BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF018E03

Length=785
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFU48609.1|  catalase 1                                              404   6e-136   Nicotiana benthamiana
emb|CCP37650.1|  catalase-1                                             404   6e-136   Nicotiana tabacum [American tobacco]
gb|ACL27272.1|  catalase                                                404   7e-136   Nicotiana benthamiana
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      404   8e-136   Nicotiana tomentosiformis
gb|AAB62892.1|  catalase-1                                              404   9e-136   Nicotiana glutinosa
gb|AAB71764.1|  catalase 1                                              404   1e-135   Nicotiana tabacum [American tobacco]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      402   7e-135   Nicotiana sylvestris
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               401   1e-134   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAR14052.2|  catalase                                                400   2e-134   Solanum tuberosum [potatoes]
gb|AAM97541.1|  catalase 2                                              399   7e-134   Capsicum annuum
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      399   1e-133   Solanum tuberosum [potatoes]
gb|KJB14249.1|  hypothetical protein B456_002G115900                    388   1e-131   Gossypium raimondii
emb|CDP01803.1|  unnamed protein product                                393   1e-131   Coffea canephora [robusta coffee]
ref|NP_001234186.1|  catalase isozyme 2                                 392   5e-131   
emb|CAI43948.1|  catalase                                               391   8e-131   Populus deltoides
gb|AJE26131.1|  catalase                                                391   1e-130   Salix matsudana [tortured willow]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 391   1e-130   Populus euphratica
ref|XP_002301920.1|  catalase family protein                            391   1e-130   Populus trichocarpa [western balsam poplar]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    389   6e-130   Gossypium raimondii
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      389   6e-130   Vitis vinifera
gb|KHG12976.1|  Catalase isozyme 2                                      388   2e-129   Gossypium arboreum [tree cotton]
ref|XP_007046520.1|  Catalase 2                                         388   2e-129   Theobroma cacao [chocolate]
gb|ACJ11733.1|  catalase                                                388   2e-129   Gossypium hirsutum [American cotton]
emb|CDY40645.1|  BnaA03g53180D                                          387   2e-129   Brassica napus [oilseed rape]
ref|XP_009138342.1|  PREDICTED: catalase-2                              387   3e-129   Brassica rapa
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         387   3e-129   Camelina sativa [gold-of-pleasure]
gb|ACV92695.1|  catalase                                                387   4e-129   Brassica oleracea
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               387   5e-129   Gossypium hirsutum [American cotton]
ref|XP_007018034.1|  Catalase 2                                         387   6e-129   
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      387   6e-129   Nicotiana tomentosiformis
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               387   6e-129   Gossypium hirsutum [American cotton]
gb|KHG25152.1|  Catalase isozyme 1                                      387   6e-129   Gossypium arboreum [tree cotton]
gb|AAF71742.1|AF248491_1  catalase                                      387   6e-129   Raphanus sativus
ref|XP_009106100.1|  PREDICTED: catalase-2                              387   6e-129   Brassica rapa
gb|AAB86582.2|  catalase                                                386   7e-129   Raphanus sativus
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         386   7e-129   Camelina sativa [gold-of-pleasure]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    386   8e-129   Gossypium raimondii
ref|XP_010437527.1|  PREDICTED: catalase-2                              386   8e-129   Camelina sativa [gold-of-pleasure]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      386   9e-129   Citrus sinensis [apfelsine]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             386   9e-129   Citrus clementina [clementine]
gb|AFU90823.1|  catalase                                                384   1e-128   Populus x beijingensis
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      386   1e-128   Nelumbo nucifera [Indian lotus]
ref|XP_010094556.1|  Catalase isozyme 1                                 386   1e-128   Morus notabilis
emb|CDX72514.1|  BnaC07g45360D                                          385   1e-128   
emb|CDP01802.1|  unnamed protein product                                385   1e-128   Coffea canephora [robusta coffee]
gb|AFU90822.1|  catalase                                                385   2e-128   Populus tomentosa [Chinese white poplar]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      386   2e-128   
emb|CDP07287.1|  unnamed protein product                                385   2e-128   Coffea canephora [robusta coffee]
ref|XP_011022275.1|  PREDICTED: catalase-like                           384   3e-128   Populus euphratica
dbj|BAJ33995.1|  unnamed protein product                                385   3e-128   Eutrema halophilum
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      385   3e-128   Populus euphratica
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      385   3e-128   
gb|AIA61608.1|  catalase                                                385   3e-128   Gynostemma pentaphyllum [jiaogulan]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             385   3e-128   Eutrema salsugineum [saltwater cress]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             385   3e-128   
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             385   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      384   4e-128   Nicotiana sylvestris
gb|KJB17473.1|  hypothetical protein B456_003G002800                    384   5e-128   Gossypium raimondii
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              384   6e-128   Populus euphratica
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      384   8e-128   Prunus mume [ume]
ref|XP_010530333.1|  PREDICTED: catalase-2                              384   1e-127   Tarenaya hassleriana [spider flower]
gb|AAD17936.1|  catalase                                                384   1e-127   Brassica juncea [brown mustard]
emb|CDX76313.1|  BnaA08g10870D                                          383   1e-127   
ref|NP_001289779.1|  catalase isozyme 1                                 383   1e-127   Nelumbo nucifera [Indian lotus]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             383   1e-127   
gb|ADU56199.1|  catalase                                                383   1e-127   Hevea brasiliensis [jebe]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              384   1e-127   Populus euphratica
gb|AAB88173.1|  catalase                                                376   2e-127   Glycine max [soybeans]
gb|AET97564.1|  catalase                                                383   2e-127   Ziziphus jujuba [Chinese jujube]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             382   3e-127   Capsella rubella
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 382   3e-127   Elaeis guineensis
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             382   3e-127   Prunus persica
emb|CAD42908.1|  catalase                                               382   3e-127   Prunus persica
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       382   4e-127   Cucumis sativus [cucumbers]
dbj|BAQ21275.1|  catalase                                               381   4e-127   Citrus tamurana
gb|AIS20825.1|  CAT                                                     382   4e-127   Pyrus x bretschneideri [bai li]
gb|AAD17935.1|  catalase                                                382   4e-127   Brassica juncea [brown mustard]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         382   6e-127   Tarenaya hassleriana [spider flower]
emb|CAA64220.1|  catalase                                               382   6e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      381   7e-127   Cucumis melo [Oriental melon]
emb|CDY17510.1|  BnaC03g65530D                                          381   7e-127   Brassica napus [oilseed rape]
emb|CAA45564.1|  catalase                                               381   7e-127   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96854.1|  catalase                                                381   8e-127   Arabidopsis thaliana [mouse-ear cress]
prf||1906388A  catalase                                                 381   9e-127
ref|NP_195235.1|  catalase 2                                            381   9e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      381   1e-126   Phoenix dactylifera
gb|AHF27428.1|  catalase                                                375   2e-126   Cucurbita moschata [ayote]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          380   2e-126   Soldanella alpina
prf||2104177A  catalase                                                 379   4e-126
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          379   5e-126   Helianthus annuus
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      379   6e-126   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX69111.1|  BnaC01g03420D                                          379   6e-126   
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 379   7e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      379   8e-126   
gb|AAR84578.1|  catalase 1a                                             379   8e-126   Lotus japonicus
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         379   9e-126   Jatropha curcas
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      378   1e-125   
ref|XP_002521709.1|  catalase, putative                                 378   2e-125   Ricinus communis
emb|CAC04509.1|  catalase                                               370   2e-125   Digitalis lanata [Grecian foxglove]
gb|KFK30147.1|  catalase                                                377   2e-125   Arabis alpina [alpine rockcress]
ref|XP_002306976.2|  catalase family protein                            377   3e-125   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 377   3e-125   Nicotiana tomentosiformis
gb|AAO17721.1|  catalase                                                377   4e-125   Hypericum perforatum
ref|NP_001240021.1|  catalase                                           377   5e-125   Glycine max [soybeans]
gb|AAK67359.2|AF390210_1  catalase                                      376   7e-125   Suaeda salsa
gb|AAD17933.1|  catalase                                                376   9e-125   Brassica juncea [brown mustard]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         376   1e-124   Tarenaya hassleriana [spider flower]
gb|AAC19397.1|  leaf catalase                                           376   1e-124   Mesembryanthemum crystallinum
gb|AFN81243.1|  catalase 1                                              376   1e-124   Brassica rapa subsp. pekinensis [bai cai]
ref|NP_001237571.1|  catalase-4                                         376   1e-124   Glycine max [soybeans]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               375   2e-124   Cucurbita pepo
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              375   2e-124   
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 375   2e-124   Nicotiana sylvestris
gb|AIP93616.1|  CAT1                                                    375   2e-124   Bassia scoparia [burning bush]
emb|CAB56850.1|  catalase                                               372   2e-124   Prunus persica
ref|XP_010692546.1|  PREDICTED: catalase                                375   3e-124   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                375   3e-124   Erythranthe guttata [common monkey flower]
gb|AGV54297.1|  peroxisomal catalase                                    374   4e-124   Phaseolus vulgaris [French bean]
gb|ADC95629.1|  catalase                                                374   5e-124   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      374   6e-124   Elaeis guineensis
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             374   7e-124   Phaseolus vulgaris [French bean]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      374   8e-124   Elaeis guineensis
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    373   1e-123   
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               373   2e-123   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_001291326.1|  catalase isozyme 1                                 372   2e-123   Sesamum indicum [beniseed]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 372   3e-123   Prunus mume [ume]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          372   4e-123   Amborella trichopoda
ref|XP_003558892.1|  PREDICTED: catalase-1                              372   4e-123   Brachypodium distachyon [annual false brome]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 371   6e-123   Vitis vinifera
ref|NP_001268098.1|  catalase                                           371   6e-123   Vitis vinifera
gb|ACA50528.1|  putative catalase 2                                     371   7e-123   Brassica napus [oilseed rape]
ref|NP_001237556.1|  catalase-1/2                                       371   7e-123   Glycine max [soybeans]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       368   1e-122   Cucumis sativus [cucumbers]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             370   1e-122   Prunus persica
dbj|BAA34205.1|  catalase                                               370   1e-122   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048861.1|  Os03g0131200                                       370   1e-122   
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           370   2e-122   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             371   2e-122   Eutrema salsugineum [saltwater cress]
gb|AAM97542.1|  catalase 3                                              370   2e-122   Capsicum annuum
emb|CAD42909.1|  catalase                                               370   2e-122   Prunus persica
ref|NP_564121.1|  catalase 1                                            370   2e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              370   2e-122   
gb|AHB72694.1|  catalase                                                370   2e-122   Beta vulgaris subsp. maritima [sea beet]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      370   3e-122   Solanum lycopersicum
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              369   3e-122   Cicer arietinum [garbanzo]
ref|NP_001235974.1|  catalase-3                                         369   3e-122   Glycine max [soybeans]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           369   4e-122   Sesamum indicum [beniseed]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 369   5e-122   Cucumis melo [Oriental melon]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         369   5e-122   Oryza brachyantha
gb|AHA50082.1|  catalase                                                368   1e-121   Eleutherococcus senticosus
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 367   2e-121   Solanum tuberosum [potatoes]
gb|AGE15298.2|  catalase 1                                              367   2e-121   Eriobotrya japonica [loquat]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       367   3e-121   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010061175.1|  PREDICTED: catalase-like                           366   5e-121   Eucalyptus grandis [rose gum]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      366   5e-121   Fragaria vesca subsp. vesca
dbj|BAJ90861.1|  predicted protein                                      366   5e-121   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAC17731.1|  catalase 1                                              366   5e-121   Arabidopsis thaliana [mouse-ear cress]
gb|EMT05040.1|  Catalase-1                                              367   7e-121   
gb|ABK24453.1|  unknown                                                 366   7e-121   Picea sitchensis
gb|ACB11496.1|  catalase                                                366   9e-121   Pinus sylvestris [Scotch pine]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             365   1e-120   Phaseolus vulgaris [French bean]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          365   2e-120   Vigna radiata var. radiata [golden gram]
gb|AAF19965.1|AF207906_1  catalase 1                                    365   2e-120   Zantedeschia aethiopica [arum-lily]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 365   2e-120   Phoenix dactylifera
gb|ADZ45555.1|  catalase                                                365   2e-120   Vigna radiata [mung bean]
gb|ABQ44283.1|  catalase                                                359   3e-120   Saccharum hybrid cultivar NCo 376
gb|AIZ77475.1|  catalase                                                364   3e-120   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ88747.1|  predicted protein                                      366   3e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIX10947.1|  putative catalase                                       364   3e-120   Gardenia jasminoides
gb|ABM47415.1|  catalase                                                363   6e-120   Prunus avium [gean]
gb|AGC65520.1|  catalase                                                363   7e-120   Eriobotrya japonica [loquat]
gb|AAY59707.1|  catalase                                                363   7e-120   Oryza sativa Indica Group [Indian rice]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 363   8e-120   Oryza brachyantha
gb|ADZ45556.1|  catalase                                                363   8e-120   Vigna radiata [mung bean]
gb|ACL35349.1|  catalase                                                363   9e-120   Picea glauca
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    363   9e-120   Oryza sativa Indica Group [Indian rice]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     366   1e-119   Eucalyptus grandis [rose gum]
gb|KEH36312.1|  catalase heme-binding enzyme                            363   1e-119   Medicago truncatula
gb|ACN36234.1|  unknown                                                 357   1e-119   Zea mays [maize]
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 376   1e-119   
emb|CDP07288.1|  unnamed protein product                                362   2e-119   Coffea canephora [robusta coffee]
gb|EPS69543.1|  catalase                                                362   2e-119   Genlisea aurea
dbj|BAA34204.1|  catalase                                               362   2e-119   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA05494.1|  catalase                                               362   2e-119   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       362   3e-119   
dbj|BAJ87148.1|  predicted protein                                      355   5e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF61732.1|AF243517_1  catalase 2                                    360   9e-119   Helianthus annuus
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         360   1e-118   Setaria italica
gb|AFW69584.1|  catalase1                                               355   1e-118   
emb|CAG23920.1|  catalase                                               360   2e-118   Festuca arundinacea [tall fescue]
gb|ACH63223.1|  catalase                                                359   3e-118   Rheum australe [Himalayan rhubarb]
gb|AIU99480.1|  catalase                                                358   5e-118   Saccharum spontaneum [fodder cane]
gb|AIU99481.1|  catalase                                                358   5e-118   Saccharum spontaneum [fodder cane]
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             358   5e-118   Eutrema salsugineum [saltwater cress]
gb|AIU99479.1|  catalase                                                358   6e-118   Saccharum arundinaceum
gb|KHG21219.1|  Catalase isozyme 1                                      356   7e-118   Gossypium arboreum [tree cotton]
gb|AIM43584.1|  catalase                                                358   8e-118   Saccharum hybrid cultivar Yacheng05-179
ref|XP_010105996.1|  Catalase isozyme 1                                 353   8e-118   
gb|AAC17729.1|  catalase 1                                              355   9e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU99485.1|  catalase                                                358   9e-118   Saccharum spontaneum [fodder cane]
gb|AIU99484.1|  catalase                                                358   1e-117   Saccharum arundinaceum
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               357   1e-117   Ricinus communis
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    357   2e-117   Arabis alpina [alpine rockcress]
gb|ABY21704.1|  catalase-1 precursor                                    357   2e-117   Panax ginseng [Asiatic ginseng]
ref|NP_001241808.1|  catalase isozyme B                                 357   2e-117   Zea mays [maize]
tpg|DAA43177.1|  TPA: catalase2                                         357   2e-117   
emb|CAA42720.1|  catalase-1                                             357   2e-117   Zea mays [maize]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 357   3e-117   Eucalyptus grandis [rose gum]
ref|XP_009103333.1|  PREDICTED: catalase-1                              357   3e-117   Brassica rapa
emb|CDY31877.1|  BnaC07g15270D                                          357   3e-117   Brassica napus [oilseed rape]
gb|AAB07026.1|  catalase 1                                              357   3e-117   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01363.1|  BnaA07g11360D                                          357   4e-117   
gb|AAG43363.1|AF151368_1  catalase                                      356   5e-117   Hevea brasiliensis [jebe]
gb|AAD37788.1|AF149283_1  catalase 1                                    354   5e-117   Phaseolus vulgaris [French bean]
gb|AIU99488.1|  catalase                                                356   5e-117   Saccharum hybrid cultivar ROC22
gb|AIU99482.1|  catalase                                                356   6e-117   Saccharum hybrid cultivar ROC22
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          356   6e-117   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               356   7e-117   Zea mays [maize]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               355   8e-117   Hordeum vulgare [barley]
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 357   9e-117   
gb|AAF79625.1|AC027665_26  F5M15.5                                      369   1e-116   Arabidopsis thaliana [mouse-ear cress]
prf||1803522A  catalase                                                 355   1e-116
gb|AIU99486.1|  catalase                                                355   1e-116   Saccharum spontaneum [fodder cane]
gb|ABR15776.1|  catalase                                                348   1e-116   Litchi
ref|NP_001105310.1|  catalase isozyme 2                                 355   2e-116   
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          355   2e-116   Amborella trichopoda
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         354   3e-116   Camelina sativa [gold-of-pleasure]
gb|ADN94253.1|  catalase                                                354   4e-116   Puccinellia chinampoensis
