGQDVTVRTETGKSFTCTV  970

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIRQLT+Q
Sbjct  971  RFDTEVELAYFNHGGILPYVIRQLTKQ  997



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   286 bits (732),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  835  GEKLSVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  894

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDAD+LGLTGHERYTIDLP  IS+IRPGQDVTV+TDTGK FTC  
Sbjct  895  NLVGMGIVPLCFKAGEDADSLGLTGHERYTIDLPDNISEIRPGQDVTVRTDTGKSFTCIV  954

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIRQL+QQ
Sbjct  955  RFDTEVELAYFNHGGILPYVIRQLSQQ  981



>sp|O04916.1|ACOC_SOLTU RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase, partial [Solanum tuberosum]
 emb|CAA65735.1| aconitate hydratase [Solanum tuberosum]
Length=616

 Score =   279 bits (714),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQ T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  470  GEKLSVFDAAMKYKSAGQSTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  529

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTG ERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  
Sbjct  530  NLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCIV  589

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIRQLTQ+
Sbjct  590  RFDTEVELAYFNHGGILQYVIRQLTQR  616



>ref|XP_004158846.1| PREDICTED: aconitate hydratase-like [Cucumis sativus]
Length=178

 Score =   265 bits (677),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  30   GEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  89

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDAD+LGLTGHER+TIDLPS + +IRPGQDV V TDTGK F+C  
Sbjct  90   NLVGMGIVPLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCIL  149

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L   
Sbjct  150  RFDTEVELAYFDHGGILQYVIRNLIHS  176



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   286 bits (731),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  850  GEKLSVFDAAMKYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  909

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTGHERYTIDLP  IS+IRPGQDV V+TDTGK FTC  
Sbjct  910  NLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPENISEIRPGQDVAVRTDTGKSFTCIV  969

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIRQLT+Q
Sbjct  970  RFDTEVELAYFNHGGILPYVIRQLTKQ  996



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   285 bits (730),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAM+YKSAG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  850  GEKLYVFDAAMKYKSAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  909

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGED DTLGLTGHERY+IDLPS IS+IRPGQDVTV TDTGK FTCTA
Sbjct  910  NLVGMGIIPLCFKAGEDTDTLGLTGHERYSIDLPSNISEIRPGQDVTVTTDTGKSFTCTA  969

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L  Q
Sbjct  970  RFDTEVELAYFNHGGILPYVIRNLINQ  996



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDA+TLGLTGHERYTIDLP KIS+I PGQDVTV+TDTGK FTC  
Sbjct  812  NLVGMGIVPLCFKAGEDAETLGLTGHERYTIDLPEKISEIHPGQDVTVRTDTGKSFTCIV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIRQL QQ
Sbjct  872  RFDTEVELAYFNHGGILPYVIRQLIQQ  898



>ref|XP_010046453.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=137

 Score =   262 bits (669),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/137 (90%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  717  MRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPL  538
            M+YKSAG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPL
Sbjct  1    MKYKSAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPL  60

Query  537  CFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAY  358
            CFKAGEDADTLGLTGHERY+IDLPS IS+IRPGQDVTV TDTGK F CTARF+TEVELAY
Sbjct  61   CFKAGEDADTLGLTGHERYSIDLPSNISEIRPGQDVTVTTDTGKSFICTARFETEVELAY  120

Query  357  FNHGGILPYVIRQLTQQ  307
            FNHGGILPYVIR L  Q
Sbjct  121  FNHGGILPYVIRNLFNQ  137



>gb|EEC83021.1| hypothetical protein OsI_28098 [Oryza sativa Indica Group]
Length=621

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA++YKS G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  475  GEKLYVFDAALKYKSEGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  534

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERYTIDLP+ +S+IRPGQD+TV TD GK FTCT 
Sbjct  535  NLVGMGIIPLCFKAGEDADSLGLTGHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTL  594

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L Q 
Sbjct  595  RFDTEVELAYFNHGGILPYVIRNLAQN  621



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   284 bits (727),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYK+ G+DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  837  GEKLYVFDAAQRYKAEGKDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  896

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLPSKIS+IRPGQDVTV TD GK FTCTA
Sbjct  897  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSKISEIRPGQDVTVTTDNGKSFTCTA  956

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  957  RFDTEVELAYFNHGGILPYVIRNLIKQ  983



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  843  GEKLSVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  902

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDA+TLGLTGHERYTIDLP KIS+I PGQDVTV+TDTGK FTC  
Sbjct  903  NLVGMGIVPLCFKAGEDAETLGLTGHERYTIDLPEKISEIHPGQDVTVRTDTGKSFTCIV  962

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIRQL QQ
Sbjct  963  RFDTEVELAYFNHGGILPYVIRQLIQQ  989



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQ+T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAAMKYKSAGQNTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTGHERYTIDLP  IS+IRPGQDV+VQTDTGK FTCT 
Sbjct  909  NLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPENISEIRPGQDVSVQTDTGKSFTCTV  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIRQLT+Q
Sbjct  969  RFDTEVELAYFNHGGILQYVIRQLTKQ  995



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  787  GEKLYVFDAAMRYKDAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  846

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLPSKI+DIRPGQDVTV TD GK FTCT 
Sbjct  847  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSKITDIRPGQDVTVTTDNGKSFTCTV  906

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  907  RFDTEVELAYFNNGGILPYVIRNLIKQ  933



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   284 bits (727),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYKSAGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  843  GEKLYVFDAAERYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  902

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERY+IDLPS IS+IRPGQDVTV TD+GK FTCT 
Sbjct  903  NLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPSNISEIRPGQDVTVTTDSGKSFTCTV  962

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  963  RFDTEVELAYFNHGGILPYVIRNLIKQ  989



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   282 bits (722),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK AG DT++LAGA+YGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  733  GEKLYVFDAAMRYKDAGHDTIVLAGADYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  792

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLP+KISDIRPGQDVTV TD GK FTCT 
Sbjct  793  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISDIRPGQDVTVTTDNGKSFTCTV  852

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  853  RFDTEVELAYFNNGGILPYVIRNLIKQ  879



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   284 bits (726),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAM+YK+AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  852  GEKLYVFDAAMKYKTAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  911

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAG+DADTLGLTGHERYTIDLPS ISDIRPGQDVTV TD GK FTCT 
Sbjct  912  NLVGMGIIPLCFKAGQDADTLGLTGHERYTIDLPSNISDIRPGQDVTVTTDNGKSFTCTV  971

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L ++
Sbjct  972  RFDTEVELAYFNHGGILPYVIRNLMKE  998



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   282 bits (722),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLYVFDAAMRYKDAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLP+KISDIRPGQDVTV T+ GK FTCT 
Sbjct  812  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  872  RFDTEVELAYFNNGGILPYVIRNLIKQ  898



>gb|KJB62843.1| hypothetical protein B456_009G439700, partial [Gossypium raimondii]
Length=417

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYV+DAAMRYK+AGQDT++LAGAEYGSGSSRDWAAKG MLLGVKAVI KSFERIHRS
Sbjct  271  GEKLYVYDAAMRYKAAGQDTIVLAGAEYGSGSSRDWAAKGQMLLGVKAVITKSFERIHRS  330

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTGHERY+IDLP+KIS+IRPGQDVTV T TGK FTCT 
Sbjct  331  NLVGMGIIPLCFKPGEDADSLGLTGHERYSIDLPNKISEIRPGQDVTVTTVTGKSFTCTV  390

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILP+VIR L ++
Sbjct  391  RFDTEVELAYFDHGGILPFVIRNLNKE  417



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score =   282 bits (721),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL+VFDAA RYK AG DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  737  GEKLFVFDAAQRYKDAGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  796

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLP+ IS+IRPGQDVTV TDTGK FTCT 
Sbjct  797  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPNSISEIRPGQDVTVTTDTGKSFTCTV  856

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  857  RFDTEVELAYFNHGGILPYVIRNLIEQ  883



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   283 bits (725),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  844  GEKLYVFDAAMRYKDAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  903

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLPSKI+DIRPGQDVTV TD GK FTCT 
Sbjct  904  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSKITDIRPGQDVTVTTDNGKSFTCTV  963

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  964  RFDTEVELAYFNNGGILPYVIRNLIKQ  990



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK AG DT++LAGA+YGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  827  GEKLYVFDAAMRYKDAGHDTIVLAGADYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  886

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLP+KISDIRPGQDVTV TD GK FTCT 
Sbjct  887  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISDIRPGQDVTVTTDNGKSFTCTV  946

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  947  RFDTEVELAYFNNGGILPYVIRNLIKQ  973



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score =   282 bits (722),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYKSAG DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI KSFERIHRS
Sbjct  792  GEKLYVFDAATRYKSAGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVITKSFERIHRS  851

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDA+TLGLTGHERYTIDLPS ISDIRPGQDVTV TD GK FTCT 
Sbjct  852  NLVGMGIIPLCFKAGEDAETLGLTGHERYTIDLPSNISDIRPGQDVTVTTDNGKSFTCTV  911

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPY IR L +Q
Sbjct  912  RFDTEVELAYFNHGGILPYAIRNLIKQ  938



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   283 bits (724),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  839  GEKLYVFDAAMRYKDAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  898

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLP+KISDIRPGQDVTV T+ GK FTCT 
Sbjct  899  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTV  958

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  959  RFDTEVELAYFNNGGILPYVIRNLIKQ  985



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK+AGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  846  GEKLYVFDAAMRYKAAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  905

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTG ERYTIDLPSK+S+IRPGQDVTV TDTGK FTCT 
Sbjct  906  NLVGMGIIPLCFKPGEDADTLGLTGQERYTIDLPSKVSEIRPGQDVTVVTDTGKSFTCTV  965

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L + 
Sbjct  966  RFDTEVELAYFNHGGILPYVIRNLMKH  992



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   283 bits (723),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  846  GEKLYVFDAAMRYKDAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  905

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLP+KISDIRPGQDVTV T+ GK FTCT 
Sbjct  906  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTV  965

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  966  RFDTEVELAYFNNGGILPYVIRNLIKQ  992



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYV+DAAMRYKSAGQDT++LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  752  GEKLYVYDAAMRYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTGHERYTIDLP+KISDIRPGQD+TV TD GK FTCT 
Sbjct  812  NLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPTKISDIRPGQDITVTTDNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR LT+Q
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLTKQ  898



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   281 bits (720),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  833  GEKLYVFDAAMRYKTSGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  892

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLC+K GEDADTLGLTGHER+TIDLPSKIS+I+PGQDV V TD+GK FTC A
Sbjct  893  NLVGMGIIPLCYKPGEDADTLGLTGHERFTIDLPSKISEIKPGQDVKVTTDSGKSFTCIA  952

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  953  RFDTEVELAYFNHGGILPYVIRNLIKQ  979



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   281 bits (720),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  844  GEKLSVFDAAMKYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  903

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD+GK F CT 
Sbjct  904  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISEIKPGQDVTVTTDSGKSFVCTV  963

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  964  RFDTEVELAYFNHGGILPYVIRNLSKQ  990



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   281 bits (720),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYKSAGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  843  GEKLYVFDAAERYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  902

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERY+IDLP  IS+IRPGQDV+V TD+GK FTCT 
Sbjct  903  NLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPDNISEIRPGQDVSVTTDSGKSFTCTV  962

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  963  RFDTEVELAYFNHGGILPYVIRNLIKQ  989



>emb|CAN62964.1| hypothetical protein VITISV_029521 [Vitis vinifera]
Length=520

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+A Q T+ILAGAEYGSGSSRDWAAKGPMLLGVKA IAKSFERIHRS
Sbjct  374  GEKLSVFDAAMKYKTANQGTIILAGAEYGSGSSRDWAAKGPMLLGVKAXIAKSFERIHRS  433

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTGHERYTIDLPS I +IRPGQD+TV T+TGK F CTA
Sbjct  434  NLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPSNIDEIRPGQDITVTTNTGKSFICTA  493

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  494  RFDTEVELAYFNHGGILPYVIRNLIKQ  520



>ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Tarenaya 
hassleriana]
Length=658

 Score =   275 bits (703),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  512  GEKLSVYDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  571

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTGHERYTI LP+ I +IRPGQDVTV TD GK FTCT 
Sbjct  572  NLVGMGIVPLCFKAGEDADTLGLTGHERYTIHLPTNILEIRPGQDVTVTTDNGKSFTCTV  631

