BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF018D16

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAF18445.1|  endo-1,4-beta-D-glucanase KORRIGAN                     207   1e-62   Pisum sativum [garden pea]
gb|AID55380.1|  glycoside hydrolase family 9 A2                         216   6e-62   Gossypium hirsutum [American cotton]
gb|KJB70736.1|  hypothetical protein B456_011G089500                    215   7e-62   Gossypium raimondii
gb|KDP32467.1|  hypothetical protein JCGZ_13392                         215   8e-62   Jatropha curcas
gb|AAZ08322.1|  endo-1,4-beta-glucanase                                 211   1e-61   Eucalyptus globulus [blue gum]
ref|XP_007147545.1|  hypothetical protein PHAVU_006G133700g             214   3e-61   Phaseolus vulgaris [French bean]
gb|ADB82903.1|  membrane-bound endo-beta-1,4-glucanase                  213   5e-61   Populus alba x Populus grandidentata
emb|CBI29606.3|  unnamed protein product                                210   9e-61   Vitis vinifera
gb|AHA41508.1|  endo-1,4 -beta-glucanase                                212   1e-60   Populus deltoides
ref|XP_006385837.1|  endo-1 family protein                              212   1e-60   Populus trichocarpa [western balsam poplar]
gb|AAT75041.1|  Cel9A                                                   212   1e-60   Populus tremula x Populus tremuloides
gb|AAS45400.1|  endo-1,4-beta-glucanase                                 212   1e-60   Populus tremuloides
ref|XP_003546229.1|  PREDICTED: endoglucanase 25-like                   211   2e-60   Glycine max [soybeans]
ref|XP_011022354.1|  PREDICTED: endoglucanase 25-like                   211   2e-60   Populus euphratica
ref|XP_002519394.1|  endo-1,4-beta-glucanase, putative                  211   3e-60   Ricinus communis
ref|XP_010065200.1|  PREDICTED: endoglucanase 25-like                   211   3e-60   Eucalyptus grandis [rose gum]
gb|KHN14382.1|  Endoglucanase 25                                        211   3e-60   Glycine soja [wild soybean]
ref|XP_002299405.1|  endo-1 family protein                              211   4e-60   
gb|AFY03622.1|  endo-1,4-beta-glucanase                                 209   1e-59   Eucalyptus globulus [blue gum]
ref|XP_004238641.1|  PREDICTED: endoglucanase 25-like                   209   2e-59   
gb|ADY68792.1|  membrane-anchored endo-1,4-beta-glucanase               209   2e-59   Gossypium herbaceum subsp. africanum
gb|KJB66548.1|  hypothetical protein B456_010G143300                    209   2e-59   Gossypium raimondii
gb|AAS87601.1|  membrane-anchored endo-1,4-beta-glucanase               209   2e-59   Gossypium hirsutum [American cotton]
gb|AAP83128.1|  endo-1,4-beta-glucanase                                 209   2e-59   Gossypium hirsutum [American cotton]
gb|ADY68794.1|  membrane-anchored endo-1,4-beta-glucanase               209   2e-59   Gossypium hirsutum [American cotton]
gb|AEN70798.1|  endo-1,4-beta-glucanase                                 209   2e-59   Gossypium turneri
gb|AAQ08018.1|  endo-1,4-beta-glucanase                                 209   2e-59   Gossypium hirsutum [American cotton]
gb|AEN70816.1|  endo-1,4-beta-glucanase                                 209   2e-59   Gossypium gossypioides
gb|ABD62083.1|  endo-1,4-beta-glucancase precursor                      208   3e-59   Glycine max [soybeans]
ref|XP_003535026.1|  PREDICTED: endoglucanase 25                        208   3e-59   
gb|AGV22123.1|  endo-1,4-beta-glucanase 1                               208   4e-59   Betula luminifera [liang ye hua]
gb|KDO53876.1|  hypothetical protein CISIN_1g007014mg                   204   4e-59   Citrus sinensis [apfelsine]
gb|AEN70810.1|  endo-1,4-beta-glucanase                                 208   4e-59   Gossypium hirsutum subsp. latifolium
gb|AEN70809.1|  endo-1,4-beta-glucanase                                 208   5e-59   Gossypium hirsutum subsp. latifolium
ref|XP_002266927.3|  PREDICTED: endoglucanase 25                        211   5e-59   
gb|ADY68791.1|  membrane-anchored endo-1,4-beta-glucanase               207   6e-59   Gossypium barbadense [Egyptian cotton]
ref|XP_009770880.1|  PREDICTED: endoglucanase 25-like                   207   9e-59   Nicotiana sylvestris
ref|XP_006356407.1|  PREDICTED: endoglucanase 25-like                   207   9e-59   Solanum tuberosum [potatoes]
ref|XP_009600540.1|  PREDICTED: endoglucanase 25-like                   207   9e-59   Nicotiana tomentosiformis
gb|AFD33696.1|  korrigan                                                207   9e-59   Eucalyptus camaldulensis
ref|XP_003529689.1|  PREDICTED: endoglucanase 25-like                   207   1e-58   Glycine max [soybeans]
ref|XP_003594425.1|  Endoglucanase                                      207   1e-58   Medicago truncatula
gb|AEN70797.1|  endo-1,4-beta-glucanase                                 207   1e-58   Gossypium schwendimanii
gb|AFR40585.1|  cellulase                                               193   1e-58   Populus nigra [black poplar]
ref|XP_011088109.1|  PREDICTED: endoglucanase 25-like                   206   1e-58   
gb|AFR40584.1|  cellulase                                               193   1e-58   Populus nigra [black poplar]
ref|XP_003550680.1|  PREDICTED: endoglucanase 25-like                   206   1e-58   Glycine max [soybeans]
ref|XP_004171003.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    206   1e-58   
ref|XP_004133745.1|  PREDICTED: endoglucanase 25-like                   206   2e-58   Cucumis sativus [cucumbers]