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                353   5e-116   Erythranthe guttata [common monkey flower]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      353   5e-116   Brachypodium distachyon [annual false brome]
tpg|DAA43178.1|  TPA: catalase2                                         355   5e-116   
gb|AIU99487.1|  catalase                                                353   6e-116   Saccharum hybrid cultivar ROC22
ref|XP_010477308.1|  PREDICTED: catalase-1                              353   8e-116   Camelina sativa [gold-of-pleasure]
ref|XP_002890395.1|  F5M15.5                                            367   8e-116   
gb|AIU99483.1|  catalase                                                353   9e-116   Saccharum hybrid cultivar ROC22
ref|NP_001105415.1|  catalase isozyme 1                                 353   1e-115   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         353   1e-115   Camelina sativa [gold-of-pleasure]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                352   2e-115   Citrus sinensis [apfelsine]
gb|ABY19573.1|  catalase                                                343   2e-115   Manihot esculenta [manioc]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             352   3e-115   Citrus clementina [clementine]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     352   3e-115   Sesamum indicum [beniseed]
gb|ACJ22771.1|  catalase 1                                              352   3e-115   Jatropha curcas
gb|AAX84671.1|  catalase CAT2                                           343   4e-115   Manihot esculenta [manioc]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      351   5e-115   Eucalyptus grandis [rose gum]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             352   6e-115   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         351   7e-115   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              350   1e-114   
emb|CDY31490.1|  BnaC05g15990D                                          349   3e-114   Brassica napus [oilseed rape]
emb|CDY29518.1|  BnaA06g14520D                                          349   3e-114   Brassica napus [oilseed rape]
ref|NP_001031791.1|  catalase 2                                         348   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149540.1|  PREDICTED: catalase-1                              349   4e-114   Brassica rapa
dbj|BAH19523.1|  AT4G35090                                              348   4e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AAA57551.1|  catalase                                                345   6e-114   Nicotiana sylvestris
gb|ACJ76836.3|  catalase                                                348   7e-114   Dimocarpus longan [longan]
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             348   9e-114   
gb|AEQ30070.1|  catalase                                                347   1e-113   Litchi chinensis [litchi]
dbj|BAH37035.1|  catalase 1                                             347   3e-113   Pisum sativum [garden pea]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 346   4e-113   Tarenaya hassleriana [spider flower]
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    346   4e-113   Nicotiana tabacum [American tobacco]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      346   4e-113   Nicotiana sylvestris
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      346   4e-113   Nicotiana tomentosiformis
gb|AAD50974.1|AF170272_1  catalase CAT1                                 345   7e-113   Manihot esculenta [manioc]
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             345   7e-113   Selaginella moellendorffii
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         345   1e-112   Tarenaya hassleriana [spider flower]
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               345   2e-112   Zea mays [maize]
gb|AFD29285.1|  catalase                                                345   2e-112   Vicia faba [broad bean]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          344   2e-112   Avicennia marina
dbj|BAF91369.1|  catalase                                               344   2e-112   Capsicum annuum
dbj|BAC79443.1|  catalase                                               344   3e-112   Acacia ampliceps
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               344   3e-112   Ricinus communis
ref|XP_002510677.1|  catalase, putative                                 357   4e-112   
ref|NP_001031072.3|  catalase 3                                         339   5e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52649.1|  BnaAnng11640D                                          342   5e-112   Brassica napus [oilseed rape]
ref|XP_010498496.1|  PREDICTED: catalase-3                              343   1e-111   Camelina sativa [gold-of-pleasure]
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    342   1e-111   Capsicum annuum
ref|XP_009110221.1|  PREDICTED: catalase-3                              342   1e-111   Brassica rapa
dbj|BAH20307.1|  AT1G20620                                              341   2e-111   Arabidopsis thaliana [mouse-ear cress]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               342   2e-111   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDY31488.1|  BnaC05g15970D                                          342   2e-111   Brassica napus [oilseed rape]
emb|CDY29519.1|  BnaA06g14510D                                          342   2e-111   
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         342   2e-111   
ref|XP_009149539.1|  PREDICTED: catalase-3                              343   3e-111   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          341   3e-111   
emb|CDY33636.1|  BnaC08g19360D                                          341   4e-111   
gb|AAC48918.1|  salicylic acid binding catalase                         341   4e-111   
ref|NP_564120.1|  catalase 3                                            341   5e-111   
emb|CDY01364.1|  BnaA07g11370D                                          343   6e-111   
gb|AAF61734.1|AF243519_1  catalase 4                                    340   6e-111   
gb|AAM65021.1|  unknown                                                 340   6e-111   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            340   7e-111   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    340   9e-111   
emb|CDY31878.1|  BnaC07g15280D                                          340   1e-110   
emb|CAE82295.1|  catalase                                               340   1e-110   
gb|AHF21552.1|  catalase                                                339   2e-110   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             339   2e-110   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             338   4e-110   
gb|AAD30292.1|AF139539_1  catalase 3                                    338   5e-110   
gb|AGI65617.1|  catalase                                                337   7e-110   
gb|AAD30291.2|AF139538_1  catalase 2                                    337   9e-110   
gb|AAF61733.1|AF243518_1  catalase 3                                    336   3e-109   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          336   5e-109
gb|AFR53082.1|  CAT                                                     335   7e-109   
gb|AHF27430.1|  catalase                                                335   8e-109   
gb|AHF27433.1|  catalase                                                335   9e-109   
gb|AAC49807.1|  catalase 3                                              335   9e-109   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      335   1e-108   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      335   1e-108   
gb|ABV55108.1|  catalase 2                                              334   2e-108   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      334   3e-108   
gb|ADU56198.1|  catalase                                                333   4e-108   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      333   5e-108   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               333   8e-108   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      332   9e-108   
ref|NP_001234827.1|  catalase isozyme 1                                 332   9e-108   
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          332   1e-107   
gb|ADB03784.1|  catalase                                                332   1e-107   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 332   1e-107   
emb|CAA85470.1|  catalase                                               332   2e-107   
gb|AAL00886.1|  catalase                                                325   2e-107   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               332   2e-107   
gb|AAR97905.1|  catalase                                                332   2e-107   
gb|AII23739.1|  catalase                                                331   2e-107   
gb|ADM96039.1|  catalase                                                332   2e-107   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 332   2e-107   
gb|ACJ73906.1|  CAT2                                                    325   3e-107   
gb|ADK25939.1|  catalase                                                322   3e-107   
gb|ABC01913.1|  catalase isozyme 1-like protein                         331   4e-107   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      330   9e-107   
ref|NP_001274863.1|  catalase isozyme 1                                 330   1e-106   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               329   2e-106   
gb|AAG61140.2|AF332973_1  catalase 2                                    329   2e-106   
gb|AHF27429.1|  catalase                                                327   6e-106   
gb|AHF27432.1|  catalase                                                327   6e-106   
ref|XP_001752315.1|  predicted protein                                  327   7e-106   
gb|ACJ73905.1|  CAT1                                                    315   1e-105   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               327   2e-105   
ref|XP_010692544.1|  PREDICTED: catalase-like                           325   1e-104   
gb|EMS61345.1|  Catalase isozyme 1                                      327   3e-104   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     323   3e-104   
gb|AJF34884.1|  catalase                                                323   5e-104   
ref|XP_001784759.1|  predicted protein                                  322   8e-104   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      322   9e-104   
ref|NP_001031073.1|  catalase 3                                         321   2e-103   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   322   1e-102   
gb|ABB72796.1|  catalase isozyme 1-like protein                         318   3e-102   
gb|ADQ28492.1|  catalase                                                317   1e-101   
gb|AAC17730.1|  catalase 2                                              313   1e-101   
gb|ACL81498.1|  catalase                                                316   3e-101   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          315   3e-101   
gb|AAZ29552.1|  catalase-C                                              315   6e-101   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 314   7e-101   
gb|ADY02963.1|  catalase                                                315   8e-101   
gb|AGT16203.1|  catalase                                                314   1e-100   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               314   1e-100   
gb|KIY96954.1|  catalase                                                308   2e-100   
gb|EMS51034.1|  Catalase isozyme 2                                      313   6e-100   
emb|CAH61266.1|  catalase                                               312   9e-100   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      312   1e-99    
ref|XP_005645077.1|  catalase                                           311   1e-99    
ref|NP_001045673.1|  Os02g0115700                                       311   2e-99    
gb|ABK41476.1|  catalase                                                311   2e-99    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          311   2e-99    
gb|AAC19398.1|  root catalase                                           311   2e-99    
dbj|BAJ92414.1|  predicted protein                                      311   3e-99    
gb|ABN71233.2|  catalase                                                310   3e-99    
gb|AAX88799.1|  catalase                                                308   2e-98    
gb|EMT06167.1|  Catalase isozyme 2                                      313   3e-98    
gb|AGT16054.1|  catalase                                                308   3e-98    
gb|AGT16188.1|  catalase                                                308   3e-98    
gb|ABK24449.1|  unknown                                                 308   3e-98    
gb|AGT16310.1|  catalase                                                308   3e-98    
gb|AGT15888.1|  catalase                                                308   3e-98    
dbj|BAH56915.1|  AT1G20620                                              308   4e-98    
gb|AHZ13843.1|  catalase                                                306   1e-97    
ref|XP_002950455.1|  catalase                                           306   1e-97    
ref|XP_001696763.1|  catalase/peroxidase                                306   3e-97    
gb|EMS35721.1|  Catalase isozyme 1                                      298   3e-97    
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    305   6e-97    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      303   2e-96    
gb|ABR16304.1|  unknown                                                 303   2e-96    
gb|ABK24543.1|  unknown                                                 302   4e-96    
gb|AAB70006.1|  catalase                                                302   6e-96    
emb|CAA43814.1|  catalase                                               301   8e-96    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           301   2e-95 
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              299   5e-95    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          300   6e-95    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               299   1e-94    
gb|AFW66787.1|  catalase3                                               298   1e-94    
emb|CAA73663.1|  catalase                                               298   2e-94    
dbj|BAA34714.1|  catalase                                               298   2e-94    
ref|XP_001779509.1|  predicted protein                                  297   4e-94    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    294   1e-93    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             294   3e-93    
gb|KJB17474.1|  hypothetical protein B456_003G002800                    294   3e-93    
gb|AAR84577.1|  catalase 1b                                             291   2e-92    
gb|AFW66785.1|  catalase3 isoform 1                                     298   2e-92    
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              292   6e-92    
gb|AEY70510.1|  catalase                                                285   6e-92    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      287   3e-90    
gb|AFY26882.1|  catalase                                                274   3e-89    
ref|XP_011396830.1|  Catalase isozyme 2                                 283   1e-88    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            281   8e-88 
gb|AFW66789.1|  catalase3                                               272   8e-87    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        276   5e-86    
ref|NP_001105416.1|  catalase isozyme 3                                 276   9e-86    
gb|ABB88582.1|  catalase                                                274   3e-85    
ref|XP_005708279.1|  catalase                                           272   2e-84    
gb|AFW66788.1|  catalase3                                               272   3e-84    
gb|ACV30589.1|  catalase                                                258   3e-83    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      259   2e-79    
gb|KDD77132.1|  catalase                                                258   5e-79    
gb|AFH53187.1|  catalase                                                249   1e-78    
gb|AFH53190.1|  catalase                                                249   2e-78    
gb|AFH53189.1|  catalase                                                249   2e-78    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      252   2e-77    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             251   7e-77    
gb|ACU23083.1|  unknown                                                 238   2e-74    
gb|AFR42410.1|  catalase                                                234   5e-74    
ref|XP_005536240.1|  catalase                                           245   6e-74    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 244   7e-74    
dbj|BAH20283.1|  AT1G20620                                              233   9e-74    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 243   1e-73    
gb|KEH36313.1|  catalase heme-binding enzyme                            238   5e-72    
gb|AFR42412.1|  catalase                                                228   7e-72    
gb|AAP57673.1|  catalase                                                229   1e-70    
gb|AGS17821.1|  catalase 2                                              232   2e-70    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             231   4e-69    
gb|AID50071.1|  catalase                                                221   4e-69    
dbj|BAD07937.1|  catalase catA-like protein                             217   2e-67    
gb|AFA36510.1|  catalase                                                218   3e-66    
gb|ABB51561.1|  truncated catalase 2                                    223   3e-66    
emb|CAA10286.1|  catalase                                               213   5e-66    
gb|AAO16182.1|  catalase-1                                              211   3e-65    
ref|NP_973873.1|  catalase 3                                            220   6e-65    
gb|ABS89000.1|  catalase                                                209   6e-64    
gb|ABY68160.1|  catalase                                                206   3e-63    
gb|ABY68162.1|  catalase                                                205   6e-63    
gb|ABY68159.1|  catalase                                                204   1e-62    
gb|ABY68158.1|  catalase                                                204   1e-62    
gb|AFI48101.1|  catalase isozyme B                                      204   1e-62    
gb|AEA86295.1|  putative catalase                                       205   2e-62    
gb|AFI48054.1|  catalase isozyme B                                      202   4e-62    
gb|ABY68161.1|  catalase                                                202   6e-62    
gb|AFI48111.1|  catalase isozyme B                                      202   7e-62    
emb|CBI29556.3|  unnamed protein product                                201   1e-61    
gb|AFI48130.1|  catalase isozyme B                                      201   3e-61    
gb|AFI48131.1|  catalase isozyme B                                      200   3e-61    
gb|AFI48068.1|  catalase isozyme B                                      200   4e-61    
gb|ABY68164.1|  catalase                                                200   4e-61    
gb|AFI48098.1|  catalase isozyme B                                      199   7e-61    
gb|ACJ71245.1|  catalase 2                                              207   2e-60    
dbj|BAD94702.1|  catalase                                               197   4e-60    
gb|ACJ71244.1|  catalase 2                                              206   6e-60    
gb|AAZ03546.1|  Catalase                                                198   1e-59    
gb|AFK46618.1|  unknown                                                 194   6e-59    
ref|XP_005712277.1|  unnamed protein product                            206   6e-59    
gb|ADR01107.1|  catalase 3                                              202   1e-58    
gb|AAY22485.1|  catalase                                                192   5e-57    
emb|CDP22058.1|  unnamed protein product                                190   8e-57    
gb|AAT68776.1|  catalase                                                193   1e-56    
gb|AFV96158.1|  catalase                                                187   5e-55    
gb|ABY68163.1|  catalase                                                184   1e-54    
gb|ACY30463.1|  catalase                                                189   6e-54    
gb|ABN79860.2|  catalase                                                185   2e-53    
emb|CAC16850.1|  catalase                                               180   5e-53    
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     187   7e-53    
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     185   1e-52    
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             187   1e-52    
emb|CAC17121.1|  catalase                                               179   2e-52    
ref|XP_005642928.1|  catalase                                           188   4e-52    
gb|AAR25790.1|  catalase                                                174   2e-51    
gb|KJE89728.1|  catalase isozyme 2                                      185   1e-50    
ref|XP_005644653.1|  catalase-domain-containing protein                 185   1e-50    
ref|XP_004366029.2|  catalase isozyme 2                                 185   1e-50    
gb|AAG23803.1|  catalase                                                171   5e-49    
ref|XP_005647994.1|  catalase-domain-containing protein                 177   3e-48    
gb|AII80275.1|  catalase                                                170   4e-47    
ref|WP_035160169.1|  catalase                                           175   4e-47    
ref|WP_032122311.1|  catalase                                           173   8e-47    
gb|AFC35182.1|  catalase dismutase                                      167   4e-46    
gb|KGS11078.1|  catalase                                                166   5e-46    
gb|AAU43642.1|  catalase                                                162   1e-45    
gb|EGH29791.1|  catalase                                                164   1e-45    
ref|WP_032632526.1|  catalase                                           170   2e-45    
ref|WP_032664185.1|  catalase                                           170   2e-45    
ref|WP_043304355.1|  catalase                                           170   2e-45    
gb|KIQ35234.1|  catalase                                                169   2e-45    
ref|WP_029198005.1|  catalase                                           169   3e-45    
ref|WP_004887231.1|  catalase                                           169   4e-45    
ref|WP_031421259.1|  catalase                                           169   4e-45    
ref|WP_032632922.1|  catalase                                           168   8e-45    
ref|WP_038401366.1|  catalase                                           168   9e-45    
ref|WP_043193175.1|  catalase                                           168   1e-44    
ref|WP_015881004.1|  catalase                                           168   1e-44    
gb|AIM05078.1|  catalase                                                164   1e-44    
ref|WP_001069151.1|  catalase                                           167   1e-44    
gb|AHG41775.1|  catalase                                                167   2e-44    
ref|WP_043337329.1|  catalase                                           167   2e-44    
ref|WP_044323073.1|  catalase                                           167   2e-44    
ref|WP_031412803.1|  catalase                                           167   2e-44    