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY+NHGGILPYVIR L++Q
Sbjct  632  RFDTEVELAYYNHGGILPYVIRNLSKQ  658



>gb|KDO62732.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=795

 Score =   278 bits (711),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK+AG +T++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  649  GEKLYVFDAAMRYKAAGHETIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGL GHERYTI+LP+K+S+IRPGQD+TV TDTGK FTCT 
Sbjct  709  NLVGMGIIPLCFKPGEDADTLGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTV  768

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILPYVIR L +Q
Sbjct  769  RFDTEVELAYFDHGGILPYVIRNLIKQ  795



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   281 bits (718),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYK+ GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  838  GEKLYVFDAAQRYKAEGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  897

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFK+GEDADTLGLTGHERYTIDLPS IS+IRPGQDVTV T TGK FTCT 
Sbjct  898  NLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSNISEIRPGQDVTVTTTTGKSFTCTV  957

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  958  RFDTEVELAYFNHGGILPYVIRNLIKQ  984



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   281 bits (718),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYKSAGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  843  GEKLYVFDAAERYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  902

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERY+IDLP  IS+IRPGQDV++ TD+GK FTCT 
Sbjct  903  NLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPDNISEIRPGQDVSITTDSGKSFTCTV  962

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  963  RFDTEVELAYFNHGGILPYVIRNLIKQ  989



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score =   280 bits (715),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYK++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  772  GEKLYVFDAATRYKASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  831

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTGHERYTI+LPS I++IRPGQDVTV TD GK FTCTA
Sbjct  832  NLVGMGIIPLCFKPGEDADTLGLTGHERYTIELPSIINEIRPGQDVTVTTDNGKSFTCTA  891

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  892  RFDTEVELAYFNHGGILPYVIRNLIKQ  918



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   280 bits (717),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYK++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  838  GEKLYVFDAATRYKASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  897

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTGHERYTI+LPS I++IRPGQDVTV TD GK FTCTA
Sbjct  898  NLVGMGIIPLCFKPGEDADTLGLTGHERYTIELPSIINEIRPGQDVTVTTDNGKSFTCTA  957

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  958  RFDTEVELAYFNHGGILPYVIRNLIKQ  984



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  839  GEKLSVFDAAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  898

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDA+T GLTGHERYTIDLP  IS+IRPGQDVTV+TDTGK FTC  
Sbjct  899  NLVGMGIVPLCFKAGEDAETHGLTGHERYTIDLPKNISEIRPGQDVTVRTDTGKSFTCIV  958

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYFNHGGILPYVIRQL Q
Sbjct  959  RFDTEVELAYFNHGGILPYVIRQLIQ  984



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   280 bits (717),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYV+DAAMRYK+AGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  847  GEKLYVYDAAMRYKAAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  906

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTGHERY+IDLP+KIS+IRPGQDVTV TDTGK FTCT 
Sbjct  907  NLVGMGIIPLCFKPGEDADSLGLTGHERYSIDLPNKISEIRPGQDVTVTTDTGKSFTCTV  966

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILP+VIR L ++
Sbjct  967  RFDTEVELAYFDHGGILPFVIRNLNRE  993



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQ T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAAMKYKSAGQSTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTG ERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  
Sbjct  909  NLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVV  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIRQLT+Q
Sbjct  969  RFDTEVELAYFNHGGILQYVIRQLTKQ  995



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  850  GEKLYVFDAAMRYKDAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  909

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLP KI +IRPGQDVTV TD GK FTCT 
Sbjct  910  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPRKIDEIRPGQDVTVTTDNGKSFTCTV  969

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  970  RFDTEVELAYFNNGGILPYVIRNLIRQ  996



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYK+ GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  838  GEKLYVFDAAQRYKAEGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  897

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFK+GEDADTLGLTGHERYTIDLPS IS+IRPGQDVTV T+TGK FTCT 
Sbjct  898  NLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSNISEIRPGQDVTVTTNTGKSFTCTV  957

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  958  RFDTEVELAYFNNGGILPYVIRNLIKQ  984



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYK+ GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  838  GEKLYVFDAAQRYKAEGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  897

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFK+GEDADTLGLTGHERYTIDLPS IS+IRPGQDVTV T+TGK FTCT 
Sbjct  898  NLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSNISEIRPGQDVTVTTNTGKSFTCTV  957

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  958  RFDTEVELAYFNNGGILPYVIRNLIKQ  984



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA++YKS G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLYVFDAALKYKSEGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERYTIDLP+ +S+IRPGQD+TV TD GK FTCT 
Sbjct  812  NLVGMGIIPLCFKAGEDADSLGLTGHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L Q 
Sbjct  872  RFDTEVELAYFNHGGILPYVIRNLAQN  898



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   279 bits (714),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQ T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  851  GEKLSVFDAAMKYKSAGQSTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  910

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTG ERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  
Sbjct  911  NLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCIV  970

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIRQLTQ+
Sbjct  971  RFDTEVELAYFNHGGILQYVIRQLTQR  997



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQ T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMKYKSAGQSTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTG ERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  
Sbjct  812  NLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIRQLT+ 
Sbjct  872  RFDTEVELAYFNHGGILQYVIRQLTKH  898



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   279 bits (714),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYV+DAAMRYK+AGQDT++LAGAEYGSGSSRDWAAKGPML+GVKAVIAKSFERIHRS
Sbjct  847  GEKLYVYDAAMRYKAAGQDTIVLAGAEYGSGSSRDWAAKGPMLVGVKAVIAKSFERIHRS  906

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTGHERY+IDLP+KIS+IRPGQDVTV TDTGK FTCT 
Sbjct  907  NLVGMGIIPLCFKPGEDADSLGLTGHERYSIDLPNKISEIRPGQDVTVTTDTGKSFTCTV  966

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILP+VIR L ++
Sbjct  967  RFDTEVELAYFDHGGILPFVIRNLNKE  993



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RY ++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  757  GEKLYVFDAATRYMASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  816

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTGHERY+IDLPSKIS+IRPGQDVTV TD GK FTCT 
Sbjct  817  NLVGMGIIPLCFKPGEDADTLGLTGHERYSIDLPSKISEIRPGQDVTVTTDNGKSFTCTV  876

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YFNHGGILPYVIR L +Q
Sbjct  877  RFDTEVELDYFNHGGILPYVIRNLIKQ  903



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQ T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMKYKSAGQSTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTG ERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  
Sbjct  812  NLVGMGIVPLCFKAGEDADTLGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIRQLT+ 
Sbjct  872  RFDTEVELAYFNHGGILQYVIRQLTKH  898



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   279 bits (713),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            G+KLYVFDAAMRY ++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  833  GDKLYVFDAAMRYMTSGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  892

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLC+K+GEDADTLGLTGHERYTIDLPSKIS+IRPGQDV V TD GK FTC  
Sbjct  893  NLVGMGIIPLCYKSGEDADTLGLTGHERYTIDLPSKISEIRPGQDVKVTTDNGKSFTCIV  952

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  953  RFDTEVELAYFNHGGILPYVIRNLIKQ  979



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK+AG +T++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLYVFDAAMRYKAAGHETIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGL GHERYTI+LP+K+S+IRPGQD+TV TDTGK FTCT 
Sbjct  812  NLVGMGIIPLCFKPGEDADTLGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILPYVIR L +Q
Sbjct  872  RFDTEVELAYFDHGGILPYVIRNLIKQ  898



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   278 bits (712),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RY ++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  833  GEKLYVFDAATRYMASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  892

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTGHERY+IDLPSKIS+IRPGQDVTV TD GK FTCT 
Sbjct  893  NLVGMGIIPLCFKPGEDADTLGLTGHERYSIDLPSKISEIRPGQDVTVTTDNGKSFTCTV  952

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YFNHGGILPYVIR L +Q
Sbjct  953  RFDTEVELDYFNHGGILPYVIRNLIKQ  979



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   278 bits (712),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAGQDT+ILAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  850  GEKLTVFDAAMKYKSAGQDTIILAGDEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  909

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFK+GEDADTLGLTGHERYTIDLPS +SDIRPGQD+TV+TDTGK FTCT 
Sbjct  910  NLVGMGIVPLCFKSGEDADTLGLTGHERYTIDLPSSVSDIRPGQDITVKTDTGKQFTCTV  969

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIRQL  +
Sbjct  970  RFDTEVELAYFNHGGILQYVIRQLAAK  996



>gb|EEE68177.1| hypothetical protein OsJ_26310 [Oryza sativa Japonica Group]
Length=956

 Score =   278 bits (711),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA++YKS G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  810  GEKLYVFDAALKYKSEGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  869

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERYTIDLP+ +S+IRPGQD+TV TD GK FTCT 
Sbjct  870  NLVGMGIIPLCFKAGEDADSLGLTGHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTL  929

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L Q 
Sbjct  930  RFDTEVELAYFNHGGILPYVIRNLAQN  956



>ref|XP_008785076.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=437

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAV+AKSFERIHRS
Sbjct  289  GEKLSVFDAAMRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVVAKSFERIHRS  348

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHERYTI+LP+ +SDI+PGQDVTV TD GK F CT 
Sbjct  349  NLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPNSVSDIKPGQDVTVVTDNGKQFACTV  408

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAY+NHGGILP+VIR L
Sbjct  409  RFDTEVELAYYNHGGILPFVIRNL  432



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   278 bits (712),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYVFDAAMRYK+AG +T++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  856   GEKLYVFDAAMRYKAAGHETIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  915

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGIIPLCFK GEDADTLGL GHERYTI+LP+K+S+IRPGQD+TV TDTGK FTCT 
Sbjct  916   NLVGMGIIPLCFKPGEDADTLGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTV  975

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQQ  307
             RFDTEVELAYF+HGGILPYVIR L +Q
Sbjct  976   RFDTEVELAYFDHGGILPYVIRNLIKQ  1002



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   277 bits (708),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  812  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  872  RFDTEVELAYFNHGGILPYVIRNLSKQ  898



>ref|NP_001159192.1| uncharacterized protein LOC100304277 [Zea mays]
 gb|ACN25362.1| unknown [Zea mays]
Length=287

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  141  GEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  200

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLC+KAGEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT 
Sbjct  201  NLAGMGIIPLCYKAGEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTL  260

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYV R++ +Q
Sbjct  261  RFDTEVELAYYDHGGILPYVARKIAEQ  287



>gb|KDO54658.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=795

 Score =   275 bits (703),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAG  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  649  GEKLSVFDAAMKYKSAGHGTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHER++IDLPSKIS+IRPGQDVTV TD+GK FTCT 
Sbjct  709  NLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTV  768

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILP+VIR L +Q
Sbjct  769  RFDTEVELAYFDHGGILPFVIRNLIKQ  795



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   278 bits (710),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  847  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  906

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI+LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  907  NLVGMGIIPLCFKSGEDADTLGLTGHERYTINLPTDISEIRPGQDVTVTTDNGKSFTCTV  966

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  967  RFDTEVELAYFNHGGILPYVIRNLSKQ  993



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   278 bits (710),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK+AGQDT++LAG EYGSGSSRDWAAKGPMLLGV+AVIAKSFERIHRS
Sbjct  851  GEKLYVFDAAMRYKTAGQDTIVLAGTEYGSGSSRDWAAKGPMLLGVQAVIAKSFERIHRS  910

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHERYTIDLPSKIS+IRPGQDVTV TDTGK FTCT 
Sbjct  911  NLVGMGIIPLCFKPGEDAETLGLTGHERYTIDLPSKISEIRPGQDVTVVTDTGKSFTCTV  970

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YFN+GGILPYVIR L + 
Sbjct  971  RFDTEVELEYFNNGGILPYVIRNLMKH  997



>ref|XP_007132547.1| hypothetical protein PHAVU_011G1037000g, partial [Phaseolus vulgaris]
 gb|ESW04541.1| hypothetical protein PHAVU_011G1037000g, partial [Phaseolus vulgaris]
Length=135

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  714  RYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLC  535
            RY ++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLC
Sbjct  1    RYMASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLC  60