ref|XP_007154086.1|  hypothetical protein PHAVU_003G089600g             206   2e-58   Phaseolus vulgaris [French bean]
ref|XP_004486415.1|  PREDICTED: endoglucanase 25-like                   206   3e-58   Cicer arietinum [garbanzo]
ref|NP_001284449.1|  endoglucanase 25-like                              206   3e-58   Cucumis melo [Oriental melon]
gb|AFR40563.1|  cellulase                                               192   3e-58   Populus trichocarpa [western balsam poplar]
gb|AIE16186.1|  endo-1,4-beta-glucanase                                 205   4e-58   Nicotiana tabacum [American tobacco]
ref|XP_011026717.1|  PREDICTED: endoglucanase 25-like isoform X3        209   5e-58   Populus euphratica
gb|AEO97184.1|  endo-1,4-beta-glucanase                                 205   5e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010533226.1|  PREDICTED: endoglucanase 25                        205   6e-58   Tarenaya hassleriana [spider flower]
ref|XP_010088712.1|  Endoglucanase 25                                   205   7e-58   Morus notabilis
gb|AEO97182.1|  endo-1,4-beta-glucanase                                 204   7e-58   Populus tomentosa [Chinese white poplar]
gb|AEO97265.1|  endo-1,4-beta-glucanase                                 204   7e-58   Populus tomentosa [Chinese white poplar]
ref|XP_006431347.1|  hypothetical protein CICLE_v10000600mg             204   7e-58   Citrus clementina [clementine]
gb|KDO53875.1|  hypothetical protein CISIN_1g007014mg                   204   8e-58   Citrus sinensis [apfelsine]
gb|AEO97239.1|  endo-1,4-beta-glucanase                                 204   8e-58   Populus tomentosa [Chinese white poplar]
gb|AEO97252.1|  endo-1,4-beta-glucanase                                 204   8e-58   Populus tomentosa [Chinese white poplar]
ref|XP_011092233.1|  PREDICTED: endoglucanase 25-like                   204   8e-58   Sesamum indicum [beniseed]
gb|AEO97238.1|  endo-1,4-beta-glucanase                                 204   8e-58   Populus tomentosa [Chinese white poplar]
gb|AFR40589.1|  cellulase                                               191   1e-57   Populus nigra [black poplar]
gb|AFR40578.1|  cellulase                                               191   1e-57   Populus fremontii
emb|CDP17765.1|  unnamed protein product                                204   2e-57   Coffea canephora [robusta coffee]
gb|AEO97185.1|  endo-1,4-beta-glucanase                                 203   2e-57   Populus trichocarpa [western balsam poplar]
gb|AFR40581.1|  cellulase                                               190   2e-57   Populus fremontii
gb|AEO97183.1|  endo-1,4-beta-glucanase                                 203   3e-57   Populus tomentosa [Chinese white poplar]
gb|AFR40588.1|  cellulase                                               190   3e-57   Populus nigra [black poplar]
gb|AEO97283.1|  endo-1,4-beta-glucanase                                 203   3e-57   Populus tomentosa [Chinese white poplar]
ref|XP_010682188.1|  PREDICTED: endoglucanase 25                        203   3e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001233943.1|  endo-1,4-beta-glucanase                            202   8e-57   Solanum lycopersicum
ref|XP_006358489.1|  PREDICTED: endoglucanase 25-like                   202   9e-57   Solanum tuberosum [potatoes]
ref|XP_008347974.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    201   1e-56   
ref|XP_008339246.1|  PREDICTED: endoglucanase 25-like                   201   1e-56   Malus domestica [apple tree]
ref|XP_010521418.1|  PREDICTED: endoglucanase 25-like                   201   2e-56   Tarenaya hassleriana [spider flower]
dbj|BAD95336.1|  cellulase homolog OR16pep precursor                    192   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009340771.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    200   5e-56   
dbj|BAC22690.1|  endo-1,4-beta-D-glucanase                              199   5e-56   Pyrus communis
ref|XP_009399913.1|  PREDICTED: endoglucanase 9-like                    201   5e-56   
emb|CAN68337.1|  hypothetical protein VITISV_025978                     199   5e-56   Vitis vinifera
dbj|BAF42036.1|  cellulase1                                             199   5e-56   Pyrus communis
ref|XP_009765308.1|  PREDICTED: endoglucanase 25-like                   199   6e-56   Nicotiana sylvestris
ref|XP_009595607.1|  PREDICTED: endoglucanase 25-like                   199   6e-56   Nicotiana tomentosiformis
gb|AFR40591.1|  cellulase                                               186   1e-55   Populus nigra [black poplar]
ref|XP_010533225.1|  PREDICTED: endoglucanase 25-like                   197   3e-55   Tarenaya hassleriana [spider flower]
ref|XP_008379019.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    201   3e-55   
ref|XP_007023831.1|  Glycosyl hydrolase 9A1                             201   4e-55   
gb|AFR40586.1|  cellulase                                               184   5e-55   Populus nigra [black poplar]
ref|XP_007222007.1|  hypothetical protein PRUPE_ppa002911mg             196   8e-55   Prunus persica
ref|XP_010266669.1|  PREDICTED: endoglucanase 9-like                    196   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_006281810.1|  hypothetical protein CARUB_v10027986mg             195   2e-54   Capsella rubella
ref|XP_006858422.1|  hypothetical protein AMTR_s00071p00064260          195   3e-54   Amborella trichopoda
gb|AFR40583.1|  cellulase                                               182   3e-54   Populus nigra [black poplar]