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   404 bits (1039),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  286  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  345

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+Y
Sbjct  346  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKY  405

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSI
Sbjct  406  PIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSI  465

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  466  WISYWSQADKSLGQKLASRLNVRPSI  491



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   404 bits (1039),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+Y
Sbjct  347  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSI
Sbjct  407  PIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   404 bits (1039),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+Y
Sbjct  347  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSI
Sbjct  407  PIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   404 bits (1038),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+Y
Sbjct  347  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNF QPGERYRSF+PDRQERFI RWV+ALSDPRITYEIRSI
Sbjct  407  PIPSTMCTGKREKCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   404 bits (1038),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+Y
Sbjct  347  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQPGERYRSF+PDRQERFI RWV+ALSDPRIT+EIRSI
Sbjct  407  PIPSTMCTGKREKCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   404 bits (1037),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+Y
Sbjct  347  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIR+I
Sbjct  407  PIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   402 bits (1032),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+Y
Sbjct  347  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQ G+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSI
Sbjct  407  PIPSTMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   401 bits (1031),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNF NENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  280  LDVTKTWPEDILPLQPVGRLVLNKNIDNFSNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  339

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+Y
Sbjct  340  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKY  399

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPRITYEIRSI
Sbjct  400  PIPSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSI  459

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  460  WISYWSQADKSLGQKLASRLNVRPSI  485



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   400 bits (1028),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  270  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  329

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE Y
Sbjct  330  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVY  389

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ VC+GKREKC+I KENNFKQPGERYR+F+PDRQERFI RWV+ALSDPRITYEIRSI
Sbjct  390  PIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSI  449

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  450  WISYWSQADKSLGQKLASRLNVRPSI  475



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   399 bits (1025),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQP+GRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  279  LDVTKTWPEDIFPLQPLGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  338

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE Y
Sbjct  339  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENY  398

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  VC+GKREKC+I KENNF+QPGERYRSFS DRQERFI RWV+ALSDPRITYEIRSI
Sbjct  399  PIPTTVCSGKREKCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEIRSI  458

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  459  WISYWSQADKSLGQKLASRLNVRPSI  484



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   399 bits (1024),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE Y
Sbjct  347  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ VC+GKREKC+I KENNFKQPGERYR+F+PDRQERFI RWV+ALSDPRITYEIRSI
Sbjct  407  PIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI+YWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WITYWSQADKSLGQKLASRLNVRPSI  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   388 bits (997),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  139  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  198

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +
Sbjct  199  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMF  258

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWVDALSDPR+T+EIRSI
Sbjct  259  PIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSI  318

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKS+GQK+ASRLN+RP++
Sbjct  319  WISYWSQADKSVGQKLASRLNVRPSI  344



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   393 bits (1010),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLN+NIDNFFNENEQLAFCP+IVVPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE+DYFPSRYDPVRHAE +
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+AV TG+REK +I KENNFKQPGERYRSF+PDRQERFICRWVDALSDPR+TYEIRSI
Sbjct  407  PIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNIRPSI  492



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   392 bits (1007),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNF   NEQLAFCPSIVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFLYMNEQLAFCPSIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE Y
Sbjct  347  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ VC+GKREKC+I KENNFKQPGERYRSF+PDRQERFI RWV+ALSDPRITYEIRSI
Sbjct  407  PIPSTVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI+YWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WITYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   391 bits (1005),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSI
Sbjct  407  PIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR T+EIRSI
Sbjct  407  PIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKREKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALSDPR+T+EIRSI
Sbjct  407  PIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSI
Sbjct  407  PIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   389 bits (1000),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWVDALSDPR+T+EIRSI
Sbjct  407  PIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKS+GQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSVGQKLASRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   389 bits (1000),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERY
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+ TG+REKC+I KENNFKQPGERYRSF+PDRQERFI RWVDALSDPR+TYEIRSI
Sbjct  407  PIPPAILTGRREKCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSDPR+T+EIRSI
Sbjct  407  PIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQKIASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCPSI+VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPSIIVPGLYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAE+Y
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+C+GKREKC+I KENNF+QPGERYRSF+PDRQERFI RWVDALSDPR+TYEIRSI
Sbjct  407  PIPTAICSGKREKCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWS+ADKSLGQK+ASRL++RP++
Sbjct  467  WISYWSKADKSLGQKLASRLSVRPSI  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWV+ALSDPR+T+EIRSI
Sbjct  407  PIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  280  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  339

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  340  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  399

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  400  PTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSI  459

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RPN+
Sbjct  460  WISYWSQADKSLGQKLASRLNVRPNI  485



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RPN+
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPNI  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+G RE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSI
Sbjct  407  PAPPAVCSGTRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   387 bits (993),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQP+GR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPMGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSDPR+T+EIRSI
Sbjct  407  PIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQKIASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAER+
Sbjct  347  SYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSI
Sbjct  407  PIPPAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI+YWSQA KSLGQK+ASRLN++PN+
Sbjct  467  WITYWSQACKSLGQKLASRLNVKPNI  492



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+Y
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TGKR+KC++ KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSI
Sbjct  407  PIPLRVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQKIASRLN+RP M
Sbjct  467  WISYWSQADKSLGQKIASRLNIRPTM  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWVDALSDPR+T+EIRSI
Sbjct  407  PIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKS+GQK+AS LN+RP++
Sbjct  467  WISYWSQADKSVGQKLASLLNVRPSI  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWV+A SDPR+T+EIRSI
Sbjct  407  PIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   387 bits (993),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPE+L+PLQPVGR+VLNKNIDNF  ENEQLAFCP+I+VPGIYYSDDKLLQTR+F
Sbjct  287  LDVTKTWPEELLPLQPVGRMVLNKNIDNFLAENEQLAFCPAIIVPGIYYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP N+PKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RPN+
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPNI  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   386 bits (992),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  286  LDVTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  345

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  346  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  405

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  406  PTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSI  465

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  466  WISYWSQADKSLGQKLASRLNVRPSI  491



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   386 bits (992),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYD VRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSI
Sbjct  407  PAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   386 bits (992),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDP RHAER+
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+CTGKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDA+SDPR+T+EIRSI
Sbjct  407  PIPPALCTGKREKCIIEKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI+YWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WITYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   386 bits (992),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYD VRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSI
Sbjct  407  PAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   386 bits (992),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP  +C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR I
Sbjct  407  PTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQA KSLGQK+ASRLN+RPN+
Sbjct  467  WISYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   386 bits (992),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP  +C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR I
Sbjct  407  PTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQA KSLGQK+ASRLN+RPN+
Sbjct  467  WISYWSQACKSLGQKLASRLNVRPNI  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   384 bits (987),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  245  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  304

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +
Sbjct  305  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESF  364

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKRE+C+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSI
Sbjct  365  PIPPAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSI  424

Query  245  WISYWSQADKSLGQKIASRLNM  180
            WISYWSQADKSLGQK+ASRLN+
Sbjct  425  WISYWSQADKSLGQKLASRLNV  446



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP +VVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPGVVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKC+ HNNH+DG MNF+HRDEE++YFPSRYDPVRHAER+
Sbjct  347  SYSDTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  +CTGKREKCVI KENNFKQPGERYRSF PDRQERFI RW DALSDPR+T+EIRSI
Sbjct  407  PIPPRICTGKREKCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+A+RLN++P+M
Sbjct  467  WISYWSQADKSLGQKLATRLNVKPSM  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHR+EE++YFPSRYDPVRHAERY
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+A+CTG+RE+ VI KENNFKQPGERYRSFSPDRQERFI RWV+ALSDPR+T+EIRSI
Sbjct  407  PIPSAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  275  LDVTKTWPEDLLPLQPVGRMVLNKNIDNFFTENEQLAFCPAIIVPGIHYSDDKLLQTRVF  334