Query  534  FKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYF  355
            FK+GEDADTLGLTG ERYTID+PSKISDIRPGQDVTV TD GK FTCT RFDTEVE+AYF
Sbjct  61   FKSGEDADTLGLTGQERYTIDIPSKISDIRPGQDVTVTTDNGKSFTCTVRFDTEVEIAYF  120

Query  354  NHGGILPYVIRQLTQ  310
            NHGGILPYVIR L +
Sbjct  121  NHGGILPYVIRNLIK  135



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   278 bits (710),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYVFDAAM+YK AG  T++LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  869   GEKLYVFDAAMKYKEAGHQTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  928

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMG+IPLCFKAGEDADTLGLTGHERYTIDLPSK+S+IRPGQD+TV TDTGK FTCT 
Sbjct  929   NLVGMGVIPLCFKAGEDADTLGLTGHERYTIDLPSKVSEIRPGQDITVTTDTGKSFTCTL  988

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQQ  307
             RFDTEVELAYF+HGGILPYVIRQL + 
Sbjct  989   RFDTEVELAYFDHGGILPYVIRQLMKN  1015



>ref|NP_001136484.1| uncharacterized protein LOC100216599 [Zea mays]
 gb|ACF82029.1| unknown [Zea mays]
Length=565

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  417  GEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  476

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERY+IDLP+ +S+IRPGQDVTV TD GK FTC  
Sbjct  477  NLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIV  536

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGILPYVIR L
Sbjct  537  RFDTEVELAYFNHGGILPYVIRNL  560



>gb|AFW61053.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=617

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  469  GEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  528

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERY+IDLP+ +S+IRPGQDVTV TD GK FTC  
Sbjct  529  NLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIV  588

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGILPYVIR L
Sbjct  589  RFDTEVELAYFNHGGILPYVIRNL  612



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   277 bits (709),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYVFDAAMRYK+ G DT++LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  863   GEKLYVFDAAMRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  922

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGIIPLCFKAGEDADTLGLTGHERY IDLPSKIS+IRPGQDVTV TD GK FTCT 
Sbjct  923   NLVGMGIIPLCFKAGEDADTLGLTGHERYNIDLPSKISEIRPGQDVTVTTDNGKSFTCTV  982

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQQ  307
             RFDTEVEL YFNHGGILPY IR L  Q
Sbjct  983   RFDTEVELEYFNHGGILPYAIRNLINQ  1009



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  845  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  904

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  905  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTV  964

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  965  RFDTEVELAYFNHGGILPYVIRNLSKQ  991



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  909  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTV  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  969  RFDTEVELAYFNHGGILPYVIRNLSKQ  995



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  844  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  903

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  904  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTV  963

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  964  RFDTEVELAYFNHGGILPYVIRNLSKQ  990



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  848  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  907

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  908  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTV  967

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  968  RFDTEVELAYFNHGGILPYVIRNLSKQ  994



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAG+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  845  GEKLSVFDAAMKYKSAGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  904

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  905  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTV  964

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  965  RFDTEVELAYFNHGGILPYVIRNLSKQ  991



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVF+AAMRYK+AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  849  GEKLYVFEAAMRYKAAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLPS I+ IRPGQDV+V T+ GK FTCT 
Sbjct  909  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSNITHIRPGQDVSVTTNNGKSFTCTV  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  969  RFDTEVELAYFNNGGILPYVIRNLIKQ  995



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRY + GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  829  GEKLSVFDAAMRYNTQGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  888

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPS +S+IRPGQDVTV TD+GK FTCTA
Sbjct  889  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSTVSEIRPGQDVTVVTDSGKSFTCTA  948

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGILPYVIR L
Sbjct  949  RFDTEVELAYFDHGGILPYVIRNL  972



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   276 bits (706),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  840  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  899

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  900  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTNISEIRPGQDVTVTTDNGKSFTCTV  959

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  960  RFDTEVELAYFNHGGILPYVIRNLSKQ  986



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   276 bits (705),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYK++G  T++LAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  833  GEKLYVFDAAERYKASGHATIVLAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  892

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLP+KIS+I+PGQDVTV TDTGK FTCTA
Sbjct  893  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPNKISEIKPGQDVTVTTDTGKSFTCTA  952

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YFNHGGILPYVIR L ++
Sbjct  953  RFDTEVELEYFNHGGILPYVIRNLIKK  979



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   276 bits (706),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  840  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  899

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDAD+LGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  900  NLVGMGIIPLCFKSGEDADSLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTV  959

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  960  RFDTEVELAYFNHGGILPYVIRNLSKQ  986



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   275 bits (703),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK+AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLYVFDAAMRYKAAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGII LCFK GEDADTLGL GHERYTI+LP+K+S+IRPGQD+TV TDTGK FTCT 
Sbjct  812  NLVGMGIILLCFKPGEDADTLGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILPYVIR L +Q
Sbjct  872  RFDTEVELAYFDHGGILPYVIRNLIKQ  898



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   275 bits (702),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAG  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMKYKSAGHGTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHER++IDLPSKIS+IRPGQDVTV TD+GK FTCT 
Sbjct  812  NLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILP+VIR L +Q
Sbjct  872  RFDTEVELAYFDHGGILPFVIRNLIKQ  898



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   276 bits (705),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAG+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  845  GEKLSVFDAAMKYKSAGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  904

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+I+PGQDVTV TD GK FTCT 
Sbjct  905  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIKPGQDVTVTTDNGKSFTCTV  964

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  965  RFDTEVELAYFNHGGILPYVIRNLSKQ  991



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   276 bits (705),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYK+ G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  850  GEKLYVFDAATRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  909

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT 
Sbjct  910  NLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTV  969

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIR L++Q
Sbjct  970  RFDTEVELAYFNHGGILHYVIRNLSKQ  996



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   275 bits (704),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYKSAG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  853  GEKLYVFDAAMRYKSAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  912

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK G+DADTLGLTGHERY+IDLPS I +IRPGQDVTV TD GK F CT 
Sbjct  913  NLVGMGIIPLCFKDGQDADTLGLTGHERYSIDLPSNIGEIRPGQDVTVTTDNGKSFICTV  972

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPY IR L +Q
Sbjct  973  RFDTEVELAYFNHGGILPYAIRNLMKQ  999



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   275 bits (704),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK F+CT 
Sbjct  909  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFSCTV  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  969  RFDTEVELAYFNHGGILPYVIRNLSKQ  995



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   275 bits (704),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  852  GEKLSVYDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  911

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTGHERYTI LP+ I +IRPGQDVTV TD GK FTCT 
Sbjct  912  NLVGMGIVPLCFKAGEDADTLGLTGHERYTIHLPTNILEIRPGQDVTVTTDNGKSFTCTV  971

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY+NHGGILPYVIR L++Q
Sbjct  972  RFDTEVELAYYNHGGILPYVIRNLSKQ  998



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   275 bits (704),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYK+ G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  848  GEKLYVFDAATRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  907

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT 
Sbjct  908  NLVGMGIVPLCFKAGEDADTLGLTGHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTV  967

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIR L++Q
Sbjct  968  RFDTEVELAYFNHGGILHYVIRNLSKQ  994



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   275 bits (703),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAG  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  850  GEKLSVFDAAMKYKSAGHGTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  909

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHER++IDLPSKIS+IRPGQDVTV TD+GK FTCT 
Sbjct  910  NLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTV  969

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILP+VIR L +Q
Sbjct  970  RFDTEVELAYFDHGGILPFVIRNLIKQ  996



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   275 bits (703),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAG  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  854  GEKLSVFDAAMKYKSAGHGTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  913

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHER++IDLPSKIS+IRPGQDVTV TD+GK FTCT 
Sbjct  914  NLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTV  973

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILP+VIR L +Q
Sbjct  974  RFDTEVELAYFDHGGILPFVIRNLIKQ  1000



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   276 bits (705),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYV+DAAMRYKSAG DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  918   GEKLYVYDAAMRYKSAGHDTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  977

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGIIPLCFK GEDA+ LGLTGHERYTIDLP +ISDIRPGQD+TV TD+GK FTCT 
Sbjct  978   NLVGMGIIPLCFKPGEDAEALGLTGHERYTIDLPQRISDIRPGQDLTVTTDSGKSFTCTL  1037

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQ  310
             RFDTEVELAYF+HGGILPYVIR L++
Sbjct  1038  RFDTEVELAYFDHGGILPYVIRNLSK  1063



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   275 bits (703),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+A Q T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  841  GEKLSVFDAAMKYKTANQGTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  900

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTGHERYTIDLPS I +IRPGQD+TV T+TGK F CTA
Sbjct  901  NLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPSNIDEIRPGQDITVTTNTGKSFICTA  960

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L +Q
Sbjct  961  RFDTEVELAYFNHGGILPYVIRNLIKQ  987



>gb|ADP03320.1| aconitate hydratase [Pinus pinaster]
Length=371

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYKSAG DT++LAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  223  GEKLSVYDAAMRYKSAGHDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  282

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDA++LGLTGHERYTID+P+ I+ ++PGQD+TV TDTGK FTC A
Sbjct  283  NLVGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVA  342

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDT+VEL YFNH GILPYV+RQL
Sbjct  343  RFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSS DWAAKGPML GVKAVIAKSFERIHRS
Sbjct  845  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSSDWAAKGPMLQGVKAVIAKSFERIHRS  904

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  905  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTV  964

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  965  RFDTEVELAYFNHGGILPYVIRNLSKQ  991



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   274 bits (701),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYK+AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  849  GEKLSVYDAAMRYKNAGLDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAG+DADTLGLTGHERYTIDLPS IS+IRPGQDVTV TD GK FTCTA
Sbjct  909  NLVGMGIIPLCFKAGQDADTLGLTGHERYTIDLPSNISEIRPGQDVTVTTDNGKSFTCTA  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDT VEL YFNHGGILPY IR L +Q
Sbjct  969  RFDTAVELEYFNHGGILPYAIRSLMKQ  995



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   274 bits (701),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYK+AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  849  GEKLSVYDAAMRYKNAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAG+DADTLGLTGHERYTIDLPS IS+IRPGQDVTV TD GK FTCT 
Sbjct  909  NLVGMGIIPLCFKAGQDADTLGLTGHERYTIDLPSNISEIRPGQDVTVTTDNGKSFTCTV  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDT VEL YFNHGGILPY IR L +Q
Sbjct  969  RFDTAVELEYFNHGGILPYAIRNLMKQ  995



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   274 bits (701),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYVFDAAMRYKSAG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  855   GEKLYVFDAAMRYKSAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  914

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGIIPLCFKAG+DADTLGLTGHERY+IDLPS I +IRPGQDVTV TD GK F CT 
Sbjct  915   NLVGMGIIPLCFKAGQDADTLGLTGHERYSIDLPSNIDEIRPGQDVTVTTDNGKSFICTV  974

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQQ  307
             RFDTEVELAYFNHGGIL Y IR L +Q
Sbjct  975   RFDTEVELAYFNHGGILQYAIRNLMKQ  1001



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYK+AGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVYDAAMRYKTAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLPS +S+IRPGQDVTV TD+G+ FTCT 
Sbjct  812  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL YVIR L
Sbjct  872  RFDTEVELAYFNHGGILQYVIRNL  895



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RYK+AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  839  GEKLYVFDAAERYKAAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  898

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTG ERYTIDLP KIS+I+PGQDVTV TDTGK FTC A
Sbjct  899  NLVGMGIIPLCFKSGEDADTLGLTGRERYTIDLPDKISEIKPGQDVTVTTDTGKSFTCKA  958

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVEL YFNHGGILPYVIR L +
Sbjct  959  RFDTEVELEYFNHGGILPYVIRNLAK  984



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAG+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  848  GEKLSVFDAAMKYKSAGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  907

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+IRPGQDV+V TD GK F CT 
Sbjct  908  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEIRPGQDVSVTTDNGKSFNCTV  967

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  968  RFDTEVELAYFNHGGILPYVIRNLSKQ  994



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL+VFDAA RYK+ G DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLFVFDAATRYKADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT 
Sbjct  812  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YFNHGGIL YVIR L++Q
Sbjct  872  RFDTEVELEYFNHGGILQYVIRNLSKQ  898



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   273 bits (699),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYKS G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  848  GEKLYVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  907

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERY+IDLP+ +S+IRPGQDVTV TD GK FTCT 
Sbjct  908  NLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPANLSEIRPGQDVTVITDNGKSFTCTL  967