ref|XP_010482263.1|  PREDICTED: endoglucanase 25-like                   194   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008803421.1|  PREDICTED: endoglucanase 10-like                   194   4e-54   Phoenix dactylifera
ref|XP_010938102.1|  PREDICTED: endoglucanase 9-like                    194   5e-54   Elaeis guineensis
ref|XP_010909007.1|  PREDICTED: endoglucanase 10-like                   194   6e-54   Elaeis guineensis
ref|XP_010441020.1|  PREDICTED: endoglucanase 25                        194   7e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010921267.1|  PREDICTED: endoglucanase 9-like                    194   7e-54   Elaeis guineensis
emb|CDX83181.1|  BnaA03g23250D                                          194   7e-54   
emb|CAB51903.1|  cellulase                                              194   7e-54   Brassica napus [oilseed rape]
ref|XP_010442441.1|  PREDICTED: endoglucanase 25                        194   7e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009134026.1|  PREDICTED: endoglucanase 25                        194   8e-54   Brassica rapa
gb|AFL65037.1|  endoglucanase                                           190   1e-53   Pinus pinaster [cluster pine]
ref|XP_002865753.1|  hypothetical protein ARALYDRAFT_495032             193   1e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_009123553.1|  PREDICTED: endoglucanase 25                        193   1e-53   Brassica rapa
emb|CDX71601.1|  BnaC09g26420D                                          193   1e-53   
emb|CDY37768.1|  BnaA10g05530D                                          193   1e-53   Brassica napus [oilseed rape]
ref|XP_008218604.1|  PREDICTED: endoglucanase 25                        196   2e-53   
ref|XP_009355455.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    196   2e-53   
gb|AAM63370.1|  cellulase homolog OR16pep precursor                     192   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007216021.1|  hypothetical protein PRUPE_ppa014845mg             192   2e-53   
gb|AAK59818.1|  AT5g49720/K2I5_8                                        192   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAN72232.1|  At5g49720/K2I5_8                                        192   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199783.1|  endo-1,4-beta-D-glucanase                             192   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406859.1|  PREDICTED: endoglucanase 9-like                    192   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16291.1|  unknown                                                 192   4e-53   Picea sitchensis
ref|XP_008782747.1|  PREDICTED: endoglucanase 9-like                    192   4e-53   Phoenix dactylifera
gb|AEL88496.1|  membrane-bound endo-1,4-beta-glucanase                  192   4e-53   Picea glauca
ref|XP_008243721.1|  PREDICTED: endoglucanase 9-like                    190   7e-53   Prunus mume [ume]
emb|CDY21449.1|  BnaC03g27480D                                          191   1e-52   Brassica napus [oilseed rape]
ref|XP_004301591.2|  PREDICTED: endoglucanase 25                        194   1e-52   Fragaria vesca subsp. vesca
ref|XP_008793381.1|  PREDICTED: endoglucanase 9-like                    189   3e-52   Phoenix dactylifera
gb|ABR15471.1|  endoglucanase                                           189   3e-52   Pinus taeda
gb|KFK26611.1|  hypothetical protein AALP_AA8G271400                    189   3e-52   Arabis alpina [alpine rockcress]
ref|XP_009395086.1|  PREDICTED: endoglucanase 10-like                   189   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417855.1|  PREDICTED: endoglucanase 9-like                    189   5e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001183308.1|  hypothetical protein                               187   2e-51   Zea mays [maize]
emb|CDX92628.1|  BnaC07g38860D                                          187   2e-51   
ref|XP_009137436.1|  PREDICTED: endoglucanase 21-like                   187   2e-51   Brassica rapa
ref|XP_006402246.1|  hypothetical protein EUTSA_v10012932mg             187   3e-51   Eutrema salsugineum [saltwater cress]
ref|XP_006402245.1|  hypothetical protein EUTSA_v10012932mg             187   3e-51   
ref|XP_010088713.1|  Endoglucanase 25                                   175   1e-50   
ref|XP_004984503.1|  PREDICTED: endoglucanase 9-like                    185   1e-50   Setaria italica
gb|AFR40582.1|  cellulase                                               172   2e-50   Populus fremontii
ref|NP_001142480.1|  uncharacterized protein LOC100274698               174   3e-50   
ref|XP_010529892.1|  PREDICTED: endoglucanase 25-like                   183   4e-50   Tarenaya hassleriana [spider flower]
gb|KHN40215.1|  Endoglucanase 25                                        171   6e-50   Glycine soja [wild soybean]
gb|EYU35397.1|  hypothetical protein MIMGU_mgv1a003033mg                182   1e-49   Erythranthe guttata [common monkey flower]
ref|XP_009400506.1|  PREDICTED: endoglucanase 10-like                   181   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADQ73896.1|  endo-1,4-beta-glucanase                                 175   4e-49   Avena strigosa
ref|XP_002465324.1|  hypothetical protein SORBIDRAFT_01g036480          181   4e-49   Sorghum bicolor [broomcorn]
gb|EEE58992.1|  hypothetical protein OsJ_10702                          181   5e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006431346.1|  hypothetical protein CICLE_v10003884mg             178   5e-49   