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MN MHRDEE++YFPSRYDPVRHAE+Y
Sbjct  335  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKY  394

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  395  PTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSI  454

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  455  WISYWSQADKSLGQKLASRLNVRPSI  480



>emb|CDP01802.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   385 bits (988),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 199/213 (93%), Gaps = 7/213 (3%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLN+NIDNFFNENEQLAFCP+IVVPGI+YSDDKLLQTRIF
Sbjct  257  LDVTKTWPEDILPLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIF  316

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEE-------IDYFPSRYDP  447
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE       +DYFPSRYDP
Sbjct  317  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEHCTFCPCVDYFPSRYDP  376

Query  446  VRHAERYPTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRI  267
            VRHAE +P P+AV TG+REK +I KENNFKQPGERYRSF+PDRQERFICRWVDALSDPR+
Sbjct  377  VRHAEMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRV  436

Query  266  TYEIRSIWISYWSQADKSLGQKIASRLNMRPNM  168
            TYEIRSIWISYWSQADKSLGQK+ASRLN+RP++
Sbjct  437  TYEIRSIWISYWSQADKSLGQKLASRLNIRPSI  469



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 175/202 (87%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  286  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  345

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +
Sbjct  346  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESF  405

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSI
Sbjct  406  PIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSI  465

Query  245  WISYWSQADKSLGQKIASRLNM  180
            WISYWSQADKSLGQK+ASRLN+
Sbjct  466  WISYWSQADKSLGQKLASRLNV  487



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIF
Sbjct  307  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIF  366

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +
Sbjct  367  SYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMH  426

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP  +C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR I
Sbjct  427  PTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHI  486

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQA KSLGQK+ASRLN+RPN+
Sbjct  487  WISYWSQACKSLGQKLASRLNVRPNI  512



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDV+KTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVSKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +GKR+KCVI KENNFKQPGERYRS++PDRQERFICRWVDALSD R+T+EIRSI
Sbjct  407  PIPPPVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQKIA+RLN+RP M
Sbjct  467  WISYWSQADKSLGQKIATRLNVRPTM  492



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   384 bits (987),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  271  LDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  330

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERY
Sbjct  331  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERY  390

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSI
Sbjct  391  PNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSI  450

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+AS LNMRP +
Sbjct  451  WISYWSQADKSLGQKLASHLNMRPGI  476



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   385 bits (989),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAER+
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+AVC+G+REKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALS+PR+T+E+RSI
Sbjct  407  PIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+AS LN+RP++
Sbjct  467  WISYWSQADKSLGQKLASHLNVRPSI  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+TYEIRSI
Sbjct  407  PIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+S GQK+ASRLN+RP++
Sbjct  467  WISYWSQADRSFGQKLASRLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAERY
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVCTGKRE+CVI KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T+EIRSI
Sbjct  407  PHPPAVCTGKRERCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+S+GQK+AS LNMRP++
Sbjct  467  WISYWSQADRSVGQKLASHLNMRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  285  LDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  344

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERY
Sbjct  345  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERY  404

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSI
Sbjct  405  PNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSI  464

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+AS LNMRP++
Sbjct  465  WISYWSQADKSLGQKLASHLNMRPSI  490



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   385 bits (988),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERY
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSI
Sbjct  407  PNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+AS LNMRP++
Sbjct  467  WISYWSQADKSLGQKLASHLNMRPSI  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   384 bits (987),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE++
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TGKR+KC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSI
Sbjct  407  PIPPRVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADK+LGQKIASRLN+RP M
Sbjct  467  WISYWSQADKTLGQKIASRLNVRPTM  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSD R+T+EIRSI
Sbjct  407  PIPSTVYSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQKIASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   384 bits (986),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERY
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSI
Sbjct  407  PNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+AS LNMRP +
Sbjct  467  WISYWSQADKSLGQKLASHLNMRPGI  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   384 bits (986),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVR+AER+
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  + +GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSI
Sbjct  407  PIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            +DVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  VDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERY
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  +C+G+RE+C+I KENNFKQPGERYRSF+PDRQERFI RW++ALSDPRIT+EIRSI
Sbjct  407  PIPPVICSGRRERCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADQSLGQKLASRLNVRPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP A+C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAICSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+A+RLN+RP++
Sbjct  467  WISYWSQADKSLGQKLANRLNVRPSI  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   383 bits (983),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  272  LDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  331

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  332  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  391

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSI
Sbjct  392  PTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSI  451

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADK+LGQK+ASRLN+RP++
Sbjct  452  WISYWSQADKTLGQKLASRLNVRPSI  477



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDV+KTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVSKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKC+ HNNH++G MNF+HR+EE++YFPSRYDPVRHAERY
Sbjct  347  SYSDTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  +CTGKREKCVI KENNFKQPGERYRS++PDRQERFI RW+DALSDPR+T+EIRSI
Sbjct  407  PIPPQICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN++P+M
Sbjct  467  WISYWSQADKSLGQKLASRLNVKPSM  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCPSIVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQRYRLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYSDTQRYRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+A+ +G  EKCVI KENNFKQPGERYRSFS DR+ERFI RWV+A+SDPR+TYEIRSI
Sbjct  407  PIPSAILSGNCEKCVIPKENNFKQPGERYRSFSSDRKERFIRRWVEAMSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW QADKSLGQKIAS LNMRP M
Sbjct  467  WISYWYQADKSLGQKIASHLNMRPTM  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  306  LDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  365

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERY
Sbjct  366  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERY  425

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSI
Sbjct  426  PNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSI  485

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+AS LNMRP +
Sbjct  486  WISYWSQADKSLGQKLASHLNMRPGI  511



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIF
Sbjct  103  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIF  162

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAE +
Sbjct  163  SYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETF  222

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+
Sbjct  223  PIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSV  282

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIASRL+MRPN+
Sbjct  283  WISYWSQADRSLGQKIASRLSMRPNI  308



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+A+  GKREKC+I KENNFKQPGERYRS++PDRQERFI RW+DALSDPR+T+EIRSI
Sbjct  407  PIPSAIFNGKREKCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFI RW++ALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+
Sbjct  347  SYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  + TG+REKCVI KENNFKQPGERYRS++PDRQERFICRWV+ALSDPR+TYEIR+I
Sbjct  407  PIPFRILTGRREKCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D+SLGQKIA+RLN++P+M
Sbjct  467  WISYWSQCDRSLGQKIATRLNVKPSM  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAER+
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  + +GKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+
Sbjct  407  PIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSV  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   382 bits (981),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAER+
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  + +GKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+
Sbjct  407  PIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSV  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   382 bits (981),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERY
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVCTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSI
Sbjct  407  PHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI+YWSQAD+S+GQK+AS LN+RP++
Sbjct  467  WITYWSQADRSVGQKLASHLNVRPSI  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIF
Sbjct  271  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIF  330

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +
Sbjct  331  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMH  390

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP  +C G+REKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALSDPR+T+EIR I
Sbjct  391  PTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHI  450

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQA KSLGQK+ +RLN+RP++
Sbjct  451  WISYWSQACKSLGQKLTARLNVRPSI  476



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   382 bits (981),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+TYEIRSI
Sbjct  407  PIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+S GQK+ASRLN+RP++
Sbjct  467  WISYWSQADRSFGQKLASRLNVRPSI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   382 bits (981),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADK+LGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKTLGQKLASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   382 bits (980),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            +DVTKTWPED+VPLQPVGRLVLNKNID+FF ENEQLAFCP I+VPGI+YSDDKLLQTR+F
Sbjct  287  VDVTKTWPEDIVPLQPVGRLVLNKNIDSFFAENEQLAFCPGIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERY
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ VC+G+RE+C+I KENNFKQPGERYRSF+PDR+ERFI RW++ALSDPRIT+EIRSI
Sbjct  407  PVPSVVCSGRRERCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQK+ASR+N+RPN+
Sbjct  467  WISYWSQADQSLGQKLASRMNVRPNI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   382 bits (980),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+CVI KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   381 bits (979),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERY
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVCTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSI
Sbjct  407  PHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+S+GQK+AS LN+RP++
Sbjct  467  WISYWSQADRSVGQKLASHLNVRPSI  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   381 bits (978),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  272  LDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  331

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  332  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  391

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSI
Sbjct  392  PTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSI  451

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADK+LGQK+AS LN+RP++
Sbjct  452  WISYWSQADKTLGQKLASHLNVRPSI  477



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   381 bits (979),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   381 bits (979),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>prf||1906388A catalase
Length=492

 Score =   381 bits (978),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   381 bits (978),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR++LNKNIDNFF+ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMILNKNIDNFFSENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE +
Sbjct  347  SYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V TG+REKCVI KENNFKQPGERYRS++PDRQ RFICRWV+ALSDPR+TYEIRSI
Sbjct  407  PIPSCVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D+SLGQKIA+RLN++P+M
Sbjct  467  WISYWSQCDRSLGQKIATRLNVKPSM  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   375 bits (963),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIF
Sbjct  139  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIF  198

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERY
Sbjct  199  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERY  258

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKRE+C+I KENNFK+PGERYRS++PDRQERF+ RWVDALSD R+T+EIRSI
Sbjct  259  PHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSI  318

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQK+AS LN+RP++
Sbjct  319  WISYWSQADRSLGQKLASHLNVRPSI  344



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   380 bits (977),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+++VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLMPVGRLVLNKNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+
Sbjct  347  SYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TGKR++C+I KENNFKQPGERYR+F+PDRQERF+CRWVDALSDPR+T+EIRSI
Sbjct  407  PIPPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+QADKSLGQK+ASRLN+RP M
Sbjct  467  WISYWTQADKSLGQKLASRLNVRPTM  492



>prf||2104177A catalase
Length=492

 Score =   379 bits (974),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDP RHAE+Y
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P    +GKR+KCVI KENNFKQPGERYRSFSPDRQERFI R V  LSDPR+T+E+RSI
Sbjct  407  PIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPN  171
            W+SYWSQADKSLGQKIASRLN++PN
Sbjct  467  WVSYWSQADKSLGQKIASRLNVKPN  491



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   379 bits (974),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDP RHAE+Y
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P    +GKR+KCVI KENNFKQPGERYRSFSPDRQERFI R V  LSDPR+T+E+RSI
Sbjct  407  PIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPN  171
            W+SYWSQADKSLGQKIASRLN++PN
Sbjct  467  WVSYWSQADKSLGQKIASRLNVKPN  491



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   379 bits (973),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCP++VVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPVGRMVLNKNIDNFFGENEQLAFCPALVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+
Sbjct  347  SYSDTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TGKREKC+I KENNFKQPGERYRSFSPDRQERFI RWV+ALSDP++T+EIRSI
Sbjct  407  PIPTRVLTGKREKCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ DKSL QK+A+RL+++P+M
Sbjct  467  WISYWSQCDKSLSQKLATRLSVKPSM  492



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   379 bits (972),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  275  LDVTKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  334

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSRY+PVRHAE+Y
Sbjct  335  SYADTQRHRLGPNYLQLPVNAPKCGHHNNHHEGFMNFMHRDEEVNYFPSRYNPVRHAEKY  394

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC GKRE+CVI KENNFK+PGERYR F P+RQERFI RW++ALSDPRIT+EIRSI
Sbjct  395  PTPPAVCAGKRERCVIEKENNFKEPGERYRYFPPERQERFIRRWIEALSDPRITHEIRSI  454

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+AS LN+RPN+
Sbjct  455  WISYWSQADKSLGQKLASHLNVRPNI  480



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   379 bits (973),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGR+VLNKNIDNFFNENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPVGRMVLNKNIDNFFNENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+
Sbjct  347  SYSDTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P++V TG+REK +I KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+T+EIR I
Sbjct  407  PIPSSVVTGRREKSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ DKSLGQKIA+RLN++P M
Sbjct  467  WISYWSQCDKSLGQKIATRLNVKPTM  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   379 bits (972),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+T+EIRSI
Sbjct  407  PIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+S GQK+ASRLN+RP++
Sbjct  467  WISYWSQADRSFGQKLASRLNVRPSI  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   379 bits (972),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGI YSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGISYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERY
Sbjct  347  SYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+CTG RE+C I KENNFKQPGERYRSF+PDRQ+RF+ RWVDALSDPR+T+EIRS 
Sbjct  407  PIPPAICTGSRERCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRST  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS LN+RP++
Sbjct  467  WISYWSQADRSLGQKIASHLNLRPSI  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   379 bits (972),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLN+NIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYSDTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG+REK VI KENNFKQPGERYRSF+PDR++RFI RWV+ALSDPR+TYEIRSI
Sbjct  407  PIPPPVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQKIAS LNMRP M
Sbjct  467  WISYWSQADKSLGQKIASHLNMRPTM  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+T+EIRSI
Sbjct  407  PIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+S GQK+ASRLN+RP++
Sbjct  467  WISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCPSIVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MN MHRDEE++YFPSRYDP RHAE++
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNIMHRDEEVNYFPSRYDPARHAEQH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  + +GKREKC+I KENNFKQPGERYRSF+PDR+ERFI RWV+AL+D RITYEIRSI
Sbjct  407  PIPPRILSGKREKCIILKENNFKQPGERYRSFTPDRKERFIRRWVEALTDTRITYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+AS LNMRP M
Sbjct  467  WISYWSQADKSLGQKLASHLNMRPTM  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   370 bits (949),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  60   LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  119

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAER+
Sbjct  120  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERF  179

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P     GKR++  I KENNFKQPGE+YRSF PDRQERFI RWVDALSDPR+T+EIRSI
Sbjct  180  PHPPVALNGKRDRICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSI  239

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYW+QADKSLGQK+ASRLN+RP M
Sbjct  240  WVSYWTQADKSLGQKLASRLNIRPTM  265