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGILPYVIR L
Sbjct  968  RFDTEVELAYFNHGGILPYVIRNL  991



>gb|ADP03120.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03121.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03122.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03125.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03127.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03128.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03129.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03130.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03131.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03135.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03137.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03138.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03140.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03145.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03147.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03148.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03150.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYKSAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  223  GEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  282

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDA++LGLTGHERYTID+P+ IS ++PGQD+TV TDTGK FTC A
Sbjct  283  NLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDISQLKPGQDITVTTDTGKSFTCVA  342

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDT+VEL YFNH GILPYV+RQL
Sbjct  343  RFDTQVELEYFNHAGILPYVMRQL  366



>gb|ADP03143.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYKSAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  223  GEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  282

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDA++LGLTGHERYTID+P+ IS ++PGQD+TV TDTGK FTC A
Sbjct  283  NLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDISQLKPGQDITVTTDTGKSFTCVA  342

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDT+VEL YFNH GILPYV+RQL
Sbjct  343  RFDTQVELEYFNHAGILPYVMRQL  366



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   272 bits (695),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VF+AA +YKSAGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFEAAEKYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDAD+LGLTGHERYTIDLP  IS IRPGQDVTV TD+GK FTCT 
Sbjct  812  NLVGMGIIPLCFKSGEDADSLGLTGHERYTIDLPDDISKIRPGQDVTVTTDSGKSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFN+GGILPYVIR L +Q
Sbjct  872  RFDTEVELAYFNNGGILPYVIRNLIKQ  898



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   273 bits (697),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL+VFDAA RYK+ G DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  846  GEKLFVFDAATRYKADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  905

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT 
Sbjct  906  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISEIKPGQDVTVTTDNGKAFTCTV  965

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YFNHGGIL YVIR L++Q
Sbjct  966  RFDTEVELEYFNHGGILQYVIRNLSKQ  992



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   273 bits (697),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL+VFDAA RYK+ G DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  848  GEKLFVFDAATRYKADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  907

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT 
Sbjct  908  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTV  967

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YFNHGGIL YVIR L++Q
Sbjct  968  RFDTEVELEYFNHGGILQYVIRNLSKQ  994



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   273 bits (697),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL+VFDAA RYK+ G DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  848  GEKLFVFDAATRYKADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  907

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT 
Sbjct  908  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTV  967

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YFNHGGIL YVIR L++Q
Sbjct  968  RFDTEVELEYFNHGGILQYVIRNLSKQ  994



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   273 bits (697),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA RYK+AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  853  GEKLSVFDAASRYKTAGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRS  912

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDADTLGLTGHERYT+ LP+K+SDIRPGQDVTV TDTGK F CT 
Sbjct  913  NLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTL  972

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  973  RFDTEVELAYYDHGGILPYVIRSLSTK  999



>gb|AFW61054.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=797

 Score =   270 bits (689),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  649  GEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERY+IDLP+ +S+IRPGQDVTV TD GK FTC  
Sbjct  709  NLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIV  768

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGILPYVIR L
Sbjct  769  RFDTEVELAYFNHGGILPYVIRNL  792



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   272 bits (696),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKS+G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  842  GEKLSVFDAAMKYKSSGVDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  901

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHER+TI LP+ IS+IRPGQDVTV TD GK FTCT 
Sbjct  902  NLVGMGIIPLCFKSGEDADTLGLTGHERFTIHLPTDISEIRPGQDVTVTTDNGKSFTCTV  961

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  962  RFDTEVELAYFNHGGILPYVIRNLSKQ  988



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   271 bits (693),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEK+ VFDAAMRYKS GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKISVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHERY+I+LPS +S+IRPGQDVTV TD+GK FTCT 
Sbjct  812  NLVGMGIIPLCFKPGEDAETLGLTGHERYSINLPSNVSEIRPGQDVTVVTDSGKSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGILPYVIR L
Sbjct  872  RFDTEVELAYFDHGGILPYVIRNL  895



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   271 bits (693),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYK+AGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKA IAKSFERIHRS
Sbjct  752  GEKLSVYDAAMRYKTAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAAIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLPS +S+IRPGQDVTV TD+G+ FTCT 
Sbjct  812  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL YVIR L
Sbjct  872  RFDTEVELAYFNHGGILQYVIRNL  895



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   272 bits (696),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYV+DAAMRYKS+GQDT++LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  864   GEKLYVYDAAMRYKSSGQDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  923

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGI+PLCFKAGEDA+TLGLTGHERYTIDLP K SDI+PGQD+TV TD GK FTCT 
Sbjct  924   NLVGMGILPLCFKAGEDAETLGLTGHERYTIDLPEKTSDIKPGQDITVTTDNGKSFTCTL  983

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQQ  307
             RFDTEVEL YF+HGGIL YVIR L++Q
Sbjct  984   RFDTEVELTYFDHGGILQYVIRNLSKQ  1010



>gb|ADP03151.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYKSAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  223  GEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  282

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDA++LGLTGHERYTID+P+ I+ ++PGQD+TV TDTGK FTC A
Sbjct  283  NLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVA  342

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDT+VEL YFNH GILPYV+RQL
Sbjct  343  RFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAA RY +AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  850  GEKLYVFDAASRYMAAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  909

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK G+DADTLGL+GHERYTIDLPS IS+I+PGQDVTV TD GK FTCTA
Sbjct  910  NLVGMGIIPLCFKPGQDADTLGLSGHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTA  969

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVEL YFNHGGILPYVIR L +
Sbjct  970  RFDTEVELEYFNHGGILPYVIRNLMK  995



>gb|ADP03123.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03124.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03126.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03132.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03133.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03136.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03141.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03142.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03146.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03149.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03152.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03153.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYKSAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  223  GEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  282

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDA++LGLTGHERYTID+P+ I+ ++PGQD+TV TDTGK FTC A
Sbjct  283  NLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVA  342

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDT+VEL YFNH GILPYV+RQL
Sbjct  343  RFDTQVELEYFNHAGILPYVMRQL  366



>gb|ADP03134.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03139.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYKSAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  223  GEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  282

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDA++LGLTGHERYTID+P+ I+ ++PGQD+TV TDTGK FTC A
Sbjct  283  NLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVA  342

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDT+VEL YFNH GILPYV+RQL
Sbjct  343  RFDTQVELEYFNHAGILPYVMRQL  366



>gb|ADP03144.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYKSAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  223  GEKLSVYDAAMRYKSAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  282

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDA++LGLTGHERYTID+P+ I+ ++PGQD+TV TDTGK FTC A
Sbjct  283  NLAGMGIIPLCFKSGEDAESLGLTGHERYTIDIPNDITKLKPGQDITVTTDTGKSFTCVA  342

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDT+VEL YFNH GILPYV+RQL
Sbjct  343  RFDTQVELEYFNHAGILPYVMRQL  366



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYVFD AMRYK+ G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  862   GEKLYVFDVAMRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  921

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMG+IPLCFK G+DAD+LGLTGHERYTIDLPS I++IRPGQDVTV TD GK FTCT 
Sbjct  922   NLVGMGVIPLCFKPGQDADSLGLTGHERYTIDLPSNINEIRPGQDVTVVTDAGKSFTCTV  981

Query  387   RFDTEVELAYFNHGGILPYVIRQL  316
             RFDTEVELAYFNHGGILPYVIR L
Sbjct  982   RFDTEVELAYFNHGGILPYVIRNL  1005



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   271 bits (693),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRYK+AGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKA IAKSFERIHRS
Sbjct  781  GEKLSVYDAAMRYKTAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAAIAKSFERIHRS  840

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLPS +S+IRPGQDVTV TD+G+ FTCT 
Sbjct  841  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTV  900

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL YVIR L
Sbjct  901  RFDTEVELAYFNHGGILQYVIRNL  924



>gb|ABK25210.1| unknown [Picea sitchensis]
Length=565

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAA+RYKSAGQDT++LAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  417  GEKLSVYDAAIRYKSAGQDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  476

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDA++LGLTGHERY+IDLP+ I+ ++PGQD+TV TDTGK FTC A
Sbjct  477  NLVGMGIIPLCFKSGEDAESLGLTGHERYSIDLPNDIAQLKPGQDITVTTDTGKSFTCVA  536

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDT+VEL YFNHGGILPYVIRQL
Sbjct  537  RFDTQVELEYFNHGGILPYVIRQL  560



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   271 bits (694),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYV+DAAMRYKSAG DT++LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  865   GEKLYVYDAAMRYKSAGHDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  924

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGIIPLCFK GEDADTLGLTG ERYTIDLP+K SDIRPGQD+TV TD GK FTCT 
Sbjct  925   NLVGMGIIPLCFKPGEDADTLGLTGQERYTIDLPTKKSDIRPGQDITVTTDNGKSFTCTL  984

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQQ  307
             RFDTEVELAYF+HGGIL YVIR L++Q
Sbjct  985   RFDTEVELAYFDHGGILQYVIRNLSKQ  1011



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YKSAG  T+ILAGAEYGSGSSRDWAAKGPMLL +KAVIAKSFERIHRS
Sbjct  850  GEKLSVFDAAMKYKSAGHGTIILAGAEYGSGSSRDWAAKGPMLLVIKAVIAKSFERIHRS  909

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHER++IDLPSKIS+IRPGQDVTV TD+GK FTCT 
Sbjct  910  NLVGMGIIPLCFKAGEDADSLGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTV  969

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILP+VIR L +Q
Sbjct  970  RFDTEVELAYFDHGGILPFVIRNLIKQ  996



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAAMRYKSSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTI LP+ IS+I P QDVTV TD GK FTCT 
Sbjct  909  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIHLPTDISEISPCQDVTVTTDNGKSFTCTV  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  969  RFDTEVELAYFNHGGILPYVIRNLSKQ  995



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   271 bits (692),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+AG+ T+ILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  831  GEKLSVFDAAMRYKAAGEATIILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  890

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTG ERYTI LP+ IS+IRPGQDVTV TDTGK FTCT 
Sbjct  891  NLVGMGIIPLCFKSGEDADTLGLTGKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTV  950

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  951  RFDTEVELAYFNHGGILPYVIRNLSKQ  977



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   271 bits (693),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYVFDAAMRYK+ G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  861   GEKLYVFDAAMRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  920

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGIIPLCFK G+DAD+LGLTGHE YTIDLPS I++IRPGQDVTV TD GK FTCT 
Sbjct  921   NLVGMGIIPLCFKPGQDADSLGLTGHELYTIDLPSNINEIRPGQDVTVVTDAGKSFTCTV  980

Query  387   RFDTEVELAYFNHGGILPYVIRQL  316
             RFDTEVELAYFNHGGILPYVIR L
Sbjct  981   RFDTEVELAYFNHGGILPYVIRSL  1004



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   271 bits (692),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKLYV+DAAMRYKSAG  T+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  871   GEKLYVYDAAMRYKSAGHGTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  930

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGIIPLCFK GED +TLGLTGHERYTIDLP  ISDIRPGQD+TV TD G+ FTC  
Sbjct  931   NLVGMGIIPLCFKPGEDTETLGLTGHERYTIDLPHSISDIRPGQDITVTTDNGRSFTCIL  990

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQQ  307
             RFDTEVELAYF+HGGILPYVIR L++Q
Sbjct  991   RFDTEVELAYFDHGGILPYVIRNLSKQ  1017



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score =   270 bits (689),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERY IDLPS +++IRPGQDVTV TD GK FTCT 
Sbjct  812  NLVGMGIIPLCFKPGEDAETFGLTGHERYNIDLPSSVAEIRPGQDVTVTTDNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGILP+VIR L Q
Sbjct  872  RFDTEVELAYFDHGGILPFVIRNLIQ  897



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   270 bits (690),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  839  GEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  898

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERY+IDLP+ +S+IRPGQDVTV TD GK FTC  
Sbjct  899  NLVGMGIIPLCFKAGEDADSLGLTGHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIV  958

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGILPYVIR L
Sbjct  959  RFDTEVELAYFNHGGILPYVIRNL  982



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   270 bits (690),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL+VFDAAMRYK AG++T++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHR 
Sbjct  844  GEKLHVFDAAMRYKEAGENTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRG  903