ref|NP_001050004.1|  Os03g0329500                                       181   5e-49   
ref|XP_009137865.1|  PREDICTED: endoglucanase 21                        180   8e-49   Brassica rapa
emb|CDY34271.1|  BnaA01g13740D                                          179   9e-49   Brassica napus [oilseed rape]
ref|NP_001147537.1|  endo-1,4-beta-glucanase                            179   1e-48   Zea mays [maize]
ref|XP_006650027.1|  PREDICTED: endoglucanase 9-like                    179   1e-48   Oryza brachyantha
gb|EMT00674.1|  Endoglucanase 10                                        178   2e-48   
gb|EMS52550.1|  Endoglucanase 10                                        178   3e-48   Triticum urartu
dbj|BAJ94336.1|  predicted protein                                      178   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA94257.1|  endo-1,4-beta-glucanase Cel1                           178   4e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABP96983.1|  cellulase                                               177   5e-48   Colocasia esculenta [cocoyam]
ref|XP_006650552.1|  PREDICTED: endoglucanase 10-like                   177   7e-48   Oryza brachyantha
emb|CBB36505.1|  Hordeum vulgare protein similar to endo-1,4-b-gl...    177   7e-48   Saccharum hybrid cultivar R570
emb|CDI66528.1|  Endoglucanase 10                                       177   8e-48   Saccharum hybrid cultivar R570
emb|CDI66602.1|  Endoglucanase 10                                       177   9e-48   Saccharum hybrid cultivar R570
ref|XP_002515321.1|  endo-1,4-beta-glucanase, putative                  177   9e-48   Ricinus communis
gb|ACZ82300.1|  beta-1,4 glycosidase                                    177   1e-47   Phyllostachys edulis [kikko-chiku]
ref|XP_003560035.1|  PREDICTED: endoglucanase 10                        176   1e-47   Brachypodium distachyon [annual false brome]
ref|XP_010433798.1|  PREDICTED: endoglucanase 21-like                   176   2e-47   Camelina sativa [gold-of-pleasure]
gb|ABF98747.1|  endo-1,4-beta-glucanase Cel1, putative, expressed       175   2e-47   Oryza sativa Japonica Group [Japonica rice]
emb|CDI66566.1|  Endoglucanase 10                                       176   2e-47   Saccharum hybrid cultivar R570
ref|XP_002463915.1|  hypothetical protein SORBIDRAFT_01g008860          176   2e-47   Sorghum bicolor [broomcorn]
ref|XP_006413454.1|  hypothetical protein EUTSA_v10024681mg             176   3e-47   
ref|NP_001051192.1|  Os03g0736300                                       175   3e-47   
emb|CDY03467.1|  BnaC01g16150D                                          175   4e-47   
gb|AAM13693.1|  endo-1,4-beta-glucanase                                 175   4e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008342152.1|  PREDICTED: endoglucanase 9-like                    174   4e-47   
ref|XP_003557996.1|  PREDICTED: endoglucanase 9                         174   7e-47   Brachypodium distachyon [annual false brome]
gb|ACN28577.1|  unknown                                                 174   8e-47   Zea mays [maize]
ref|NP_001151770.1|  endo-1,4-beta-glucanase Cel1                       174   9e-47   
tpg|DAA51201.1|  TPA: endo-1,4-beta-glucanase Cel1                      174   9e-47   
ref|XP_009339798.1|  PREDICTED: endoglucanase 9-like                    174   1e-46   Pyrus x bretschneideri [bai li]
gb|EPS69180.1|  hypothetical protein M569_05586                         174   1e-46   Genlisea aurea
ref|XP_010277803.1|  PREDICTED: endoglucanase 12-like                   174   1e-46   Nelumbo nucifera [Indian lotus]
ref|XP_006444448.1|  hypothetical protein CICLE_v10024241mg             173   2e-46   Citrus clementina [clementine]
ref|XP_004981854.1|  PREDICTED: endoglucanase 10-like                   172   3e-46   Setaria italica
ref|XP_006480121.1|  PREDICTED: endoglucanase 25-like                   172   4e-46   Citrus sinensis [apfelsine]
gb|KDO87072.1|  hypothetical protein CISIN_1g046335mg                   172   4e-46   Citrus sinensis [apfelsine]
ref|XP_006403190.1|  hypothetical protein EUTSA_v10003366mg             171   5e-46   
ref|NP_194157.1|  endoglucanase 21                                      172   6e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448587.1|  PREDICTED: endoglucanase 21-like                   172   7e-46   Camelina sativa [gold-of-pleasure]
emb|CDY45056.1|  BnaA08g02190D                                          171   9e-46   Brassica napus [oilseed rape]
ref|XP_006283336.1|  hypothetical protein CARUB_v10004382mg             171   1e-45   Capsella rubella
ref|XP_010439066.1|  PREDICTED: endoglucanase 21                        170   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002867672.1|  predicted protein                                  170   4e-45   Arabidopsis lyrata subsp. lyrata
gb|KDO53877.1|  hypothetical protein CISIN_1g041590mg                   168   4e-45   Citrus sinensis [apfelsine]
gb|KFK22234.1|  hypothetical protein AALP_AAs42893U000400               168   1e-44   Arabis alpina [alpine rockcress]
ref|XP_002960146.1|  hypothetical protein SELMODRAFT_266522             168   1e-44   
ref|XP_008235173.1|  PREDICTED: endoglucanase 9-like                    167   4e-44   Prunus mume [ume]
gb|EMS51342.1|  Endoglucanase 9                                         166   7e-44   Triticum urartu
ref|XP_007199407.1|  hypothetical protein PRUPE_ppa026228mg             166   1e-43   Prunus persica