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   377 bits (969),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFI RW++ALSDPRIT+EIRSI
Sbjct  407  PAPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   377 bits (968),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAER+
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+AVC+G+REKC+I KENNFKQPGERYRS++PDRQERF+ RWVDALS+PR+T+E+RSI
Sbjct  407  PIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+AS LN+RP++
Sbjct  467  WISYWSQADKSLGQKLASHLNVRPSV  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   377 bits (968),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+Y
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  + TGKR++C+I KENNFKQPGERYRS+SPDRQERFICRW++ALSDPR+T+EI +I
Sbjct  407  PIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLG+KIASRLN+RP M
Sbjct  467  WISYWSQADKSLGEKIASRLNVRPTM  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   377 bits (967),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V  G+REKC+I KENNFKQPGERYRSFSPDRQERF+ RW+ +LSDPR+T+EIR+I
Sbjct  407  PIPPVVLNGRREKCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W++YW QADKSLGQK+ASRLN+RPNM
Sbjct  467  WVTYWYQADKSLGQKLASRLNVRPNM  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   377 bits (967),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAE +
Sbjct  347  SYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+
Sbjct  407  PIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSV  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIASRL+MRPN+
Sbjct  467  WISYWSQADRSLGQKIASRLSMRPNI  492



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   376 bits (966),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCPSIVVPG++YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAERY
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V  G REK  I KENNFKQPGERYRS  P RQERFICR VDALSDPR+T+EIRSI
Sbjct  407  PIPSNVLNGCREKQCIPKENNFKQPGERYRSMDPARQERFICRVVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLG K+ASRLN+RP M
Sbjct  467  WISYWSQADKSLGMKVASRLNVRPTM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   376 bits (966),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 199/210 (95%), Gaps = 4/210 (2%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPD----RQERFICRWVDALSDPRITYE  258
            PTP AVC+GKRE+CVI KENNFK+PGERYRSF+P+    RQERFI RW++ALSDPRIT+E
Sbjct  407  PTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHE  466

Query  257  IRSIWISYWSQADKSLGQKIASRLNMRPNM  168
            IRSIWISYWSQADK+LGQK+ASRLN+RP++
Sbjct  467  IRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQ+AFCP++VVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQVAFCPALVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC  HNNH+DG MNFMHRDEE++YFPSR+DPVRHAER+
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P+P A+C+G+REKC+I KENNFKQPGERYRS++PDRQERF+ RWV+ALSD R T+EIRSI
Sbjct  407  PSPPAICSGRREKCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP+ 
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSF  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRD+E+DYFPSRYDPVRHAERY
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V  G R++ +I KENNFKQPGERYRS+ P RQERFICRWVDALSDPRIT+EIR+I
Sbjct  407  PIPPNVLNGNRDRQIIQKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKS+G K+ASRLN+RP M
Sbjct  467  WISYWSQADKSVGMKLASRLNVRPTM  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++AL DPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI YWSQADK+ GQK+ASRLN+RP++
Sbjct  467  WIFYWSQADKTFGQKLASRLNVRPSI  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAER+
Sbjct  347  SYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+
Sbjct  407  PIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSV  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS L+ RPN+
Sbjct  467  WISYWSQADRSLGQKIASHLSTRPNI  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   375 bits (964),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERY
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVC+GKRE+C+I KENNFK+PGERYRS++PDRQERF+ RWVDALSD R+T+EIRSI
Sbjct  407  PHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQK+AS LN+RP++
Sbjct  467  WISYWSQADRSLGQKLASHLNVRPSI  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 198/210 (94%), Gaps = 4/210 (2%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPD----RQERFICRWVDALSDPRITYE  258
            PTP AVC+GKRE+CVI KENNFK+PG RYRSF+PD    RQERFI RW++ALSDPRIT+E
Sbjct  407  PTPPAVCSGKRERCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHE  466

Query  257  IRSIWISYWSQADKSLGQKIASRLNMRPNM  168
            IRSIWISYWSQADK+LGQK+ASRLN+RP++
Sbjct  467  IRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFM+RDEE++YFPSR+DP RHAE+Y
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  + TGKR++C+I KENNFKQPGERYRS+SPDRQERFICRW++ALSDPR+T+EIR I
Sbjct  407  PIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRII  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLG+KIASRLN+RP M
Sbjct  467  WISYWSQADKSLGEKIASRLNVRPTM  492



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHR EE+DYFPSRYDPVRHAE++
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRGEEVDYFPSRYDPVRHAEKF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +CTG+RE+ +I KENNFKQPGERYRS  P RQERFICR VDALSDPRIT+EIRSI
Sbjct  407  PIPSNICTGRRERQIIPKENNFKQPGERYRSMDPARQERFICRVVDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+QADKSLG K+ASRLN++  M
Sbjct  467  WISYWTQADKSLGMKVASRLNVKATM  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   372 bits (956),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD+TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF
Sbjct  218  LDLTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIF  277

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERY
Sbjct  278  AYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERY  337

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+
Sbjct  338  PIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSV  397

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  398  WISYWSQADKSLGQKLASRLNVRPSI  423



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   375 bits (962),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL PVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+ YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLLPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVSYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V  GKRE+ +I KENNFKQPGERYRS  P RQERFICR VDALSDPRIT+EIRSI
Sbjct  407  PIPSNVINGKRERQIIAKENNFKQPGERYRSMDPARQERFICRVVDALSDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQADKSLG K+ASRLN+RP M
Sbjct  467  WVSYWSQADKSLGMKVASRLNVRPTM  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   375 bits (962),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP +VVPG++YSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGLVVPGVHYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSD+QR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAE++
Sbjct  347  SYSDSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +GKR++C I KENNFKQPGERYR+FSPDRQERFI RWVDALSDPR+T+EIRSI
Sbjct  407  PIPPVVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP M
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPTM  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   374 bits (961),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYD VRHAE +
Sbjct  347  SYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+C+G+REKC I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+
Sbjct  407  PIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSV  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS LNMRPN+
Sbjct  467  WISYWSQADRSLGQKIASHLNMRPNI  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   374 bits (960),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++Y PSR+DPVRHAER+
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVCTG+REKC+I KENNFKQPGERYRS++PDRQERF  RWV+ALSDPR+T+EI SI
Sbjct  407  PIPPAVCTGRREKCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+Q DK LGQK+A+RLN+RP++
Sbjct  467  WISYWTQCDKFLGQKLATRLNVRPSI  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+
Sbjct  347  SYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TG+REKCVI KENNFKQPGERYRS+ P+RQERFI RWV+ALSDPR+T+EI+SI
Sbjct  407  PIPSRILTGRREKCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ DKSLGQKIA+RLN++P M
Sbjct  467  WISYWSQCDKSLGQKIATRLNVKPCM  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   374 bits (959),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYD VRHAE +
Sbjct  347  SYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+C+G+REKC I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+
Sbjct  407  PIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSV  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS LNMRPN+
Sbjct  467  WISYWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   374 bits (959),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDV+K WPED+VPLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTR+F
Sbjct  287  LDVSKIWPEDIVPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TGKREKCVIGKENNFKQPGERYRSF P RQERF+ RWV+ALSD R+T+EIR I
Sbjct  407  PLPPRVLTGKREKCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI+YWSQ DKSLGQK+A+RLNMRP+M
Sbjct  467  WITYWSQCDKSLGQKLATRLNMRPSM  492



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 193/206 (94%), Gaps = 2/206 (1%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL PVGRLVLN+NIDNFF ENEQLAFCPSIVVPG++YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFCPSIVVPGVFYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAERY
Sbjct  347  SYSDTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+ TGKREK +I KENNFKQPGERYRS++PDRQERFICRWVDALSD   T+EIRS+
Sbjct  407  PIPTAMLTGKREKTIIEKENNFKQPGERYRSWTPDRQERFICRWVDALSD--XTHEIRSV  464

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  465  WISYWSQADKSLGQKLASRLNVRPSI  490



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+IVVPG+Y SDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFWPAIVVPGVYCSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSD QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+Y
Sbjct  347  SYSDAQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TGKR+KC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSI
Sbjct  407  PIPPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W SYWSQADK+LGQKIASRLN+RP M
Sbjct  467  WFSYWSQADKTLGQKIASRLNVRPTM  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   372 bits (956),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RH+E Y
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +GKREK  I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T+EIRSI
Sbjct  407  PIPPVVLSGKREKRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP M
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD+TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPG+YYSDDK+LQTRIF
Sbjct  287  LDLTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSRYDPVRHAERY
Sbjct  347  AYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +  GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSI
Sbjct  407  PIPSNILYGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   372 bits (954),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL  VGR+VLN+NIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLLLVGRMVLNRNIDNFFTENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKC+ HNNHYDG MNF HRDEE+DYFPSR+DPVRHAE++
Sbjct  347  SYSDTQRHRLGPNYLMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  +C+GKREKC+I KENNFKQPGERYRSF+ DRQERFI RWVDALSDPR+T+EI SI
Sbjct  407  PMPPQICSGKREKCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ DKSLGQK+A+ LN++PNM
Sbjct  467  WISYWSQCDKSLGQKLATHLNLKPNM  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   372 bits (954),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKC+ HNNHYDG+MNFMHRDEE+DYFPSR+DP +HA RY
Sbjct  347  SYSDTQRHRLGPNYLLLPANAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRFDPAKHAPRY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P++ C G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI+SI
Sbjct  407  PIPSSTCNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQAD+SLGQK+ASRL+ +P+M
Sbjct  467  WLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   371 bits (953),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENE LAF P++VVPGIYY++DK+LQ RIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDTQR+RLGPNYLQLP NAPKC+ HNNH+DGSMNFMHRDEE+DYFPSR+DPVRHAE +
Sbjct  347  AYSDTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +C GKREK VI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPR+TYEIRSI
Sbjct  407  PIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRP  174
            WISYWSQAD+SLGQK+ASRLN++P
Sbjct  467  WISYWSQADRSLGQKLASRLNVKP  490



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   371 bits (953),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 167/204 (82%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENE LAF P++VVPGIYY++DK+LQ RIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDTQR+RLGPNYLQLP NAPKC+ HNNH+DGSMNFMHRDEE+DYFPSR+DPVRHAE +
Sbjct  347  AYSDTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +C GKREK VI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPR+TYEIRSI
Sbjct  407  PIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRP  174
            WISYWSQAD+SLGQK+ASRLN++P
Sbjct  467  WISYWSQADRSLGQKLASRLNVKP  490



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   371 bits (953),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRP  174
            WISYW+QADKSLGQK+ASRLN+RP
Sbjct  467  WISYWTQADKSLGQKLASRLNVRP  490



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   371 bits (953),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+ 
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  +  GKREKC+I KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIRSI
Sbjct  407  PVPPRILGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS LN++P++
Sbjct  467  WISYWSQADRSLGQKIASHLNLKPSI  492



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  200  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  259

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQRYRLGPNYLQLP NAPKC+ HNNH+DG MNFM RDEEI+YFPSR DP RHAERY
Sbjct  260  SYADTQRYRLGPNYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERY  319

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+AV TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+I
Sbjct  320  PQPSAVYTGKRERCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNI  379

Query  245  WISYWSQADKSLGQKIASRLNMRPN  171
            WISYWSQADKSLG K+AS  N++ N
Sbjct  380  WISYWSQADKSLGHKLASHFNLKIN  404



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD+TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF
Sbjct  287  LDLTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERY
Sbjct  347  AYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSI
Sbjct  407  PIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ SRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLLSRLNVRPSI  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+VPLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIVPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RY
Sbjct  347  SYSDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+A  TG+REK VI KENNFKQPGERYRS+ P RQ+RFI RW+DALSDPR+T+EIRSI
Sbjct  407  PIPSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQAD+SLGQK+ASRL+ +P+M
Sbjct  467  WLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+VPLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIVPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RY
Sbjct  347  SYSDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+A  TG+REK VI KENNFKQPGERYRS+ P RQ+RFI RW+DALSDPR+T+EIRSI
Sbjct  407  PIPSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQAD+SLGQK+ASRL+ +P+M
Sbjct  467  WLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERY
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +GKR K  I KENNFKQPG+RYRS++PDRQERFI RWV+ALSDPR+T+EIRSI
Sbjct  407  PIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQADKSLGQK+ASRLN+RP M
Sbjct  467  WVSYWSQADKSLGQKLASRLNVRPAM  492



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/232 (74%), Positives = 199/232 (86%), Gaps = 26/232 (11%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREK--------------------------CVIGKENNFKQPGERYRSFSP  324
            PTP AVC+GKRE+                          C+I KENNFK+PGERYRSF+P
Sbjct  407  PTPPAVCSGKRERVSNQIKPIFFSVSVSYGSESLKFVLQCIIEKENNFKEPGERYRSFAP  466

Query  323  DRQERFICRWVDALSDPRITYEIRSIWISYWSQADKSLGQKIASRLNMRPNM  168
            +RQERFI RW++ALSDPRIT+EIRSIWISYWSQADKSLGQK+ASRLN+RP++
Sbjct  467  ERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  518



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFVENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V  GKR++C+I KENNFKQPGERYRS++PDRQERFICRWVDALS+PR+T+EIR+I
Sbjct  407  PIPPRVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQADKSLGQK+ASRLN++P M
Sbjct  467  WLSYWSQADKSLGQKLASRLNVKPTM  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD+TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF
Sbjct  287  LDLTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKVLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERY
Sbjct  347  AYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSI
Sbjct  407  PIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ SRLN+RP++
Sbjct  467  WISYWSQADKSLGQKLLSRLNVRPSI  492



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+Y
Sbjct  347  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT   VC+G REKC IGKENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSI
Sbjct  407  PTTPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+A+RLN+RPN 
Sbjct  467  WISYWSQADKSLGQKLATRLNVRPNF  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIF
Sbjct  288  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIF  347

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAER+
Sbjct  348  SYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERF  407

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP A  +GKRE+C+  KENNFKQPGERYR+++PDRQ+RF  RW++ALSDPR+T+E+RSI
Sbjct  408  PTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSI  467