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTGHERYTIDLP KIS+IRPGQ+V V+TDTGK F C  
Sbjct  904  NLVGMGIIPLCFKPGEDADTLGLTGHERYTIDLPDKISEIRPGQEVGVKTDTGKSFACRV  963

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGILPYVIR L+++
Sbjct  964  RFDTEVELAYFDHGGILPYVIRNLSKE  990



>ref|XP_010438674.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=795

 Score =   267 bits (683),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+AGQDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  649  GEKLSVFDAASKYKTAGQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT 
Sbjct  709  NLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTL  768

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  769  RFDTEVELAYYDHGGILPYVIRSLSTK  795



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   269 bits (687),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+D AMRYK+AGQDT+ILAG EYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVYDVAMRYKAAGQDTIILAGVEYGSGSSRDWAAKGPVLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLP+ +S+IRPGQDVTV TD GK FTCT 
Sbjct  812  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPNTVSEIRPGQDVTVATDCGKSFTCTV  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL YVIR L
Sbjct  872  RFDTEVELAYFNHGGILQYVIRNL  895



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score =   269 bits (688),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA RYK+AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAV AKSFERIHRS
Sbjct  816  GEKLTVFDAASRYKTAGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVTAKSFERIHRS  875

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDADTLGLTGHERYT+ LP+K+SDIRPGQDVTV TDTGK F CT 
Sbjct  876  NLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTL  935

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  936  RFDTEVELAYYDHGGILPYVIRSLSTK  962



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   269 bits (687),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYVFDAAMRYK AGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRS
Sbjct  853  GEKLYVFDAAMRYKEAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFETIHRS  912

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTG+ERYTIDLP KIS+IRPGQDVTV TD G  FTC A
Sbjct  913  NLVGMGIIPLCFKPGEDADTLGLTGNERYTIDLPDKISEIRPGQDVTVTTDNGNSFTCIA  972

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDT+VELAYF+HGGIL YVIR L ++
Sbjct  973  RFDTQVELAYFDHGGILQYVIRNLIKE  999



>ref|NP_001159229.1| uncharacterized protein LOC100304315 [Zea mays]
 gb|ACN25517.1| unknown [Zea mays]
 gb|AFW89612.1| hypothetical protein ZEAMMB73_646589 [Zea mays]
Length=685

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            G+KL VFDAAM+YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  539  GDKLSVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  598

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT 
Sbjct  599  NLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTL  658

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR++ +Q
Sbjct  659  RFDTEVELAYYDHGGILPYVIRKIAEQ  685



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   268 bits (686),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA RY +AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAASRYMNAGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDADTLGLTGHERYT+ LP+K+SDI+PGQDVTV TDTGK F CT 
Sbjct  909  NLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTL  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  969  RFDTEVELAYYDHGGILPYVIRSLSAK  995



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   268 bits (685),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+AG+ T+ILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  835  GEKLSVFDAAMKYKAAGEATIILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  894

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDAD+LGLTG ERYTI LP+ IS+IRPGQDVTV TDTGK FTCT 
Sbjct  895  NLVGMGIIPLCFKSGEDADSLGLTGKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTV  954

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  955  RFDTEVELAYFNHGGILPYVIRNLSKQ  981



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   268 bits (685),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA RY +AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAASRYMNAGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDADTLGLTGHERYT+ LP+K+SDI+PGQDVTV TDTGK F CT 
Sbjct  909  NLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTL  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  969  RFDTEVELAYYDHGGILPYVIRSLSAK  995



>gb|KDO71349.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=565

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+ G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  417  GEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  476

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  
Sbjct  477  NLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVI  536

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL YVIR L
Sbjct  537  RFDTEVELAYFDHGGILQYVIRNL  560



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   268 bits (685),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA+RYKS G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  844  GEKLSVFDAALRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  903

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHERYTI+LPS +SDI+PGQDVTV TD GK FTC  
Sbjct  904  NLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPSSVSDIKPGQDVTVVTDNGKSFTCIV  963

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAY+NHGGILP+VIR L
Sbjct  964  RFDTEVELAYYNHGGILPFVIRNL  987



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   268 bits (684),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+AGQDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  852  GEKLSVFDAASKYKTAGQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRS  911

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT 
Sbjct  912  NLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTL  971

Query  387  RFDTEVELAYFNHGGILPYVIRQLT  313
            RFDTEVELAY++HGGILPYVIR L+
Sbjct  972  RFDTEVELAYYDHGGILPYVIRSLS  996



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   268 bits (684),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            G+KLYVF+ AMRYK+ G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  855  GDKLYVFEVAMRYKADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  914

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHERYTIDLPS I+DIRPGQD+TV  D GK FTCT 
Sbjct  915  NLVGMGIIPLCFKPGEDAETLGLTGHERYTIDLPSSITDIRPGQDITVVVDNGKSFTCTL  974

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGILP+VIR L
Sbjct  975  RFDTEVELAYFNHGGILPFVIRNL  998



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   267 bits (683),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA+RYKS G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAAVRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHERYTI+LPS +SDI+PGQDVTV TD GK FTC  
Sbjct  909  NLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPSSVSDIKPGQDVTVVTDNGKSFTCIV  968

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAY+NHGGILP+VIR L
Sbjct  969  RFDTEVELAYYNHGGILPFVIRNL  992



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   267 bits (683),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA RY +AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAVI+KSFERIHRS
Sbjct  849  GEKLSVFDAASRYMNAGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVISKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDADTLGLTGHERYT+ LP+K+SDI+PGQDVTV TDTGK F CT 
Sbjct  909  NLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTL  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  969  RFDTEVELAYYDHGGILPYVIRSLSAK  995



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   267 bits (682),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS   DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  847  GEKLSVFDAAMRYKSEEHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  906

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHERYTI+LP  +SDI+PGQDVTV TD GK FTCT 
Sbjct  907  NLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPDNVSDIKPGQDVTVVTDNGKSFTCTV  966

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAY+NHGGILP+VIR L
Sbjct  967  RFDTEVELAYYNHGGILPFVIRNL  990



>gb|KEH27599.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=797

 Score =   264 bits (675),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  649  GEKLSVFDAANKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLPS +++IRPGQD+TV TD GK F+CT 
Sbjct  709  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSSVNEIRPGQDITVVTDNGKTFSCTL  768

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL Y IR L
Sbjct  769  RFDTEVELAYFNHGGILQYAIRNL  792



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   266 bits (681),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+AG+ T+ILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  834  GEKLSVFDAAMKYKAAGEATIILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  893

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDA++LGLTG ERYTI LP+ IS+IRPGQDVTV TDTGK FTCT 
Sbjct  894  NLVGMGIIPLCFKSGEDAESLGLTGKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTV  953

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGILPYVIR L++Q
Sbjct  954  RFDTEVELAYFNHGGILPYVIRNLSRQ  980



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHER+TIDLPS + +IRPGQDV V TDTGK F+C  
Sbjct  812  NLVGMGIIPLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCIL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L   
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIHS  898



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   266 bits (681),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GE+LYV+DAAMRYKSAGQDT+ILAG EYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  864   GEELYVYDAAMRYKSAGQDTIILAGTEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  923

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NLVGMGIIPLCFK GEDADTLGLTG+ERY+IDLP K+SD+RPGQD+TV TD GK FTC  
Sbjct  924   NLVGMGIIPLCFKPGEDADTLGLTGYERYSIDLPKKVSDVRPGQDITVTTDDGKSFTCVV  983

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQ  310
             RFDT+VEL YF+HGGILPYVIR L +
Sbjct  984   RFDTQVELTYFDHGGILPYVIRNLAK  1009



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK G+DA+TLGLTGHERYTIDLPS +S+I+PGQD+TV TD GK FTCT 
Sbjct  812  NLVGMGIIPLCFKPGQDAETLGLTGHERYTIDLPSSVSEIKPGQDITVVTDNGKSFTCTM  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL Y IR L
Sbjct  872  RFDTEVELAYFDHGGILQYAIRNL  895



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  770  GEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  829

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK G+DA+TLGLTGHERYTIDLPS +S+I+PGQD+TV TD GK FTCT 
Sbjct  830  NLVGMGIIPLCFKPGQDAETLGLTGHERYTIDLPSSVSEIKPGQDITVVTDNGKSFTCTM  889

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL Y IR L
Sbjct  890  RFDTEVELAYFDHGGILQYAIRNL  913



>tpg|DAA43249.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=685

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  539  GEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  598

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLC+KAGEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT 
Sbjct  599  NLAGMGIIPLCYKAGEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTL  658

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYV R++ +Q
Sbjct  659  RFDTEVELAYYDHGGILPYVARKIAEQ  685



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  733  GEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  792

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDAD+LGLTGHER+TIDLPS + +IRPGQDV V TDTGK F+C  
Sbjct  793  NLVGMGIVPLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCIL  852

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L   
Sbjct  853  RFDTEVELAYFDHGGILQYVIRNLIHS  879



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFD AMRYK  G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  829  GEKLSVFDTAMRYKDEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  888

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFK GEDADTLGLTGHERYTI+LPS +SDI+PGQDVTV TDTGK FTCT 
Sbjct  889  NLVGMGIVPLCFKPGEDADTLGLTGHERYTINLPSNVSDIKPGQDVTVTTDTGKLFTCTV  948

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAY+ HGGILPYV+R L
Sbjct  949  RFDTEVELAYYGHGGILPYVVRSL  972



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKSEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDAD+LGLTGHER+TIDLPS + +IRPGQDV V TDTGK F+C  
Sbjct  812  NLVGMGIVPLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCIL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L   
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIHS  898



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA RY +AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAVI+KSFERIHRS
Sbjct  853  GEKLSVFDAASRYMNAGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVISKSFERIHRS  912

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDA+TLGLTGHERYT+ LP+K+S+IRPGQDVTV TDTGK F CT 
Sbjct  913  NLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSEIRPGQDVTVTTDTGKSFVCTL  972

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  973  RFDTEVELAYYDHGGILPYVIRSLSTK  999



>gb|KHG24816.1| Aconitate hydratase 1 -like protein [Gossypium arboreum]
Length=813

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+DAAMRY +AGQDT+ILAGAEYGSGSSRDWAAKGPM+LG+KAVIAKSFE+IHRS
Sbjct  665  GEKLSVYDAAMRYNTAGQDTIILAGAEYGSGSSRDWAAKGPMMLGIKAVIAKSFEQIHRS  724

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK G+DADTLGLTGHERYTI+LP+ +S+IRPGQDVTV TDT K F+CT 
Sbjct  725  NLVGMGIIPLCFKPGDDADTLGLTGHERYTINLPNSVSEIRPGQDVTVATDTSKSFSCTV  784

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL YVIR L
Sbjct  785  RFDTEVELAYFNHGGILQYVIRNL  808



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYV+DAAMRYKS G DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  834  GEKLYVYDAAMRYKSEGHDTIVVAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  893

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMG+IPL FK GEDA+TLGLTGHE YTIDLP KISDIRPGQDV V TD+GK F CT 
Sbjct  894  NLVGMGLIPLSFKHGEDAETLGLTGHECYTIDLPQKISDIRPGQDVAVTTDSGKSFICTL  953

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YF HGGILPYVIR LT+Q
Sbjct  954  RFDTEVELTYFEHGGILPYVIRNLTKQ  980



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  840  GEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  899

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDADTLGLTGHERYTI LP+ +S+I+PGQDVTV TDTGK FTCT 
Sbjct  900  NLAGMGIIPLCFKAGEDADTLGLTGHERYTIHLPTNVSEIKPGQDVTVTTDTGKSFTCTL  959

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYV R++ +Q
Sbjct  960  RFDTEVELAYYDHGGILPYVTRKIAEQ  986



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   265 bits (678),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+A QDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAASKYKTAEQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TDTGK F CT 
Sbjct  909  NLAGMGIIPLCFKSGEDAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTL  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  969  RFDTEVELAYYDHGGILPYVIRSLSAK  995



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+A QDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  761  GEKLSVFDAASKYKTAEQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRS  820

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT 
Sbjct  821  NLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTL  880

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  881  RFDTEVELAYYDHGGILPYVIRSLSAK  907



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   265 bits (678),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+ GQDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  851  GEKLSVFDAASKYKTDGQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRS  910

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT 
Sbjct  911  NLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTL  970

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  971  RFDTEVELAYYDHGGILPYVIRSLSTK  997