ref|XP_002514768.1|  endo-1,4-beta-glucanase, putative                  166   1e-43   Ricinus communis
ref|XP_002983992.1|  hypothetical protein SELMODRAFT_268803             165   1e-43   
emb|CBI18623.3|  unnamed protein product                                163   1e-43   Vitis vinifera
gb|EPS66085.1|  hypothetical protein M569_08689                         165   2e-43   Genlisea aurea
gb|EMT18790.1|  Endoglucanase 9                                         165   2e-43   
gb|AGK26802.1|  endo-beta-1,4-glucanase                                 164   3e-43   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26803.1|  endo-beta-1,4-glucanase                                 164   3e-43   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26798.1|  endo-beta-1,4-glucanase                                 164   3e-43   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26801.1|  endo-beta-1,4-glucanase                                 164   3e-43   Triticum aestivum [Canadian hard winter wheat]
gb|KDP32490.1|  hypothetical protein JCGZ_13415                         164   4e-43   Jatropha curcas
dbj|BAK04500.1|  predicted protein                                      164   4e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010646848.1|  PREDICTED: endoglucanase 12                        162   6e-43   
gb|EYU33245.1|  hypothetical protein MIMGU_mgv1a022358mg                161   6e-43   Erythranthe guttata [common monkey flower]
gb|KDP28223.1|  hypothetical protein JCGZ_13994                         162   1e-42   Jatropha curcas
gb|AFZ78629.1|  korrigan                                                162   1e-42   Populus tomentosa [Chinese white poplar]
ref|XP_002312211.1|  endo-1 family protein                              162   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006448516.1|  hypothetical protein CICLE_v10014583mg             161   4e-42   Citrus clementina [clementine]
ref|XP_007028162.1|  Six-hairpin glycosidases superfamily protein       161   4e-42   
ref|XP_010065082.1|  PREDICTED: endoglucanase 12                        161   5e-42   Eucalyptus grandis [rose gum]
ref|XP_008801082.1|  PREDICTED: endoglucanase 12-like                   160   6e-42   Phoenix dactylifera
ref|XP_006468640.1|  PREDICTED: endoglucanase 12-like                   160   7e-42   Citrus sinensis [apfelsine]
gb|KDO77086.1|  hypothetical protein CISIN_1g013288mg                   158   1e-41   Citrus sinensis [apfelsine]
ref|XP_011010912.1|  PREDICTED: endoglucanase 12                        160   1e-41   Populus euphratica
ref|XP_011014628.1|  PREDICTED: endoglucanase 12-like isoform X3        159   2e-41   Populus euphratica
ref|XP_009141938.1|  PREDICTED: endoglucanase 21-like                   159   2e-41   Brassica rapa
ref|XP_006858738.1|  hypothetical protein AMTR_s00066p00128970          159   2e-41   Amborella trichopoda
ref|XP_011014603.1|  PREDICTED: endoglucanase 12-like isoform X1        159   3e-41   Populus euphratica
ref|XP_011077092.1|  PREDICTED: endoglucanase 12                        158   4e-41   Sesamum indicum [beniseed]
ref|XP_002315101.2|  hypothetical protein POPTR_0010s18480g             157   5e-41   
gb|AFZ78628.1|  korrigan                                                158   7e-41   Populus tomentosa [Chinese white poplar]
ref|XP_004250089.1|  PREDICTED: endoglucanase 12                        157   9e-41   Solanum lycopersicum
gb|AEO97186.1|  endo-1,4-beta-glucanase                                 157   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_004502103.1|  PREDICTED: endoglucanase 12-like                   157   1e-40   Cicer arietinum [garbanzo]
ref|XP_010929679.1|  PREDICTED: endoglucanase 12-like                   157   1e-40   Elaeis guineensis
ref|XP_003556773.1|  PREDICTED: endoglucanase 12-like                   156   2e-40   Glycine max [soybeans]
gb|KHN09941.1|  Endoglucanase 7                                         156   2e-40   Glycine soja [wild soybean]
emb|CDP09829.1|  unnamed protein product                                155   2e-40   Coffea canephora [robusta coffee]
ref|XP_007146006.1|  hypothetical protein PHAVU_006G0049001g            155   2e-40   Phaseolus vulgaris [French bean]
ref|XP_009782313.1|  PREDICTED: endoglucanase 12                        154   1e-39   Nicotiana sylvestris
ref|XP_010912745.1|  PREDICTED: endoglucanase 12-like                   152   1e-39   
ref|XP_009602898.1|  PREDICTED: endoglucanase 12                        154   1e-39   Nicotiana tomentosiformis
ref|XP_010930303.1|  PREDICTED: endoglucanase 12-like                   154   1e-39   Elaeis guineensis
ref|XP_009385674.1|  PREDICTED: endoglucanase 12-like                   154   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010528623.1|  PREDICTED: endoglucanase 7                         154   1e-39   Tarenaya hassleriana [spider flower]
gb|ACF87544.1|  unknown                                                 152   2e-39   Zea mays [maize]
gb|ACT54547.1|  endo-1,4-beta-glucanase                                 153   2e-39   Dimocarpus longan [longan]
emb|CDP21162.1|  unnamed protein product                                152   4e-39   Coffea canephora [robusta coffee]
tpg|DAA36812.1|  TPA: hypothetical protein ZEAMMB73_340402              152   4e-39   
ref|XP_008441913.1|  PREDICTED: endoglucanase 7                         152   5e-39   Cucumis melo [Oriental melon]
ref|XP_010673846.1|  PREDICTED: endoglucanase 12-like                   152   5e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001147970.1|  glycoside transferase, six-hairpin, subgroup       152   7e-39   Zea mays [maize]