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS LNMRP++
Sbjct  468  WISYWSQADRSLGQKIASHLNMRPSI  493



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   370 bits (949),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL PVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+ YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLLPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVSYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V  GKRE+ +I KENNFKQPGERYRS  P RQERFICR VDAL DPRIT+EIRSI
Sbjct  407  PIPSNVINGKRERQIIAKENNFKQPGERYRSMDPARQERFICRVVDALFDPRITHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYW QADKSLG K+ASRLN+RP M
Sbjct  467  WVSYWFQADKSLGMKVASRLNVRPTM  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   370 bits (949),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+F
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++Y PSR DP RHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TGKREK +I KENNFKQPGE YRS++PDRQERF+CRWVDALSDPR T+EIRSI
Sbjct  407  PIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP M
Sbjct  467  WISYWSQADKSLGQKLASRLNIRPTM  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   369 bits (948),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAER+
Sbjct  347  SYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP A  +GKRE+C+  KENNFKQPGERYR+++PDRQ+RF  RW++ALSDPR+T+E+RSI
Sbjct  407  PTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS LNMRP++
Sbjct  467  WISYWSQADRSLGQKIASHLNMRPSI  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   369 bits (948),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPAN+PKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER 
Sbjct  347  SYADTQRHRLGPNYLQLPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P     GKREKC+I KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIRSI
Sbjct  407  PVPPRTLGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS LN++P++
Sbjct  467  WISYWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   369 bits (947),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERY
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +GKR K  I KENNFKQPG+RYRS++PDRQERFI RWV+ALSDPR+T+EIRSI
Sbjct  407  PIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQADKSLGQK+AS LN+RP M
Sbjct  467  WVSYWSQADKSLGQKLASHLNVRPTM  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   369 bits (947),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            +DVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  VDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DP  HAERY
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AV TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+I
Sbjct  407  PQPPAVYTGKRERCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNI  466

Query  245  WISYWSQADKSLGQKIASRLNMR  177
            WISYWSQADKSLGQK+ASRLN++
Sbjct  467  WISYWSQADKSLGQKLASRLNVK  489



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   369 bits (947),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RY
Sbjct  347  SYSDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+   TG+REK VI KENNFKQPGERYRS+ P RQERFI RW+DALSDPR+T+EIRSI
Sbjct  407  PIPSVNLTGRREKTVIPKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQAD+SLGQK+ASRL+ +P+M
Sbjct  467  WLSYWSQADRSLGQKLASRLSAKPSM  492



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   368 bits (944),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  + TG+R++C++ KENNFKQPGERYRSFS DRQERFI R VDALSDPR+T+EIRSI
Sbjct  407  PLPPPMLTGRRDRCMVQKENNFKQPGERYRSFSTDRQERFISRLVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+QA KSLGQK+ASRLN++P++
Sbjct  467  WISYWTQACKSLGQKLASRLNVKPSI  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+F
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR DP RHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TGKREK +I KENNFKQPGE YRS++P RQERF+CRWVDALSD R T+EIRSI
Sbjct  407  PIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN+RP M
Sbjct  467  WISYWSQADKSLGQKLASRLNIRPTM  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   367 bits (942),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIF
Sbjct  287  LDDTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRY P RHAE +
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+++ TGKR+KCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+ R+TYEIRSI
Sbjct  407  PIPSSIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+S GQK+A+RLN+RP++
Sbjct  467  WISYWSQADRSFGQKLATRLNVRPSI  492



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   367 bits (942),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+VPLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RY
Sbjct  347  SYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++I
Sbjct  407  PIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQADKSLGQK+ASRL+ +P+M
Sbjct  467  WLSYWSQADKSLGQKLASRLSSKPSM  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   366 bits (940),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED+VPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIF
Sbjct  287  LDVTKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+D VRHAE++
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V  GKR++C+I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T EIRSI
Sbjct  407  PIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+QADKSLGQKIAS LN+RP+M
Sbjct  467  WISYWTQADKSLGQKIASCLNVRPSM  492



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   366 bits (940),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+++VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSR+DPVRHAE +
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAESH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+AV TG+REK +I KENNFKQ GERYRSF+PDRQER+I RWVDALSDPR T+EIRSI
Sbjct  407  PIPSAVYTGRREKSIIEKENNFKQAGERYRSFAPDRQERYIRRWVDALSDPRCTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+AS LN+RPN 
Sbjct  467  WISYWSQADKSLGQKLASHLNVRPNF  492



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   366 bits (940),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RY
Sbjct  347  SYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P PA    G+REK  I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++I
Sbjct  407  PIPARALNGRREKACIDKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQADKSLGQK+ASRL+ +P+M
Sbjct  467  WLSYWSQADKSLGQKLASRLSAKPSM  492



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   366 bits (940),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+Y
Sbjct  347  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT   VC+G REKC I KENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSI
Sbjct  407  PTTPIVCSGNREKCFIRKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+A+RLN+RPN 
Sbjct  467  WISYWSQADKSLGQKLATRLNVRPNF  492



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   367 bits (942),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIF
Sbjct  321  LDVTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIF  380

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RY
Sbjct  381  SYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRY  440

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++I
Sbjct  441  PIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAI  500

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQADKSLGQK+ASRL+ +P+M
Sbjct  501  WLSYWSQADKSLGQKLASRLSSKPSM  526



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   366 bits (939),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P++VVPGIYY++DKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+
Sbjct  347  SYSDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+   +G REKCVI KENNFKQPGERYRSF PDRQERF+ RWV ALSDPR+T+EI SI
Sbjct  407  PIPSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ+DKSLGQKIA+RLNM+ NM
Sbjct  467  WISYWSQSDKSLGQKIAARLNMKANM  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   366 bits (939),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P ++VPG+YY++DKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFGPGLIVPGVYYTEDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+
Sbjct  347  SYSDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+   TGKREKCVI KENNFKQPGERYRSF+P+RQERF+ RWV ALSDPR+T+EI SI
Sbjct  407  PIPSHTHTGKREKCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ DKSLGQKIA+RLNM+ NM
Sbjct  467  WISYWSQCDKSLGQKIAARLNMKANM  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   365 bits (938),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQ+PANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAER 
Sbjct  347  SYADSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERI  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  +  GKREKC+I KENNFKQPGERYRS++ DRQERF+ RWVDALS+PR+T+EIRSI
Sbjct  407  PVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS LN++P++
Sbjct  467  WISYWSQADRSLGQKIASHLNLKPSI  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++
Sbjct  347  SYADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AV +G+REK  I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+
Sbjct  407  PIPPAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSV  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS LNMRPN+
Sbjct  467  WISYWSQADRSLGQKIASHLNMRPNI  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++
Sbjct  347  SYADTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  +  G REKC I KENNFKQPGE+YRS++PDRQERFI RW+DALSDPR+T+EIR+I
Sbjct  407  PIPPRILNGGREKCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI+YWSQ DK LGQK+ASRLN++P +
Sbjct  467  WITYWSQCDKFLGQKLASRLNIKPTL  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQ VGR+VLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQAVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNF+HRDEE++YFPSRYDPVRHAER 
Sbjct  347  SYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERC  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TG+REKCVI KENNFKQPGERYRS+ PDRQ RFI RWV+ALSDPR+T+EI+SI
Sbjct  407  PIPSRILTGRREKCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ DKSLG+KIA+RLN++P+M
Sbjct  467  WISYWSQCDKSLGRKIATRLNVKPSM  492



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++
Sbjct  347  SYADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+C+G+REK  I KENNFKQ GER+RS++PDRQ+RF  RWVDALSDPR+T+EIRS+
Sbjct  407  PIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSV  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS L+MRPN+
Sbjct  467  WISYWSQADRSLGQKIASHLSMRPNI  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   359 bits (922),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGR+VLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIF
Sbjct  134  LDVTKTWPEDVFPLQPVGRMVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIF  193

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP ++A RY
Sbjct  194  SYSDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRY  253

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P    TG+R+K VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIRSI
Sbjct  254  PIPTVHITGRRDKTVIAKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSI  313

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  314  WLSNWSQADRSLGQKLASRLSAKPSM  339



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   364 bits (935),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+VPLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RY
Sbjct  347  SYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++I
Sbjct  407  PIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAI  466

Query  245  WISYWSQADKSLGQKIASRLNMRP  174
            W+SYWSQADKSLGQK+ASRL+ +P
Sbjct  467  WLSYWSQADKSLGQKLASRLSSKP  490



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIF
Sbjct  328  LDVTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIF  387

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RY
Sbjct  388  SYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRY  447

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P PA    G+REK  I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++I
Sbjct  448  PIPARALNGRREKACIDKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAI  507

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQADKSLGQK+ASRL+ +P+M
Sbjct  508  WLSYWSQADKSLGQKLASRLSAKPSM  533



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   364 bits (935),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQLAF P+ VVPGIYYS+DKLLQ RIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFNPAHVVPGIYYSEDKLLQGRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDT R+RLGPNYLQLP NAPKC+ HNNHYDG MN MHRDEEIDYFPSRYDPVRHAER+
Sbjct  347  AYSDTHRHRLGPNYLQLPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG+RE+ VI KENNFKQP ERYRS++PDRQERF+ RWVDALSDPR+T+EIRSI
Sbjct  407  PIPTRVLTGRRERRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQKIA RLN+RP M
Sbjct  467  WISYWSQADKSLGQKIAFRLNVRPTM  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   363 bits (933),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD+TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDKLLQTRIF
Sbjct  287  LDLTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDTQR+RLGPNY+QLP NAPKC  HNNH DG MNFMHRDEE++YFPSRYDPVRHAER+
Sbjct  347  AYSDTQRHRLGPNYMQLPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TGKRE+ VI KENNFKQPGERYRS++PDRQERFI R VDALSDPR+++EIRSI
Sbjct  407  PIPSNILTGKRERRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQKIA+RLN+RP++
Sbjct  467  WISYWSQADKSLGQKIATRLNVRPSI  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   363 bits (933),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD TKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPG+YYS+DK+LQTR+F
Sbjct  287  LDDTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGVYYSNDKMLQTRLF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRY P RHAE +
Sbjct  347  AYSDTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TGKR+KCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+TYEIRSI
Sbjct  407  PIPSNIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+S GQK+A+RLN+RP++
Sbjct  467  WISYWSQADRSFGQKLATRLNVRPSI  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   363 bits (933),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKCVI KENNFKQ GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R I
Sbjct  407  PIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   363 bits (932),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG+MNFMHRDEE++YFPSR+D  RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKCVI KENNFKQ GERYRSF P RQ+RFI RWVDALSDPRIT+E+R I
Sbjct  407  PVPPRVLTGCREKCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   363 bits (932),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D QR+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++
Sbjct  347  SYADPQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+C+G+REK  I KENNFKQ GER+RS++PDRQ+RF  RWVDALSDPR+T+EIRS+
Sbjct  407  PIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSV  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS L+MRPN+
Sbjct  467  WISYWSQADRSLGQKIASHLSMRPNI  492



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   363 bits (932),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P++VVPGIYY++DKLLQTRIF
Sbjct  287  LDVTKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+
Sbjct  347  SYSDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+   +G REKCVI KENNFKQPGERYRSF PDRQERF+ RWV ALSDPR+T+EI SI
Sbjct  407  PIPSHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI YWSQ+DKSLGQKIA+RLNM+ NM
Sbjct  467  WIFYWSQSDKSLGQKIAARLNMKANM  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   363 bits (932),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKCVI KENNFKQ GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R I
Sbjct  407  PIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED+VPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIF
Sbjct  379  LDVTKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIF  438

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+D VRHAE++
Sbjct  439  SYADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKF  498

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V  GKR++C+I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T EIRSI
Sbjct  499  PIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSI  558

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+QADKSLGQKIAS LN+RP+M
Sbjct  559  WISYWTQADKSLGQKIASCLNVRPSM  584



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAE+ 
Sbjct  347  SYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A  +  REKC I K+NNFKQPGERYRS++PDRQ+RF+ RWVDALSDPR+T+EIRSI
Sbjct  407  PIPTANFSACREKCNIPKQNNFKQPGERYRSWAPDRQDRFLRRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQAD+SLGQKIAS LNMRP++
Sbjct  467  WISYWSQADRSLGQKIASHLNMRPSI  492



>gb|ACN36234.1| unknown [Zea mays]
Length=340

 Score =   357 bits (917),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -1

Query  779  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  600
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  137  VTKTWPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  196

Query  599  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  420
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  197  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  256

Query  419  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  240
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  257  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  316

Query  239  SYWSQADKSLGQKIASRLNMRPNM  168
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  317  SNWSQADRSLGQKLASRLSAKPSM  340



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   376 bits (966),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERY
Sbjct  347  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P AVCTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSI
Sbjct  407  PHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLN  183
            WI+YWSQAD+S+GQK+AS LN
Sbjct  467  WITYWSQADRSVGQKLASHLN  487


 Score =   367 bits (943),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  768  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  827

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQRYRLGPNYLQLP NAPKC+ HNNH+DG MNFM RDEEI+YFPSR DP RHAERY
Sbjct  828  SYADTQRYRLGPNYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERY  887

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+AV TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+I
Sbjct  888  PQPSAVYTGKRERCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNI  947

Query  245  WISYWSQADKSLGQKIASRLNMRPN  171
            WISYWSQADKSLG K+AS  N++ N
Sbjct  948  WISYWSQADKSLGHKLASHFNLKIN  972



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   362 bits (930),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDV+K WPED++PLQPVGRLVLNKNIDN+F E EQLAF P+ VVPGIYY++DKLLQTRIF
Sbjct  287  LDVSKIWPEDILPLQPVGRLVLNKNIDNYFAETEQLAFNPAFVVPGIYYTEDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +Y DTQR+RLGPNY+QLP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSR+DPVRHA R+
Sbjct  347  AYGDTQRHRLGPNYMQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V  GKR++CVI KENNFKQ GERYRS++PDRQERFICRWVD LSD R+T+EIRSI
Sbjct  407  PIPSTVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+A+RLN+RP M
Sbjct  467  WISYWSQADKSLGQKMATRLNVRPTM  492