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   265 bits (678),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDA MRYKS G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAV+AKSFERIHRS
Sbjct  850  GEKLSVFDATMRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVVAKSFERIHRS  909

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHERYTI+LP+ +SDI+PGQDVTV TD GK F CT 
Sbjct  910  NLVGMGIIPLCFKPGEDAETLGLTGHERYTINLPNSVSDIKPGQDVTVVTDNGKQFACTV  969

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAY+NHGGILP+VIR L
Sbjct  970  RFDTEVELAYYNHGGILPFVIRNL  993



>gb|KDO71348.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=702

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+ G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  554  GEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  613

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  
Sbjct  614  NLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVI  673

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL YVIR L
Sbjct  674  RFDTEVELAYFDHGGILQYVIRNL  697



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  753  GEKLSVFDAANKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  812

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDADTLGLTGHERYTIDLPS +++IRPGQD+TV TD GK F+CT 
Sbjct  813  NLVGMGIIPLCFKSGEDADTLGLTGHERYTIDLPSSVNEIRPGQDITVVTDNGKTFSCTL  872

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL Y IR L
Sbjct  873  RFDTEVELAYFNHGGILQYAIRNL  896



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+AGQDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAASKYKTAGQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDA++LGLTGHERYT+ LP+K+S+IRPGQDVTV TD+GK F CT 
Sbjct  909  NLAGMGIIPLCFKAGEDAESLGLTGHERYTVHLPTKVSEIRPGQDVTVTTDSGKSFVCTL  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  969  RFDTEVELAYYDHGGILPYVIRSLSTK  995



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL  FDAA RYKS G DT++LAG EYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  838  GEKLSAFDAATRYKSEGHDTIVLAGEEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  897

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDA+TLGLTGHERYTI LPS +SDI+PGQDVTV TDTGK FTCT 
Sbjct  898  NLVGMGIIPLCFKSGEDAETLGLTGHERYTIHLPSNVSDIKPGQDVTVTTDTGKSFTCTV  957

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAY+NHGGILPYVIR L +
Sbjct  958  RFDTEVELAYYNHGGILPYVIRSLIK  983



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            G+KLYVF+AAMRYK+ G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  845  GDKLYVFEAAMRYKADGYDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  904

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG+E YTIDLPS ISDIRPGQD+TV TD+GK FTCT 
Sbjct  905  NLVGMGIIPLCFKPGEDAETLGLTGYESYTIDLPSCISDIRPGQDITVVTDSGKSFTCTL  964

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGILP+VIR L
Sbjct  965  RFDTEVELAYFNHGGILPFVIRNL  988



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   265 bits (676),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+A QDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRS
Sbjct  849  GEKLSVFDAASKYKTAEQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT 
Sbjct  909  NLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTL  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  969  RFDTEVELAYYDHGGILPYVIRSLSAK  995



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   263 bits (673),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTG ERYTIDLPS +S+IRPGQD+TV TD GK F CT 
Sbjct  812  NLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSEIRPGQDITVVTDNGKSFICTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L +
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIK  897



>sp|Q42669.1|ACOC_CUCMC RecName: Full=Aconitate hydratase; Short=Aconitase; AltName: 
Full=Citrate hydro-lyase, partial [Cucumis melo var. conomon]
 emb|CAA58047.1| aconitase [Cucumis melo]
Length=764

 Score =   261 bits (667),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  744  EKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSN  565
            EKL VFDAAMRYKS GQDT+ILAGAEYG GSSRDWAAKGPMLLGVKAVIAKSFERIHRSN
Sbjct  617  EKLSVFDAAMRYKSEGQDTIILAGAEYGIGSSRDWAAKGPMLLGVKAVIAKSFERIHRSN  676

Query  564  LVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTAR  385
            LVGMGIIPLCFKAGEDAD+LGLTGHER+TIDLPS + +IRPGQDV V TDTGK F+C  R
Sbjct  677  LVGMGIIPLCFKAGEDADSLGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILR  736

Query  384  FDTEVELAYFNHGGILPYVIRQLTQQ  307
            FDTEVELAYF+HGGIL YVIR L   
Sbjct  737  FDTEVELAYFDHGGILQYVIRNLIHS  762



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            G+KL VFDAAM+YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  843  GDKLSVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  902

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT 
Sbjct  903  NLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTL  962

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR++ +Q
Sbjct  963  RFDTEVELAYYDHGGILPYVIRKIAEQ  989



>gb|KDO71347.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=797

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+ G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  649  GEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  
Sbjct  709  NLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVI  768

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL YVIR L
Sbjct  769  RFDTEVELAYFDHGGILQYVIRNL  792



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFD AM+YKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDVAMKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTGHERY+IDLP+ +S+IRPGQDV V TD GK FTCT 
Sbjct  812  NLVGMGIIPLCFKTGEDADTLGLTGHERYSIDLPNSVSEIRPGQDVKVLTDNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L  
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIH  897



>ref|XP_008363078.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase 1-like [Malus 
domestica]
Length=795

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  649  GEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTG ERYTI+LPS +S+IRPGQDVTV TD GK F CT 
Sbjct  709  NLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTL  768

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L + 
Sbjct  769  RFDTEVELAYFDHGGILQYVIRNLIKS  795



>ref|XP_008344247.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=779

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  633  GEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  692

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTG ERYTI+LPS +S+IRPGQDVTV TD GK F CT 
Sbjct  693  NLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTL  752

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L + 
Sbjct  753  RFDTEVELAYFDHGGILQYVIRNLIKS  779



>ref|XP_008393748.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=795

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  649  GEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTG ERYTI+LPS +S+IRPGQDVTV TD GK F CT 
Sbjct  709  NLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTL  768

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L + 
Sbjct  769  RFDTEVELAYFDHGGILQYVIRNLIKS  795



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  845  GEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  904

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT 
Sbjct  905  NLAGMGIIPLCFKAGEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTL  964

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYV R++ +Q
Sbjct  965  RFDTEVELAYYDHGGILPYVTRKIAEQ  991



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  710  GEKLSVFDAATKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  769

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERYTI+LP+ +S+IRPGQDVT+ TD  K FTC  
Sbjct  770  NLVGMGIIPLCFKAGEDADSLGLTGHERYTINLPTDVSEIRPGQDVTISTDNDKSFTCIL  829

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAY+NHGGILPYVIR +
Sbjct  830  RFDTEVELAYYNHGGILPYVIRNM  853



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFD AMRYKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDVAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTG ERYTIDLPS +S+IRPGQD+TV TD GK F CT 
Sbjct  812  NLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSEIRPGQDITVVTDNGKSFVCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L +
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIK  897



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFD AMRYKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDVAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTG ERYTIDLPS +S+IRPGQD+TV TD GK F CT 
Sbjct  812  NLVGMGIIPLCFKTGEDADSLGLTGEERYTIDLPSSVSEIRPGQDITVVTDNGKSFVCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L +
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIK  897



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTG ERYTI+LPS +S+IRPGQDVTV TD GK F CT 
Sbjct  812  NLVGMGIIPLCFKTGEDADSLGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L +
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIK  897



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA RYKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  839  GEKLSVFDAATRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  898

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLC+K GEDAD+LGLTGHER+TI+LP+ +S IRPGQDVT+ TD GK F+CT 
Sbjct  899  NLVGMGIIPLCYKTGEDADSLGLTGHERFTINLPTDVSKIRPGQDVTITTDNGKSFSCTL  958

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY+NHGGILPYVIR L  Q
Sbjct  959  RFDTEVELAYYNHGGILPYVIRSLAGQ  985



>gb|EMS48231.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=860

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  713  GEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  772

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGI+PLCFKAGEDADTLGLTGHERYTI LP+ +++I+PGQDVTV TD GK FTCT 
Sbjct  773  NLAGMGIVPLCFKAGEDADTLGLTGHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTL  832

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY+ HGGILPYVIR++  +
Sbjct  833  RFDTEVELAYYTHGGILPYVIRKIAAE  859



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score =   261 bits (667),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+ G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  741  GEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  800

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  
Sbjct  801  NLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVI  860

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL YVIR L
Sbjct  861  RFDTEVELAYFDHGGILQYVIRNL  884



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+ G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  733  GEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  792

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  
Sbjct  793  NLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVI  852

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL YVIR L
Sbjct  853  RFDTEVELAYFDHGGILQYVIRNL  876



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   261 bits (667),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+ G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  
Sbjct  812  NLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVI  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL YVIR L
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNL  895



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   261 bits (667),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+ G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  
Sbjct  812  NLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVI  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL YVIR L
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNL  895



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   261 bits (667),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+ G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  750  GEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  809

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  
Sbjct  810  NLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVI  869

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL YVIR L
Sbjct  870  RFDTEVELAYFDHGGILQYVIRNL  893



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   261 bits (667),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+ G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  
Sbjct  812  NLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVI  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL YVIR L
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNL  895



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  789  GEKLSVFDAATKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  848

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTGHERYTI+LP+ +S+IRPGQDVT+ TD  K FTC  
Sbjct  849  NLVGMGIIPLCFKAGEDADSLGLTGHERYTINLPTDVSEIRPGQDVTITTDNDKSFTCIL  908

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAY+NHGGILPYVIR +
Sbjct  909  RFDTEVELAYYNHGGILPYVIRNM  932



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   261 bits (668),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+A QDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSF RIHRS
Sbjct  849  GEKLSVFDAASKYKTAEQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFGRIHRS  908

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT 
Sbjct  909  NLAGMGIIPLCFKAGEDAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTL  968

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY++HGGILPYVIR L+ +
Sbjct  969  RFDTEVELAYYDHGGILPYVIRSLSAK  995



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score =   261 bits (666),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  847  GEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  906

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFKAGEDADTLGLTGHER+TI LP+ +SDI+PGQDVTV TD GK FTCT 
Sbjct  907  NLAGMGIIPLCFKAGEDADTLGLTGHERFTIQLPTNVSDIKPGQDVTVTTDAGKSFTCTL  966

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY+ +GGILPYVIR++  +
Sbjct  967  RFDTEVELAYYTNGGILPYVIRKIAAE  993



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYK+ G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKNEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+T GLTGHERYTIDLP+ +S+IRPGQDV V TD+GK FTC  
Sbjct  812  NLVGMGIIPLCFKPGEDAETHGLTGHERYTIDLPNSVSEIRPGQDVRVVTDSGKSFTCVI  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL YVIR L
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNL  895



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA++YKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  836  GEKLSVFDAALKYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  895

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIP+CFKAGEDAD+LGLTGHERYTI+LP+ +  IRPGQDVT+ T+ GK FTC  
Sbjct  896  NLVGMGIIPMCFKAGEDADSLGLTGHERYTINLPTDVGQIRPGQDVTITTEDGKSFTCIL  955

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAY+NHGGILPYVIR +
Sbjct  956  RFDTEVELAYYNHGGILPYVIRNM  979



>gb|KCW56578.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=797

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+D AMRYKS G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  649  GEKLSVYDVAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDA+TLGLTGHERYTI+LP+ +S+IRPGQD+TV+TD GK F CT 
Sbjct  709  NLVGMGIIPLCFKSGEDAETLGLTGHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTL  768

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL Y IR L
Sbjct  769  RFDTEVELAYFDHGGILQYAIRNL  792



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  756  GEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  815

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTG ERYTIDLPS + +I+PGQDVTV TD GK F CT 
Sbjct  816  NLVGMGIIPLCFKTGEDADTLGLTGEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTL  875

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L +
Sbjct  876  RFDTEVELAYFDHGGILQYVIRNLIK  901



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFD AMRYKS G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  751  GEKLSVFDVAMRYKSEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  810

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHE Y+IDLPS +S+IRPGQDVTV TD GK F CT 
Sbjct  811  NLVGMGIIPLCFKPGEDAETLGLTGHECYSIDLPSNVSEIRPGQDVTVVTDNGKSFACTL  870

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL Y IR L  
Sbjct  871  RFDTEVELAYFDHGGILQYAIRNLIH  896



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   259 bits (661),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  752  GEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG E YTIDLP+ +S+I+PGQD+TV T+ GK FTCT 
Sbjct  812  NLVGMGIIPLCFKTGEDAETLGLTGQELYTIDLPNNVSEIKPGQDITVVTNNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIR L +Q
Sbjct  872  RFDTEVELAYFNHGGILQYVIRNLIKQ  898