ref|XP_006353239.1|  PREDICTED: endoglucanase 12-like                   151   1e-38   Solanum tuberosum [potatoes]
ref|XP_008813788.1|  PREDICTED: endoglucanase 12-like                   151   1e-38   Phoenix dactylifera
ref|XP_004976098.1|  PREDICTED: endoglucanase 12-like                   150   2e-38   Setaria italica
gb|AFR40587.1|  cellulase                                               140   4e-38   Populus nigra [black poplar]
gb|AID55392.1|  glycoside hydrolase family 9 A6                         149   1e-37   Gossypium hirsutum [American cotton]
ref|XP_003601506.1|  Endoglucanase                                      148   1e-37   Medicago truncatula
ref|XP_008791029.1|  PREDICTED: endoglucanase 12-like                   148   2e-37   Phoenix dactylifera
ref|NP_001288466.1|  endoglucanase 12-like                              147   3e-37   Zea mays [maize]
ref|XP_002446733.1|  hypothetical protein SORBIDRAFT_06g021440          147   4e-37   Sorghum bicolor [broomcorn]
gb|KJB49856.1|  hypothetical protein B456_008G141900                    146   5e-37   Gossypium raimondii
ref|XP_004152840.1|  PREDICTED: endoglucanase 7-like                    147   5e-37   Cucumis sativus [cucumbers]
emb|CDY39820.1|  BnaC02g42980D                                          146   6e-37   Brassica napus [oilseed rape]
ref|XP_004169320.1|  PREDICTED: endoglucanase 7-like                    147   6e-37   
ref|XP_009403795.1|  PREDICTED: endoglucanase 12-like                   146   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001288520.1|  uncharacterized protein LOC103641803               146   7e-37   Zea mays [maize]
ref|XP_006391540.1|  hypothetical protein EUTSA_v10018270mg             145   2e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010496067.1|  PREDICTED: endoglucanase 7                         145   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004976099.1|  PREDICTED: endoglucanase 12-like                   144   4e-36   Setaria italica
ref|XP_002961082.1|  hypothetical protein SELMODRAFT_75214              144   4e-36   
ref|NP_176738.1|  glycosyl hydrolase 9A2                                144   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127411.1|  PREDICTED: endoglucanase 7                         144   5e-36   Brassica rapa
gb|EAY94707.1|  hypothetical protein OsI_16485                          144   6e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_002966925.1|  hypothetical protein SELMODRAFT_408186             144   6e-36   
sp|Q7XUK4.2|GUN12_ORYSJ  RecName: Full=Endoglucanase 12; AltName:...    144   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010673848.1|  PREDICTED: endoglucanase 12-like                   143   8e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002888427.1|  hypothetical protein ARALYDRAFT_894138             143   9e-36   Arabidopsis lyrata subsp. lyrata
gb|EPS58029.1|  endo-1,4-beta-glucanase                                 143   1e-35   Genlisea aurea
gb|EYU39502.1|  hypothetical protein MIMGU_mgv1a002977mg                142   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_006300882.1|  hypothetical protein CARUB_v10019972mg             142   1e-35   Capsella rubella
emb|CDY29138.1|  BnaA09g53910D                                          142   2e-35   
gb|EMT22659.1|  Endoglucanase 12                                        139   2e-34   
ref|XP_003580066.1|  PREDICTED: endoglucanase 12                        138   8e-34   
gb|KFK41003.1|  hypothetical protein AALP_AA2G072700                    137   2e-33   
gb|AGG19084.1|  cellulase                                               136   2e-33   
emb|CDY16412.1|  BnaA02g12160D                                          135   3e-33   
ref|XP_006652472.1|  PREDICTED: endoglucanase 12-like                   135   5e-33   
dbj|BAH57006.1|  AT5G49720                                              134   8e-33   
ref|XP_001772986.1|  predicted protein                                  134   2e-32   
gb|EMT15171.1|  Endoglucanase 12                                        133   3e-32   
ref|XP_009407065.1|  PREDICTED: endoglucanase 25-like                   133   4e-32   
ref|XP_003610176.1|  Endo-1 4-beta-glucanase                            130   4e-32   
ref|XP_007137548.1|  hypothetical protein PHAVU_009G135900g             129   5e-31   
ref|XP_001759056.1|  predicted protein                                  129   8e-31   
ref|XP_011465378.1|  PREDICTED: endoglucanase 9-like isoform X2         128   1e-30   
ref|XP_004502591.1|  PREDICTED: endoglucanase 25-like                   128   2e-30   
ref|XP_004301819.1|  PREDICTED: endoglucanase 25-like isoform X1        127   4e-30   
ref|XP_002526151.1|  endo-1,4-beta-glucanase, putative                  127   5e-30   
emb|CAN59981.1|  hypothetical protein VITISV_016152                     118   7e-30   
ref|XP_010415102.1|  PREDICTED: endoglucanase 7-like                    126   1e-29   
gb|AAQ63883.1|  cellulase                                               126   1e-29   
gb|AES72416.2|  glycosyl hydrolase family 9 protein                     126   1e-29   
ref|XP_003602165.1|  Endoglucanase                                      125   2e-29   
ref|XP_001775325.1|  predicted protein                                  125   3e-29   
ref|XP_003527970.1|  PREDICTED: endoglucanase 25-like                   124   4e-29   
ref|XP_006858456.1|  hypothetical protein AMTR_s00071p00095020          124   5e-29   