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   362 bits (930),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDVLPLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSRYDPVRHA++ 
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKNAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHADKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+   +G+REK  I KENNFKQPGERYRS+ PDRQERFI RWVDALSDPR+T EIRSI
Sbjct  407  PIPSVPFSGRREKVSIEKENNFKQPGERYRSWDPDRQERFIRRWVDALSDPRLTQEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+QADKSLGQK+ASRLN+RP M
Sbjct  467  WISYWTQADKSLGQKLASRLNVRPTM  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   362 bits (930),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R I
Sbjct  407  PIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   362 bits (929),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R I
Sbjct  407  PIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   362 bits (928),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R I
Sbjct  407  PIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   355 bits (910),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIF
Sbjct  97   LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIF  156

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+Y
Sbjct  157  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKY  216

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SI
Sbjct  217  PMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSI  276

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQ D SLGQK+ASRL ++PNM
Sbjct  277  WVSYWSQCDASLGQKLASRLKIKPNM  302



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   360 bits (925),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE+ YFPSRYDPVRHAE+ 
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVIYFPSRYDPVRHAEQS  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  + +GKR KCVI KENNFKQPGER+RS+ PDRQERFI R V ALSDPR+T+E+ +I
Sbjct  407  PIPPVMLSGKRNKCVIEKENNFKQPGERFRSWDPDRQERFIRRIVGALSDPRVTHEVCTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPN  171
            W+SYWSQADKSLGQKIASRLN++P+
Sbjct  467  WVSYWSQADKSLGQKIASRLNVKPS  491



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   360 bits (925),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDVIPLQPVGRMVLNRNIDNFFTENEQLAFCPGVIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYD  ++A RY
Sbjct  347  SYSDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDAAKNAPRY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+   TG+REK +I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EIRSI
Sbjct  407  PIPSVPLTGRREKTMIKKENNFKQPGERYRSMDPARQERFIKRWIDALSDPRLTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQ D+SLGQK+ASRL+ +P+M
Sbjct  467  WLSYWSQTDRSLGQKLASRLSAKPSM  492



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   355 bits (912),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  148  LDVTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIF  207

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  208  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKV  267

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+I
Sbjct  268  PIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTI  327

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D +LGQK+ASRLN++P+M
Sbjct  328  WISYWSQCDAALGQKLASRLNLKPSM  353



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   360 bits (923),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP   A RY
Sbjct  347  SYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++I
Sbjct  407  PIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQAD+SLGQK+A RL+++P+M
Sbjct  467  WLSYWSQADRSLGQKLAGRLSVKPSM  492



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   359 bits (922),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVT+TWPED++PL PVGR+VLNKNIDNFF ENEQLAFCP IVVPGIYYSDDKLLQTRIF
Sbjct  287  LDVTRTWPEDILPLIPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+Y
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V  G+REK +I KENNF++PG RYRSF P RQERFICRW+ ALSDPR+T EIRSI
Sbjct  407  PIPQNVLNGRREKQIIAKENNFEEPGVRYRSFDPARQERFICRWIGALSDPRVTPEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLG K+A+RLN++P M
Sbjct  467  WISYWSQADKSLGMKLANRLNVKPTM  492



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   358 bits (920),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   358 bits (920),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   358 bits (920),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQ+RIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQSRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHR+EE++YFPSR +PVRHAE+Y
Sbjct  347  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHREEEVNYFPSRLNPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT   VC+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSI
Sbjct  407  PTSPIVCSGNREKCIIKKENNFQQPGERYRSWDSDRQERFVKRFVEALAEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+A+RLN++PN 
Sbjct  467  WISYWSQADKSLGQKLATRLNVKPNF  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   358 bits (920),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+A CP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIALCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPSRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>gb|KHG21219.1| Catalase isozyme 1 [Gossypium arboreum]
Length=432

 Score =   356 bits (914),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 188/206 (91%), Gaps = 6/206 (3%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVV GIYYSDDKLLQTR+F
Sbjct  233  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVRGIYYSDDKLLQTRVF  292

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDE+I+YFPSRYDP  HAER+
Sbjct  293  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEQINYFPSRYDPSHHAERF  352

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+CTGKREK      NNFKQPGERYRS++PDRQERFI  WVDALSDPR+T+EI SI
Sbjct  353  PIPPALCTGKREK------NNFKQPGERYRSWAPDRQERFINSWVDALSDPRVTHEICSI  406

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI+YWSQADKSLGQK+A RLN+RP++
Sbjct  407  WITYWSQADKSLGQKLACRLNVRPSI  432



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   358 bits (919),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_010105996.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXC51646.1| Catalase isozyme 1 [Morus notabilis]
Length=359

 Score =   353 bits (907),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIF
Sbjct  159  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIF  218

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHR+EE++YFPSRYDPVRHAERY
Sbjct  219  SYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERY  278

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+A+CTG+RE+ VI KENNFKQPGERYRSFSPDRQERFI RWV+ALSDPR+T+EIRSI
Sbjct  279  PIPSAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSI  338

Query  245  WISYWSQA  222
            WISYWSQ 
Sbjct  339  WISYWSQV  346



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   355 bits (910),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIF
Sbjct  193  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIF  252

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+Y
Sbjct  253  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKY  312

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SI
Sbjct  313  PMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSI  372

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQ D SLGQK+ASRL ++PNM
Sbjct  373  WVSYWSQCDASLGQKLASRLKIKPNM  398



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   358 bits (919),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   358 bits (918),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+ YS+DKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVSYSEDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR DP R+AE +
Sbjct  347  SYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+A+C+GKREKCVI KENNFKQPGERYRS++PDRQERF+ R V  LSDPRIT+E+R+I
Sbjct  407  PVPSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW Q DKSLGQK+A+RLN++P++
Sbjct  467  WISYWIQCDKSLGQKLATRLNVKPSI  492



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++P+QPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQ+RIF
Sbjct  287  LDVTKIWPEDVLPMQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQSRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHR+EE++YFPSR+DPVR+A++Y
Sbjct  347  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRNEEVNYFPSRFDPVRNAQKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT   VC+G REKC+IGKENNFKQPGERYRS+   RQERF+ R+V+AL++PR+T+EIRSI
Sbjct  407  PTTPIVCSGNREKCIIGKENNFKQPGERYRSWDSARQERFVKRFVEALAEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+ASRLN RP+ 
Sbjct  467  WISYWSQADKSLGQKLASRLNARPSF  492



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPK + HNNH++G MNFMHRDEE++YFPSR+D VRH+E++
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHSEKH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG+  + +I KENNFKQPGERYRSF PDRQERFI R VDALSDPR+T+EIRSI
Sbjct  407  PLPPPVLTGRCTRAMIEKENNFKQPGERYRSFPPDRQERFIRRVVDALSDPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLG+KIASRLN+RP++
Sbjct  467  WISYWSQADKSLGEKIASRLNVRPSI  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+I
Sbjct  407  PIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D +LGQK+ASRLN++P+M
Sbjct  467  WISYWSQCDAALGQKLASRLNLKPSM  492



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -1

Query  779  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  600
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  290  VTKTWPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  349

Query  599  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  420
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  350  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  409

Query  419  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  240
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  410  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  469

Query  239  SYWSQADKSLGQKIASRLNMRPNM  168
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  470  SNWSQADRSLGQKLASRLSAKPSM  493



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+I
Sbjct  407  PIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D +LGQK+ASRLN++P+M
Sbjct  467  WISYWSQCDAALGQKLASRLNLKPSM  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD+TK WPED++PLQPVGRLVLNKN+DNFF ENEQLAF P+ VVPGIYYS+DKLLQ RIF
Sbjct  287  LDMTKEWPEDILPLQPVGRLVLNKNVDNFFAENEQLAFNPAFVVPGIYYSNDKLLQARIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDT RYRLGPNYLQLP NAPKC+ HNNH+DG MN MHRDEEI+YFPS++DPVRHAERY
Sbjct  347  AYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TGKREK +I KENNFKQPGERYRS++PDRQERFI RW+ AL++PR+T+E RSI
Sbjct  407  PIPSQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+QADKSLGQK+ASRL+ RP+M
Sbjct  467  WISYWTQADKSLGQKLASRLSARPSM  492



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++Y
Sbjct  347  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT    C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSI
Sbjct  407  PTTPVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRP  174
            WISYW+QADKSLGQK+ASRLN+RP
Sbjct  467  WISYWTQADKSLGQKLASRLNVRP  490



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++Y
Sbjct  347  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT    C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSI
Sbjct  407  PTTPVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRP  174
            WISYW+QADKSLGQK+ASRLN+RP
Sbjct  467  WISYWTQADKSLGQKLASRLNVRP  490



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVP I+YSDD +LQTRIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPFIHYSDDNVLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+Y
Sbjct  347  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT   VC+G REKC I KENNFKQPGERYRS+  DRQERF+ R+V+AL +PR+T+EIRSI
Sbjct  407  PTTPIVCSGNREKCFIRKENNFKQPGERYRSWDSDRQERFVKRFVEALWEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+A+RLN+RPN 
Sbjct  467  WISYWSQADKSLGQKLATRLNVRPNF  492



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   357 bits (915),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDVLPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++Y
Sbjct  347  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT    C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSI
Sbjct  407  PTTPVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRP  174
            WISYW+QADKSLGQK+ASRLN+RP
Sbjct  467  WISYWTQADKSLGQKLASRLNVRP  490



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPGI YS+DKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGISYSEDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SYSDTQR+RLG NYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRH+ER+
Sbjct  347  SYSDTQRHRLGSNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERF  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ +C+G+R+KCVI KENNF+QPGERYRS++PDRQERF+ R V  LSDPRIT+E+RSI
Sbjct  407  PIPSTICSGRRDKCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+Q D+SLGQK+A RLN+RP++
Sbjct  467  WISYWTQCDRSLGQKLAFRLNVRPSI  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   354 bits (908),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVT+  PED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIF
Sbjct  228  LDVTRICPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIF  287

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQ+PANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAER 
Sbjct  288  SYADSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERI  347

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  +  GKREKC+I KENNFKQPGERYRS++ DRQERF+ RWVDALS+PR+T+EIRSI
Sbjct  348  PVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSI  407

Query  245  WISYWSQADKSLGQKIASRLN  183
            WISYWSQAD+SLGQKIAS LN
Sbjct  408  WISYWSQADRSLGQKIASHLN  428



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWV ALSDPR+T+E  +I
Sbjct  407  PIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVGALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   356 bits (913),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP +APKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPTRVQTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   356 bits (913),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPTRHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V TG REKC+I KENNFKQ GER+RSF P RQ+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPSRVLTGCREKCIIEKENNFKQAGERFRSFDPARQDRFIQRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WI+YWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WINYWSQCDASLGQKLASRLNLKPNM  492



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   356 bits (913),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -1

Query  779  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  600
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  288  VTKTWPEDTFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  347

Query  599  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  420
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  348  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  407

Query  419  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  240
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  408  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  467

Query  239  SYWSQADKSLGQKIASRLNMRPNM  168
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  468  SNWSQADRSLGQKLASRLSAKPSM  491



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   355 bits (912),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+Y
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SI
Sbjct  407  PMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQ D SLGQK+ASRL ++PNM
Sbjct  467  WVSYWSQCDASLGQKLASRLKIKPNM  492



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   357 bits (917),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  342  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIF  401

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  402  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKV  461

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI R VDALSDPR+T+E RSI
Sbjct  462  PIPPRVLTGCREKCIIHKENNFKQAGERYRSFDPARQDRFIQRVVDALSDPRVTHEHRSI  521

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  522  WISYWSQCDASLGQKLASRLNLKPNM  547



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   369 bits (948),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785   LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
             LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIF
Sbjct  808   LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIF  867

Query  605   SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
             SY+D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+Y
Sbjct  868   SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKY  927

Query  425   PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
             PT   VC+G REKC IGKENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSI
Sbjct  928   PTTPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSI  987

Query  245   WISYWSQADKSLGQKIASRLNMRPNM  168
             WISYWSQADKSLGQK+A+RLN+RPN 
Sbjct  988   WISYWSQADKSLGQKLATRLNVRPNF  1013


 Score =   340 bits (872),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLN+ IDNFFNE EQLAF P +VVPGIYYSDDKLLQ RIF
Sbjct  326  LDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIF  385

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +Y DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+Y+PS++DPVR AE+ 
Sbjct  386  AYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKV  445

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP    TG R KCVI KENNFKQ G+RYRS++PDRQ+RF+ RWV+ LS+PR+T+EIR I
Sbjct  446  PTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGI  505

Query  245  WISYWSQADKSLGQKIASRLNMRPN  171
            WISYWSQAD+SLGQK+ASRLN+RP+
Sbjct  506  WISYWSQADRSLGQKLASRLNVRPS  530



>prf||1803522A catalase
Length=491

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -1

Query  779  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  600
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  288  VTKTWPEDRFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  347

Query  599  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  420
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  348  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  407

Query  419  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  240
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  408  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  467

Query  239  SYWSQADKSLGQKIASRLNMRPNM  168
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  468  SNWSQADRSLGQKLASRLSAKPSM  491



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG  EKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPTRVLTGCGEKCIIQKENNFKQAGERYRSFDPARQDRFIRRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQKLASRLNLKPNM  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   348 bits (892),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLN+NIDNFFNENEQLAF P +VVPGIYYSDDK+LQ RIF
Sbjct  86   LDVTKWWPEDIIPLQPVGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIF  145

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +Y DTQR+RLGPNYL LP NAPKC  HNNHYDG MNFMHRDEE+DYFPS++  V +AE++
Sbjct  146  AYGDTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKF  205

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  +C+GKREK  I KENNFK PG+RYRS++PDRQERFI R VD LSDPR+T+EIRSI
Sbjct  206  PIPGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSI  265