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score =   259 bits (661),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  760  GEKLSVFDAATKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  819

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDADTLGLTGHER+T+ LP+ +SDI+PGQDVTV TD GK FTCT 
Sbjct  820  NLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSDIKPGQDVTVTTDNGKSFTCTL  879

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY+++GGILPYVIR++ +Q
Sbjct  880  RFDTEVELAYYDNGGILPYVIRKIAEQ  906



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   259 bits (661),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTG ERYTIDLPS + +I+PGQDVTV TD GK F CT 
Sbjct  812  NLVGMGIIPLCFKTGEDADTLGLTGEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L +
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIK  897



>ref|NP_001119125.1| aconitate hydratase 1 [Arabidopsis thaliana]
 gb|AEE86577.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=795

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  649  GEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  708

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT 
Sbjct  709  NLVGMGIIPLCFKAGEDAETLGLTGQELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTL  768

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L +Q
Sbjct  769  RFDTEVELAYFDHGGILQYVIRNLIKQ  795



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMR KS G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  751  GEKLSVFDAAMRCKSEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  810

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHE Y+IDLPS +S+IRPGQDVTV TD GK FTCT 
Sbjct  811  NLVGMGIIPLCFKPGEDAETLGLTGHECYSIDLPSNVSEIRPGQDVTVVTDNGKSFTCTL  870

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL Y IR L  
Sbjct  871  RFDTEVELAYFDHGGILQYAIRNLIH  896



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -2

Query  744  EKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSN  565
            EKL VFD AMRYKS G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAV+AKSFERIHRSN
Sbjct  752  EKLSVFDVAMRYKSEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVMAKSFERIHRSN  811

Query  564  LVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTAR  385
            LVGMGIIPLCFK+GEDA+TLGLTGHERY++DLPS +S+IRPGQDVTV TD GK FTCT R
Sbjct  812  LVGMGIIPLCFKSGEDAETLGLTGHERYSLDLPSNVSEIRPGQDVTVVTDNGKQFTCTLR  871

Query  384  FDTEVELAYFNHGGILPYVIRQLTQ  310
            +DTEVELAYF+HGGIL Y IR L  
Sbjct  872  YDTEVELAYFDHGGILQYAIRNLIH  896



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            G+KL V+DAA RYK+ GQDT+ILAG +YGSGSSRDWAAKG MLLGVKAVIAKSFERIHRS
Sbjct  737  GDKLNVYDAATRYKATGQDTIILAGEDYGSGSSRDWAAKGSMLLGVKAVIAKSFERIHRS  796

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD LGLTGHERYTIDLPSKI +IRPGQDVT+ TDTGK FTCTA
Sbjct  797  NLVGMGIIPLCFKPGEDADFLGLTGHERYTIDLPSKIKEIRPGQDVTITTDTGKSFTCTA  856

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
             FDT+VEL YF+HGGILPYVIR L +
Sbjct  857  WFDTKVELEYFDHGGILPYVIRNLNK  882



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   258 bits (659),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  752  GEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT 
Sbjct  812  NLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIR L +Q
Sbjct  872  RFDTEVELAYFNHGGILQYVIRNLIKQ  898



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   258 bits (658),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  752  GEKLSVFDAAMKYRNEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG E YTI+LP+K+S+I+PGQDVTV T+ GK FTCT 
Sbjct  812  NLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L +Q
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIKQ  898



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   258 bits (658),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRY+S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVFDAAMRYRSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGLTG ERYTIDLPS + +I+PGQDVTV TD GK F CT 
Sbjct  812  NLVGMGIIPLCFKTGEDADTLGLTGEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L +
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIK  897



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   258 bits (660),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRS
Sbjct  852  GEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRS  911

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGI+PLCFKAGEDADTLGLTGHERYTI LP+ +++I+PGQDVTV TD GK FTCT 
Sbjct  912  NLAGMGIVPLCFKAGEDADTLGLTGHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTL  971

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVE+AY+ HGGILPYVIR++  +
Sbjct  972  RFDTEVEIAYYTHGGILPYVIRKIAAE  998



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   258 bits (658),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  755  GEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  814

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT 
Sbjct  815  NLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTL  874

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIR L +Q
Sbjct  875  RFDTEVELAYFNHGGILQYVIRNLIKQ  901



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   258 bits (658),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  752  GEKLSVFDAAMKYRNEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG E YTI+LP+K+S+I+PGQDVTV T+ GK FTCT 
Sbjct  812  NLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L +Q
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIKQ  898



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   258 bits (658),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  752  GEKLSVFDAAMKYRNEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG E YTI+LP+K+S+I+PGQDVTV T+ GK FTCT 
Sbjct  812  NLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L +Q
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIKQ  898



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  752  GEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT 
Sbjct  812  NLVGMGIIPLCFKAGEDAETLGLTGQELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L +Q
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIKQ  898



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  773  GEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  832

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT 
Sbjct  833  NLVGMGIIPLCFKAGEDAETLGLTGQELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTL  892

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L +Q
Sbjct  893  RFDTEVELAYFDHGGILQYVIRNLIKQ  919



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+D AMRYKS G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  750  GEKLSVYDVAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  809

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDA+TLGLTGHERYTI+LP+ +S+IRPGQD+TV+TD GK F CT 
Sbjct  810  NLVGMGIIPLCFKSGEDAETLGLTGHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTL  869

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL Y IR L
Sbjct  870  RFDTEVELAYFDHGGILQYAIRNL  893



>gb|ACK56134.1| putative aconitase, partial [Dimocarpus longan]
Length=167

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAMRYKS G +T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  39   GEKLSVFDAAMRYKSEGHNTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  98

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFK GEDA+TL LTGHERYTIDLPS +S+IRPGQDV+V TD GK FTCT 
Sbjct  99   NLVGMGIVPLCFKPGEDAETLSLTGHERYTIDLPSSVSEIRPGQDVSVVTDNGKSFTCTV  158

Query  387  RFDTEVELA  361
            RFDTEVELA
Sbjct  159  RFDTEVELA  167



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  761  GEKLSVFDAATKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  820

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDADTLGLTGHER+T+ LP+ +S+I+PGQDVTV TD GK FTCT 
Sbjct  821  NLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTL  880

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY+++GGILPYVIR++ +Q
Sbjct  881  RFDTEVELAYYDNGGILPYVIRKIAEQ  907



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL V+D AMRYKS G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  752  GEKLSVYDVAMRYKSEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDA+TLGLTGHERYTI+LP+ +S+IRPGQD+TV+TD GK F CT 
Sbjct  812  NLVGMGIIPLCFKSGEDAETLGLTGHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYF+HGGIL Y IR L
Sbjct  872  RFDTEVELAYFDHGGILQYAIRNL  895



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+ G D +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  753  GEKLSVFDAAEKYKNEGHDMIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  812

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDAD+LGLTGHERYTIDLPS +++IRPGQDVTV TDTGK F  T 
Sbjct  813  NLVGMGIIPLCFKSGEDADSLGLTGHERYTIDLPSDVNEIRPGQDVTVVTDTGKTFVSTL  872

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL Y IR L
Sbjct  873  RFDTEVELAYFNHGGILQYAIRNL  896



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  840  GEKLSVFDAATKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  899

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDADTLGLTGHER+T+ LP+ +S+I+PGQDVTV TD GK FTCT 
Sbjct  900  NLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTL  959

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY+++GGILPYVIR++ +Q
Sbjct  960  RFDTEVELAYYDNGGILPYVIRKIAEQ  986



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  752  GEKLSVFDAAMKYKNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TL LTG E YTI+LPS +S+I+PGQDVTV T+ GK FTCT 
Sbjct  812  NLVGMGIIPLCFKTGEDAETLRLTGEELYTIELPSNVSEIKPGQDVTVITNNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIR L +Q
Sbjct  872  RFDTEVELAYFNHGGILQYVIRNLIKQ  898



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  840  GEKLSVFDAATKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  899

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NL GMGIIPLCFK+GEDADTLGLTGHER+T+ LP+ +S+I+PGQDVTV TD GK FTCT 
Sbjct  900  NLAGMGIIPLCFKSGEDADTLGLTGHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTL  959

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAY+++GGILPYVIR++ +Q
Sbjct  960  RFDTEVELAYYDNGGILPYVIRKIAEQ  986



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score =   261 bits (667),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747   GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             GEKL VFDAAM+YK+ G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRS
Sbjct  1820  GEKLAVFDAAMKYKNEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRS  1879

Query  567   NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
             NL GMGI+PLCFKAGEDADTLGLTGHERYTI LP+ +++I+PGQDVTV TD GK FTCT 
Sbjct  1880  NLAGMGIVPLCFKAGEDADTLGLTGHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTL  1939

Query  387   RFDTEVELAYFNHGGILPYVIRQLTQQ  307
             RFDTEVELAY+ HGGILPYVIR++  +
Sbjct  1940  RFDTEVELAYYTHGGILPYVIRKIAAE  1966



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   256 bits (654),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA++Y++ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  752  GEKLSVFDAALKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT 
Sbjct  812  NLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNNVSEIKPGQDVTVITNNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIR L +Q
Sbjct  872  RFDTEVELAYFNHGGILQYVIRNLIKQ  898



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   256 bits (654),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  752  GEKLSVFDAAMKYRNEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT 
Sbjct  812  NLVGMGIIPLCFKTGEDAETLGLTGQELYTIELPNNVSEIKPGQDVTVITNNGKSFTCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVEL YFNHGGIL YVIR L +Q
Sbjct  872  RFDTEVELEYFNHGGILQYVIRNLIKQ  898



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+YK+ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  776  GEKLSVFDAAMKYKNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  835

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TL LTG E YTI+LPS +S+I+PGQDVTV T+ GK FTCT 
Sbjct  836  NLVGMGIIPLCFKTGEDAETLRLTGEELYTIELPSNVSEIKPGQDVTVITNNGKSFTCTL  895

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIR L +Q
Sbjct  896  RFDTEVELAYFNHGGILQYVIRNLIKQ  922



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   255 bits (652),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YKS G D +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  753  GEKLSVFDAAEKYKSEGHDMIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  812

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK G+DAD+LGLTGHERYTIDLPS +++IRPGQDVTV TD GK F  T 
Sbjct  813  NLVGMGIIPLCFKPGDDADSLGLTGHERYTIDLPSNVNEIRPGQDVTVVTDAGKSFVSTL  872

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYFNHGGIL YVIR +  
Sbjct  873  RFDTEVELAYFNHGGILQYVIRNMVN  898



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   255 bits (652),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  779  GEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  838

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT 
Sbjct  839  NLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTL  898

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYF+HGGIL YVIR L +Q
Sbjct  899  RFDTEVELAYFDHGGILQYVIRNLIKQ  925



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   255 bits (651),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFD A +YKS G D +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  753  GEKLSVFDVAEKYKSEGHDMIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  812

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTG ERYTIDLPS +++IRPGQDVTV TDTGK F  T 
Sbjct  813  NLVGMGIIPLCFKPGEDADSLGLTGQERYTIDLPSNVNEIRPGQDVTVVTDTGKSFVSTL  872

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL YVIR L
Sbjct  873  RFDTEVELAYFNHGGILQYVIRNL  896



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            G+K+ VFDAAM+YKS G DT+ILAGAEYGSGSSRDWAAKGP LLGVKAVIAKSFERIHRS
Sbjct  752  GDKVSVFDAAMKYKSEGHDTIILAGAEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDA+TLGLTG ERYTIDLPS +S+I+PGQD+TV T  GK F CT 
Sbjct  812  NLVGMGIIPLCFKAGEDAETLGLTGEERYTIDLPSTVSEIKPGQDITVVTSNGKSFVCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L +
Sbjct  872  RFDTEVELAYFDHGGILQYVIRNLIK  897



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   255 bits (651),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 134/164 (82%), Gaps = 17/164 (10%)
 Frame = -2

Query  747  GEKLYVFDAAM-----------------RYKSAGQDTVILAGAEYGSGSSRDWAAKGPML  619
            GEKL VFD AM                 RYKS G DT+ILAGAEYGSGSSRDWAAKGPML
Sbjct  812  GEKLSVFDTAMVDCISIDCLKLYVWLLQRYKSEGHDTIILAGAEYGSGSSRDWAAKGPML  871