gb|KHN23415.1|  Endoglucanase 25                                        123   1e-28   
ref|XP_008240312.1|  PREDICTED: endoglucanase 25-like                   122   3e-28   
ref|XP_009360182.1|  PREDICTED: endoglucanase 25-like                   122   3e-28   
gb|AID55391.1|  glycoside hydrolase family 9 A3                         122   4e-28   
emb|CDP18285.1|  unnamed protein product                                122   4e-28   
sp|P23666.1|GUN2_PERAE  RecName: Full=Endoglucanase 2; AltName: F...    114   6e-28   
ref|XP_001754846.1|  predicted protein                                  121   7e-28   
ref|XP_002278065.1|  PREDICTED: endoglucanase 25-like                   121   7e-28   
ref|XP_010999860.1|  PREDICTED: endoglucanase 9-like                    121   7e-28   
gb|KEH24407.1|  glycosyl hydrolase family 9 protein                     116   7e-28   
gb|ABK24648.1|  unknown                                                 120   1e-27   
gb|EYU36779.1|  hypothetical protein MIMGU_mgv1a004472mg                119   1e-27   
gb|AFK41115.1|  unknown                                                 114   2e-27   
gb|KDP36939.1|  hypothetical protein JCGZ_08230                         119   2e-27   
ref|XP_006340729.1|  PREDICTED: endoglucanase 2-like                    119   2e-27   
ref|XP_009610927.1|  PREDICTED: endoglucanase 2-like                    119   3e-27   
ref|XP_004510305.1|  PREDICTED: endoglucanase 1-like                    114   3e-27   
ref|XP_004298838.1|  PREDICTED: endoglucanase 20-like                   118   4e-27   
ref|XP_009783020.1|  PREDICTED: endoglucanase 2                         118   5e-27   
gb|KJB19224.1|  hypothetical protein B456_003G089600                    118   6e-27   
ref|XP_001763929.1|  predicted protein                                  119   6e-27   
gb|KJB19223.1|  hypothetical protein B456_003G089600                    118   6e-27   
ref|XP_004147421.1|  PREDICTED: endoglucanase 25-like                   118   7e-27   
ref|XP_004170784.1|  PREDICTED: endoglucanase 25-like                   118   7e-27   
ref|XP_010107239.1|  Endoglucanase 7                                    116   8e-27   
emb|CDY10895.1|  BnaC01g15100D                                          117   8e-27   
gb|KFK28905.1|  hypothetical protein AALP_AA7G063600                    117   1e-26   
ref|XP_007019419.1|  Endo-1,4-beta-glucanase, putative                  118   1e-26   
ref|XP_008786534.1|  PREDICTED: endoglucanase 10-like                   118   1e-26   
ref|XP_009137168.1|  PREDICTED: endoglucanase 20                        116   1e-26   
ref|XP_002510516.1|  endo-1,4-beta-glucanase, putative                  117   1e-26   
ref|XP_002509863.1|  endo-1,4-beta-glucanase, putative                  116   1e-26   
ref|XP_003601448.1|  Endo-1 4-beta-glucanase                            116   2e-26   
ref|XP_010676410.1|  PREDICTED: endoglucanase-like isoform X1           116   2e-26   
ref|XP_006413541.1|  hypothetical protein EUTSA_v10025071mg             116   2e-26   
ref|XP_007209103.1|  hypothetical protein PRUPE_ppa005285mg             115   2e-26   
gb|KJB43353.1|  hypothetical protein B456_007G195700                    116   2e-26   
gb|KDP25211.1|  hypothetical protein JCGZ_20367                         115   2e-26   
ref|XP_002975128.1|  hypothetical protein SELMODRAFT_415162             115   3e-26   
ref|XP_002977531.1|  hypothetical protein SELMODRAFT_417347             115   3e-26   
ref|XP_009592543.1|  PREDICTED: endoglucanase 17-like                   115   3e-26   
sp|P05522.1|GUN1_PERAE  RecName: Full=Endoglucanase 1; AltName: F...    115   4e-26   
ref|XP_009624009.1|  PREDICTED: endoglucanase 2-like                    115   4e-26   
ref|XP_006836842.1|  hypothetical protein AMTR_s00099p00070580          115   4e-26   
ref|XP_002300715.1|  glycosyl hydrolase family 9 family protein         115   5e-26   
gb|AGC94751.1|  endoglucanase-1,4-beta glucanase 6                      115   5e-26   
ref|XP_007017776.1|  EG isoform 2                                       115   6e-26   
gb|AID55372.1|  glycoside hydrolase family 9 B13                        114   6e-26   
ref|XP_008784873.1|  PREDICTED: endoglucanase 1-like                    114   7e-26   
gb|KHG04285.1|  Endoglucanase 1                                         114   7e-26   
gb|ABK96199.1|  unknown                                                 112   8e-26   
ref|XP_011074667.1|  PREDICTED: endoglucanase 10-like                   114   8e-26   
ref|XP_009788905.1|  PREDICTED: endoglucanase 17-like                   114   8e-26   
ref|XP_007017775.1|  EG isoform 1                                       114   8e-26   
ref|XP_010906451.1|  PREDICTED: endoglucanase 1-like                    114   8e-26   
ref|XP_007136082.1|  hypothetical protein PHAVU_009G016100g             114   8e-26   
dbj|BAL41418.1|  endo-1,4-beta-glucanase                                114   9e-26   
ref|XP_008238977.1|  PREDICTED: endoglucanase-like                      114   1e-25   
ref|XP_011028991.1|  PREDICTED: endoglucanase 2-like                    114   1e-25   
gb|KJB14408.1|  hypothetical protein B456_002G123700                    114   1e-25   
gb|AFW74700.1|  hypothetical protein ZEAMMB73_090741                    113   1e-25   
ref|XP_010676913.1|  PREDICTED: endoglucanase 1-like                    114   1e-25   
gb|AGG19097.1|  cellulase                                               113   1e-25   