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQADKSLGQKIASRLN+RPN+
Sbjct  266  WVSYWSQADKSLGQKIASRLNVRPNI  291



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -1

Query  779  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  600
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  288  VTKTWPEDRFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  347

Query  599  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  420
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  348  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  407

Query  419  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  240
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  408  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  467

Query  239  SYWSQADKSLGQKIASRLNMRPNM  168
            S WSQAD+SLGQK+ASRL+ +P+M
Sbjct  468  SNWSQADRSLGQKLASRLSAKPSM  491



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            +DVTK WPED+ PLQPVGR+VLN+NIDNFFNENEQLAF P IVVPGIYYSDDK LQ R F
Sbjct  287  VDVTKEWPEDMFPLQPVGRMVLNRNIDNFFNENEQLAFNPGIVVPGIYYSDDKFLQARTF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +Y DTQR+RLGPNYL LP NAPKC+ HNNHYDG MNF HRDEE+DYFPSR+DPVRHAER 
Sbjct  347  AYGDTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERC  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  + +GKRE+CVI KENNFKQPG+RYRSF+PDRQERF+ R VDALSD R+T+EIRSI
Sbjct  407  PLPPQLVSGKRERCVIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ DKSLGQKIA+RLN++P+M
Sbjct  467  WISYWSQCDKSLGQKIATRLNIKPHM  492



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   354 bits (909),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QRYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+Y
Sbjct  347  SYADSQRYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT    C+G REK +IGKENNFKQPGERYRS+  DRQERF+ R+++ALS+PR+T+EIRSI
Sbjct  407  PTTPITCSGNREKSIIGKENNFKQPGERYRSWDSDRQERFVKRFLEALSEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYW+QADKSLGQK+A+ LN++ N+
Sbjct  467  WVSYWTQADKSLGQKLATCLNVKANI  492



>gb|ADN94253.1| catalase [Puccinellia chinampoensis]
Length=492

 Score =   354 bits (908),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAITVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+   TG REKC+I KENNFKQ GER+RSF P  Q+RFI  WVDAL+D R+T+EI+ I
Sbjct  407  PIPSRTLTGCREKCIIEKENNFKQAGERFRSFDPAGQDRFIQWWVDALTDTRVTHEIQGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ASRL M+PNM
Sbjct  467  WISYWSQCDASLGQKLASRLKMKPNM  492



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   353 bits (907),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+++VPG++YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPK   HNNH++G MNFMHRDEE++YFPSRYDP RHAER+
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKNGHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERH  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +GKR++  I KENNFK+PG R+RS++ DRQERFI RWVDALSDPR+T+EIR I
Sbjct  407  PIPPVVLSGKRDRICIEKENNFKEPGVRFRSWATDRQERFIRRWVDALSDPRLTHEIRGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+QADKSLGQK+ASRLN+RP M
Sbjct  467  WISYWTQADKSLGQKLASRLNVRPTM  492



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   353 bits (907),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR++LNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMILNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH++G MNF+HRDEE++YFPSR+DP RHA++Y
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRFDPTRHAQKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSD R+T+EI+ I
Sbjct  407  PIPTRVLTGCREKCIIEKENNFKQAGERYRSFDPARQDRFIQRWVDALSDARVTHEIQGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQK+ SRL  +PNM
Sbjct  467  WISYWSQCDTSLGQKLGSRLKAKPNM  492



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   355 bits (910),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -1

Query  779  VTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSY  600
            VTKTWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSY
Sbjct  290  VTKTWPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSY  349

Query  599  SDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPT  420
            SDTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP 
Sbjct  350  SDTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPI  409

Query  419  PAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWI  240
            P A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+
Sbjct  410  PTAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWL  469

Query  239  SYWSQADKSLGQKIASRLNMRPNM  168
            S WSQAD+SLGQK+ASRL+ +P++
Sbjct  470  SNWSQADRSLGQKLASRLSAKPSI  493



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   353 bits (906),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
             DVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  FDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHA + 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAGKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQ D SLGQK+ASRLN++PNM
Sbjct  467  WMSYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   353 bits (906),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QRYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+Y
Sbjct  347  SYADSQRYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT    C+G REK +IGKENNF+QPGERYRS+  DRQERF+ R+++ALS+PR+T+EIRSI
Sbjct  407  PTTPITCSGNREKSIIGKENNFQQPGERYRSWDSDRQERFVKRFLEALSEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYW+QADKSLGQK+A+ LN++ N+
Sbjct  467  WVSYWTQADKSLGQKLATCLNVKANI  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   367 bits (941),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNE EQ+AFCP++VVPGI+YSDDKLLQTRIF
Sbjct  776  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNEYEQIAFCPALVVPGIHYSDDKLLQTRIF  835

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+Y
Sbjct  836  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKY  895

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT   VCTG REKC IGKENNF+QPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSI
Sbjct  896  PTTPIVCTGNREKCFIGKENNFQQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSI  955

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQADKSLGQK+A+RLN+RPN 
Sbjct  956  WISYWSQADKSLGQKLATRLNVRPNF  981


 Score =   338 bits (866),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLN+ IDNFFNE EQLAF P +VVPGIYYSDDKLLQ RIF
Sbjct  294  LDVTKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIF  353

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +Y DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+Y+PS++DPVR AE+ 
Sbjct  354  AYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKA  413

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P    TG R KCVI KENNFKQ G+RYRS++PDRQ+RF+ RWV+ LS+PR+T+EIR I
Sbjct  414  PIPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGI  473

Query  245  WISYWSQADKSLGQKIASRLNMRPN  171
            WISYWSQAD+SLGQK+ASRLN+RP+
Sbjct  474  WISYWSQADRSLGQKLASRLNVRPS  498



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   353 bits (905),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP +APKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P  Q+RFI RWVDALSDPR+T+E  +I
Sbjct  407  PIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPAGQDRFIQRWVDALSDPRVTHEHHTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D SLGQ++ASRLN++PNM
Sbjct  467  WISYWSQCDASLGQELASRLNLKPNM  492



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAISVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKV  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+I
Sbjct  407  PIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYWSQ D +LGQK+ SRLN++P+M
Sbjct  467  WISYWSQCDAALGQKLPSRLNLKPSM  492



>ref|XP_010498497.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QRYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+Y
Sbjct  347  SYADSQRYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PT    C+G REK +IGKENNFKQPG+RYRS+  DRQERF+ R+++ALS+PR+T+EIRSI
Sbjct  407  PTTPITCSGNREKSIIGKENNFKQPGDRYRSWDSDRQERFVKRFLEALSEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYW+QADKSLGQK+A+ LN++ N+
Sbjct  467  WVSYWTQADKSLGQKLATCLNVKANI  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFF ENE LAF P IVVPGIYYS+DK+LQ RIF
Sbjct  272  LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIF  331

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +Y DTQR+RLGPNYL LP NAPKC   NNHYDG MNFMHRDEE+DYFPSRYDP RHAERY
Sbjct  332  AYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERY  391

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V TG+REK  I KENNFKQPGERYRS++PDRQERF+ RW+ AL DPR+T+E+RSI
Sbjct  392  PIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSI  451

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQAD+SLGQK+ASRLN+RP++
Sbjct  452  WVSYWSQADRSLGQKLASRLNVRPSI  477



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   343 bits (881),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD+TK WPED+ PLQ +GRLVLN+NIDN+F ENE LAF P  VVPGI+YS+DKL Q R F
Sbjct  56   LDMTKIWPEDMFPLQQLGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTF  115

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +Y+DTQR+RLGPNY  LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER 
Sbjct  116  AYADTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERT  175

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+ +G+REKCVI KENNFKQPG+RYRS++PDRQERF+CR V+ALSDPRIT+EIRSI
Sbjct  176  PLPHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSI  235

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQ DKSLGQK+ASRLN+RPN 
Sbjct  236  WVSYWSQCDKSLGQKLASRLNVRPNF  261



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   352 bits (902),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFF ENE LAF P IVVPGIYYS+DK+LQ RIF
Sbjct  288  LDVTKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIF  347

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +Y DTQR+RLGPNYL LP NAPKC   NNHYDG MNFMHRDEE+DYFPSRYDP RHAERY
Sbjct  348  AYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERY  407

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ V TG+REK  I KENNFKQPGERYRS++PDRQERF+ RW+ AL DPR+T+E+RSI
Sbjct  408  PIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSI  467

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQAD+SLGQK+ASRLN+RP++
Sbjct  468  WVSYWSQADRSLGQKLASRLNVRPSI  493



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   352 bits (904),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PL PVGRLVLN+N+DNFF ENE LAF PS++VPGIY+S+DK+LQTRIF
Sbjct  308  LDVTKIWPEDILPLMPVGRLVLNRNVDNFFAENEMLAFSPSMIVPGIYFSNDKMLQTRIF  367

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +Y+DTQR+R+GPNYLQLP NAPKC  HNNH+DG+MNFMHRDEE++YFPSRYDP RHAE++
Sbjct  368  AYADTQRHRIGPNYLQLPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKF  427

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +G+R K VI KENNFKQPG+RYRS++PDRQERFI RW+DALSDPR+T EIRSI
Sbjct  428  PIPPVVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSI  487

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYW+QADKSLGQK+ASRLN+RP M
Sbjct  488  WVSYWTQADKSLGQKLASRLNVRPAM  513



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   352 bits (902),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD+TK WPED+ PLQP+GRLVLN+NIDN+F ENE LAF P+ VVPGI+YS+DKL Q R F
Sbjct  287  LDMTKIWPEDIFPLQPIGRLVLNRNIDNWFAENEMLAFNPAHVVPGIHYSNDKLFQLRTF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDTQR+RLGPNY+QLP NAPKC  HNNHYDG MNFMHRDEEIDYF SRYDPVRHAERY
Sbjct  347  AYSDTQRHRLGPNYMQLPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+ +G+REKCVI KENNFKQPGERYRS++PDRQERF+CR V+ALSDPRIT+EIR I
Sbjct  407  PIPNAIISGRREKCVIPKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQ D+SLGQK+ASRLN+RPN+
Sbjct  467  WVSYWSQCDQSLGQKLASRLNVRPNI  492



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   343 bits (881),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD+TK WPED+ PLQ +GRLVLN+NIDN+F ENE LAF P  VVPGI+YS+DKL Q R F
Sbjct  65   LDMTKIWPEDMFPLQQLGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTF  124

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +Y+DTQR+RLGPNY  LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER 
Sbjct  125  AYADTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERT  184

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P A+ +G+REKCVI KENNFKQPG+RYRS++PDRQERF+CR V+ALSDPRIT+EIRSI
Sbjct  185  PLPHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSI  244

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQ DKSLGQK+ASRLN+RPN 
Sbjct  245  WVSYWSQCDKSLGQKLASRLNVRPNF  270



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   351 bits (900),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LD+TK WPED++PLQPVGRLVLN+N+DNFF ENEQLAF P+ VVPGIY+S+DKLLQ RIF
Sbjct  287  LDMTKIWPEDILPLQPVGRLVLNQNVDNFFAENEQLAFNPAFVVPGIYFSNDKLLQARIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            +YSDT RYRLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEEI+YFPS++DPVRHAERY
Sbjct  347  AYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TGKRE+ +I KENNFKQ GERYRS++PDRQERFI RW+ ALS+PR+T+E RSI
Sbjct  407  PIPSQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WISYW+QADKS+GQK+AS L+ RP+M
Sbjct  467  WISYWTQADKSIGQKLASSLSARPSM  492



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   352 bits (902),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERY
Sbjct  347  SYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P+ + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSI
Sbjct  407  PNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSI  466

Query  245  WISYWSQA  222
            WISYWSQ 
Sbjct  467  WISYWSQV  474



>sp|P55313.1|CATA2_WHEAT RecName: Full=Catalase [Triticum aestivum]
 emb|CAA64077.1| catalase [Triticum aestivum]
Length=492

 Score =   351 bits (900),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIF
Sbjct  287  LDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR DP RHAE+ 
Sbjct  347  SYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRVDPTRHAEKD  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P P  V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SI
Sbjct  407  PMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            W+SYWSQ D SLGQK+ASRL ++PNM
Sbjct  467  WVSYWSQCDASLGQKLASRLKIKPNM  492



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   350 bits (897),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+CVI KENNFK+PG RYRSF+PDRQERFI RW++ALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCVIEKENNFKEPGGRYRSFTPDRQERFIRRWIEALSDPRITHEIRSI  466

Query  245  WISYWSQA  222
            WISYWSQ 
Sbjct  467  WISYWSQV  474



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score =   349 bits (895),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCP+IVVPG +YSDDKLLQ+RIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHAE+Y
Sbjct  347  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P     C G REKC+I KENNFKQPGERYRS+  DRQERF+ R+VDAL++PR+T+EIRSI
Sbjct  407  PQNPIACAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WIS W++AD+SLGQK+A+RLN+ PN 
Sbjct  467  WISNWTKADESLGQKLATRLNVSPNF  492



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score =   349 bits (895),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTK WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCP+IVVPG +YSDDKLLQ+RIF
Sbjct  287  LDVTKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHAE+Y
Sbjct  347  SYADSQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            P     C G REKC+I KENNFKQPGERYRS+  DRQERF+ R+VDAL++PR+T+EIRSI
Sbjct  407  PQNPIACAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEIRSI  466

Query  245  WISYWSQADKSLGQKIASRLNMRPNM  168
            WIS W++AD+SLGQK+A+RLN+ PN 
Sbjct  467  WISNWTKADESLGQKLATRLNVSPNF  492



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = -1

Query  785  LDVTKTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIF  606
            LDVTKTWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+F
Sbjct  287  LDVTKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVF  346

Query  605  SYSDTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERY  426
            SY+DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+Y
Sbjct  347  SYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKY  406

Query  425  PTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSI  246
            PTP AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSI
Sbjct  407  PTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSI  466

Query  245  WISYWSQA  222
            WISYWSQ 
Sbjct  467  WISYWSQV  474



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150