Query  618  LGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPG  439
            LGVKAVIAKSFERIHRSNLVGMG+IPLCFK GEDA+TLGLTGHERYTIDLPS +S+I+PG
Sbjct  872  LGVKAVIAKSFERIHRSNLVGMGVIPLCFKPGEDAETLGLTGHERYTIDLPSSVSEIKPG  931

Query  438  QDVTVQTDTGKCFTCTARFDTEVELAYFNHGGILPYVIRQLTQQ  307
            QDVT+ TD GK FTCT RFDTEVELAYF+HGGILPYVIR L + 
Sbjct  932  QDVTMVTDDGKSFTCTLRFDTEVELAYFDHGGILPYVIRNLIKS  975



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAAM+Y++ G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRS
Sbjct  759  GEKLSVFDAAMKYRNEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRS  818

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FT T 
Sbjct  819  NLVGMGIIPLCFKTGEDAETLGLTGEELYTIELPNNVSEIKPGQDVTVITNNGKSFTSTL  878

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            RFDTEVELAYFNHGGIL YVIR L +Q
Sbjct  879  RFDTEVELAYFNHGGILQYVIRNLIKQ  905



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score =   253 bits (646),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFD A +YKS G D +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAK FERIHRS
Sbjct  760  GEKLSVFDVAEKYKSEGHDMIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKGFERIHRS  819

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDAD+LGLTG ERYTIDLPS +++IRPGQDVTV TDTGK F  T 
Sbjct  820  NLVGMGIIPLCFKPGEDADSLGLTGQERYTIDLPSNVNEIRPGQDVTVVTDTGKSFVSTL  879

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL YVIR L
Sbjct  880  RFDTEVELAYFNHGGILQYVIRNL  903



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   253 bits (645),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GE L VFD AM+Y S GQDTVILAGAEYGSGSSRDWAAKGP LLGVKAVIAKSFERIHRS
Sbjct  752  GETLSVFDVAMKYNSDGQDTVILAGAEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRS  811

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFKAGEDA+TLGLTGHE+Y I+LPS + +I+PGQDVTV T+ GK F+CT 
Sbjct  812  NLVGMGIVPLCFKAGEDAETLGLTGHEQYNIELPSNVGEIKPGQDVTVVTNNGKSFSCTL  871

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL YVIR L
Sbjct  872  RFDTEVELAYFNHGGILQYVIRNL  895



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   253 bits (645),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YKS G D +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  753  GEKLSVFDAAEKYKSEGHDMIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  812

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK G+DAD+LGLTG ERYTIDLPS +++IRPGQDVTV TD GK F  T 
Sbjct  813  NLVGMGIIPLCFKPGDDADSLGLTGQERYTIDLPSNVNEIRPGQDVTVVTDAGKSFVSTL  872

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYFNHGGIL YVIR +  
Sbjct  873  RFDTEVELAYFNHGGILQYVIRNMVN  898



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score =   250 bits (638),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +YK+ G D +ILAGAEYGSGSSRDWAAKGP LLGVKAVI+KSFERIHRS
Sbjct  753  GEKLSVFDAATKYKTEGHDMIILAGAEYGSGSSRDWAAKGPKLLGVKAVISKSFERIHRS  812

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGLTGHER+TIDLPS +++IRPGQD+ V TD GK F CT 
Sbjct  813  NLVGMGIIPLCFKDGEDAETLGLTGHERFTIDLPSNVNEIRPGQDIAVVTDNGKTFLCTL  872

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL Y IR L
Sbjct  873  RFDTEVELAYFNHGGILQYAIRNL  896



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            G+KL+V+DAAMRYK+AGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  823  GDKLHVYDAAMRYKTAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  882

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDADTLGL+GHERY+IDLPSKIS+IRPGQDVTV TDTGK FTCT 
Sbjct  883  NLVGMGIIPLCFKPGEDADTLGLSGHERYSIDLPSKISEIRPGQDVTVTTDTGKSFTCTV  942

Query  387  RFDTEVELA  361
            RFDTEVELA
Sbjct  943  RFDTEVELA  951



>gb|ACR36825.1| unknown [Zea mays]
Length=565

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYV+DAAM+YKS G D VI+AG+EYGSGSSRD AAKGPMLLGVK+VIAKSFERIHRS
Sbjct  417  GEKLYVYDAAMKYKSEGHDMVIIAGSEYGSGSSRDSAAKGPMLLGVKSVIAKSFERIHRS  476

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCF+AGEDAD+LGLTG ERYTI LP+  ++I PGQDVTV T  G+ FTCT 
Sbjct  477  NLVGMGIIPLCFQAGEDADSLGLTGRERYTIHLPTSTAEISPGQDVTVTTHDGRSFTCTL  536

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            R DT++E+ YFNHGGILPY++R L  Q
Sbjct  537  RLDTQLEVTYFNHGGILPYMVRNLAAQ  563



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +Y+  G DT+ILAGAEYGSGSSRDWAAKGP L GVKAVIAKSFERIHRS
Sbjct  760  GEKLSVFDAAKKYQDEGHDTIILAGAEYGSGSSRDWAAKGPYLQGVKAVIAKSFERIHRS  819

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDA++LGLTG+ER+TID+PS I DI+PGQDV V+TD GK FTCT 
Sbjct  820  NLVGMGIIPLCFKSGEDAESLGLTGYERFTIDIPSDIKDIKPGQDVVVKTDKGKSFTCTL  879

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDT+VEL YF +GGIL YVIRQL Q
Sbjct  880  RFDTQVELTYFENGGILHYVIRQLLQ  905



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEK++VFDAAMRYK+ GQDT++LAG+EYG GSSRD AAKGPML+GV+AVIAKSFE+IHRS
Sbjct  753  GEKMHVFDAAMRYKNEGQDTIVLAGSEYGVGSSRDGAAKGPMLVGVQAVIAKSFEQIHRS  812

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGL GHERYTIDLP+K+S+++P QDV V TD GK F CT 
Sbjct  813  NLVGMGIIPLCFKPGEDAETLGLNGHERYTIDLPNKVSELKPRQDVKVVTDNGKSFACTL  872

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L +
Sbjct  873  RFDTEVELAYFDHGGILQYVIRTLVE  898



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             EKL+VFDAAMRYK+ G  T++LAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  831  NEKLFVFDAAMRYKADGHHTIVLAGEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  890

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMG++PLCFK GEDAD+LGLTGHERYTI LP+ +S+I+PGQDV V +DTGK FTC  
Sbjct  891  NLVGMGVLPLCFKPGEDADSLGLTGHERYTIRLPTNVSEIQPGQDVQVLSDTGKSFTCKL  950

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            R DT VELAYF+HGGIL YV+R L +Q
Sbjct  951  RIDTMVELAYFDHGGILHYVLRNLVRQ  977



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
             EKL+VFDAAMRYK+ G  T++LAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS
Sbjct  833  NEKLFVFDAAMRYKADGHHTIVLAGEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  892

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMG++PLCFK GEDAD+LGLTGHERYTI LP+ +S+I+PGQDV V +DTGK FTC  
Sbjct  893  NLVGMGVLPLCFKPGEDADSLGLTGHERYTIRLPTNVSEIQPGQDVQVLSDTGKSFTCKL  952

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            R DT VELAYF+HGGIL YV+R L +Q
Sbjct  953  RIDTMVELAYFDHGGILHYVLRNLVRQ  979



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            G+KL VFDAA +YKS GQDT+ILAG+EYGSGSSRDWAAKGP LLGVKAVIAKSFERIHRS
Sbjct  754  GQKLSVFDAATKYKSEGQDTIILAGSEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRS  813

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGI+PLCFK GEDA+TLGLTG E+Y ++LP++I++I+PGQDV V TD GK F CT 
Sbjct  814  NLVGMGIVPLCFKVGEDAETLGLTGFEQYNVELPNEINEIKPGQDVKVITDDGKSFVCTL  873

Query  387  RFDTEVELAYFNHGGILPYVIRQL  316
            RFDTEVELAYFNHGGIL YVIR L
Sbjct  874  RFDTEVELAYFNHGGILQYVIRNL  897



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEK++VFDAAMRYK+ GQDT++LAG+EYG GSSRD AAKGPML+GV+AVIAKSFE+IHRS
Sbjct  780  GEKMHVFDAAMRYKNEGQDTIVLAGSEYGVGSSRDGAAKGPMLVGVQAVIAKSFEQIHRS  839

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK GEDA+TLGL GHERYTIDLP+K+S+++P QDV V TD GK F CT 
Sbjct  840  NLVGMGIIPLCFKPGEDAETLGLNGHERYTIDLPNKVSELKPRQDVKVVTDNGKSFACTL  899

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDTEVELAYF+HGGIL YVIR L +
Sbjct  900  RFDTEVELAYFDHGGILQYVIRTLVE  925



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  744  EKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSN  565
            +KL+VFDAAMRYK+ G  T++LAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSN
Sbjct  830  DKLFVFDAAMRYKADGHHTIVLAGEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSN  889

Query  564  LVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTAR  385
            LVGMG++PLCFK GEDAD+LGLTGHERYTI LP+ +S+I+PGQDV V TDTGK FTC  R
Sbjct  890  LVGMGVLPLCFKPGEDADSLGLTGHERYTIRLPTNVSEIQPGQDVQVVTDTGKSFTCKLR  949

Query  384  FDTEVELAYFNHGGILPYVIRQLTQQ  307
             DT VELAYF+HGGIL YV+R L +Q
Sbjct  950  IDTLVELAYFDHGGILHYVLRNLVKQ  975



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKL VFDAA +Y+  G DT+ILAGAEYGSGSSRDWAAKGP L GVKAVIAKSFERIHRS
Sbjct  760  GEKLSVFDAAKKYQDEGHDTIILAGAEYGSGSSRDWAAKGPYLQGVKAVIAKSFERIHRS  819

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFK+GEDA++LGLTG+ER+TID+PS I DI+PGQDV V+TD GK FTCT 
Sbjct  820  NLVGMGIIPLCFKSGEDAESLGLTGYERFTIDIPSDIKDIKPGQDVLVKTDKGKSFTCTL  879

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQ  310
            RFDT+VEL YF +GGIL YVIRQL Q
Sbjct  880  RFDTQVELTYFENGGILHYVIRQLLQ  905



>gb|ACU19654.1| unknown [Glycine max]
Length=130

 Score =   226 bits (576),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  687  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADT  508
            +I+AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK GEDAD+
Sbjct  2    IIMAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADS  61

Query  507  LGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGILPYV  328
            LGLTG ERYTIDLPS +++IR GQDVTV TDTGK F  T RFDTEVELAYFNHGGIL YV
Sbjct  62   LGLTGQERYTIDLPSNVNEIRSGQDVTVVTDTGKSFVSTLRFDTEVELAYFNHGGILQYV  121

Query  327  IRQLTQ  310
            IR L  
Sbjct  122  IRNLIN  127



>ref|NP_001147431.1| aconitase2 [Zea mays]
 gb|ACG27495.1| aconitate hydratase, cytoplasmic [Zea mays]
 gb|ACN28210.1| unknown [Zea mays]
 gb|AFW57775.1| aconitate hydratase, cytoplasmic [Zea mays]
Length=905

 Score =   242 bits (618),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  747  GEKLYVFDAAMRYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRS  568
            GEKLYV+DAAM+YKS G D VI+AG+EYGSGSSRD AAKGPMLLGVK+VIAKSFERIHRS
Sbjct  757  GEKLYVYDAAMKYKSEGHDMVIIAGSEYGSGSSRDSAAKGPMLLGVKSVIAKSFERIHRS  816

Query  567  NLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTA  388
            NLVGMGIIPLCFKAGEDAD+LGLTG ERYTI LP+  +++ PGQDVTV T  G+ FTCT 
Sbjct  817  NLVGMGIIPLCFKAGEDADSLGLTGRERYTIHLPTSTAELSPGQDVTVTTHDGRSFTCTL  876

Query  387  RFDTEVELAYFNHGGILPYVIRQLTQQ  307
            R DT++E+ YFNHGGILPY++R L  Q
Sbjct  877  RLDTQLEVTYFNHGGILPYMVRNLAAQ  903



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630