emb|CDY29381.1|  BnaA06g14150D                                          114   1e-25   
ref|XP_003603741.1|  Endoglucanase                                      114   1e-25   
ref|XP_009149490.1|  PREDICTED: endoglucanase 2                         114   1e-25   
gb|AEO97190.1|  endo-1,4-beta-glucanase                                 114   1e-25   
gb|AES73992.2|  glycosyl hydrolase family 9 protein                     114   2e-25   
ref|XP_010064810.1|  PREDICTED: endoglucanase 25-like                   115   2e-25   
ref|NP_173423.1|  glycosyl hydrolase 9B5                                114   2e-25   
ref|XP_010459672.1|  PREDICTED: endoglucanase 2                         114   2e-25   
gb|KDO83647.1|  hypothetical protein CISIN_1g043321mg                   114   2e-25   
ref|XP_006383120.1|  hypothetical protein POPTR_0005s11750g             114   2e-25   
ref|XP_010112623.1|  hypothetical protein L484_006703                   113   2e-25   
emb|CDP07412.1|  unnamed protein product                                114   2e-25   
ref|XP_010477219.1|  PREDICTED: endoglucanase 2-like                    113   2e-25   
ref|XP_010100207.1|  Endoglucanase 1                                    113   2e-25   
ref|XP_004136389.1|  PREDICTED: endoglucanase 2-like                    114   2e-25   
ref|XP_007158534.1|  hypothetical protein PHAVU_002G160200g             113   2e-25   
ref|XP_009143046.1|  PREDICTED: endoglucanase 14-like                   113   2e-25   
emb|CDX74668.1|  BnaA05g04140D                                          113   2e-25   
gb|ABY58175.1|  endo-1,4-D-glucanase                                    111   2e-25   
dbj|BAA06877.1|  cellulase precursor                                    113   2e-25   
ref|XP_008466493.1|  PREDICTED: endoglucanase 10                        113   2e-25   
ref|XP_010501531.1|  PREDICTED: endoglucanase 2                         113   2e-25   
ref|XP_008650181.1|  PREDICTED: endoglucanase 14-like                   113   2e-25   
ref|XP_009343864.1|  PREDICTED: endoglucanase 20-like                   113   2e-25   
ref|XP_006307252.1|  hypothetical protein CARUB_v10008868mg             113   2e-25   
ref|XP_004232483.1|  PREDICTED: endoglucanase 2-like                    113   2e-25   
ref|XP_003521576.1|  PREDICTED: endoglucanase 17                        113   2e-25   
ref|XP_004509346.1|  PREDICTED: endoglucanase 10-like                   113   2e-25   
ref|XP_002440523.1|  hypothetical protein SORBIDRAFT_09g002490          113   2e-25   
ref|XP_009363387.1|  PREDICTED: endoglucanase 20-like                   113   2e-25   
gb|KJB18957.1|  hypothetical protein B456_003G077300                    113   2e-25   
gb|KHF97947.1|  hypothetical protein F383_10892                         113   2e-25   
ref|XP_004292399.2|  PREDICTED: endoglucanase 9-like                    113   2e-25   
ref|XP_003629333.1|  Endoglucanase                                      113   2e-25   
dbj|BAF42037.1|  cellulase2                                             113   3e-25   
ref|XP_002874585.1|  glycosyl hydrolase family 9 protein                112   3e-25   
gb|AFZ78635.1|  korrigan                                                112   3e-25   
ref|XP_010941260.1|  PREDICTED: endoglucanase 24-like                   113   3e-25   
gb|AID55377.1|  glycoside hydrolase family 9 B5                         113   3e-25   
ref|XP_006842476.1|  hypothetical protein AMTR_s00077p00078180          111   3e-25   
gb|ADU15552.1|  EG                                                      113   3e-25   
gb|KEH27425.1|  endo-1,4-beta-glucanase                                 111   3e-25   
emb|CDP04111.1|  unnamed protein product                                107   3e-25   
gb|KDP25379.1|  hypothetical protein JCGZ_20535                         112   3e-25   
gb|KDO76516.1|  hypothetical protein CISIN_1g006835mg                   111   3e-25   
ref|XP_004502058.1|  PREDICTED: endoglucanase 1-like                    112   3e-25   
ref|XP_006827988.1|  hypothetical protein AMTR_s00008p00230370          107   3e-25   
gb|KJB58121.1|  hypothetical protein B456_009G195400                    112   3e-25   
gb|KHN00484.1|  Endoglucanase 24                                        112   3e-25   
gb|KHN07637.1|  Endoglucanase 1                                         112   3e-25   
ref|XP_011026779.1|  PREDICTED: endoglucanase CX-like                   112   3e-25   
ref|XP_003527686.1|  PREDICTED: endoglucanase 10-like                   113   4e-25   
emb|CDP12234.1|  unnamed protein product                                112   4e-25   
ref|XP_011069683.1|  PREDICTED: endoglucanase 1-like                    112   4e-25   
gb|ABY58176.1|  endo-1,4-D-glucanase                                    110   4e-25   
ref|XP_004511554.1|  PREDICTED: endoglucanase-like                      113   4e-25   
ref|XP_010029690.1|  PREDICTED: endoglucanase 2-like                    113   4e-25   
gb|KJB63540.1|  hypothetical protein B456_010G005200                    112   4e-25   
ref|XP_003523541.1|  PREDICTED: endoglucanase 10                        113   4e-25   
dbj|BAA77239.1|  endo-1,4-beta glucanase                                112   4e-25   
ref|XP_008799407.1|  PREDICTED: endoglucanase 24-like                   112   4e-25   
gb|AID55379.1|  glycoside hydrolase family 9 B7                         112   4e-25   
ref|XP_002523114.1|  endo-1,4-beta-glucanase, putative                  112   4e-25   
ref|XP_003552557.1|  PREDICTED: endoglucanase 1                         112   4e-25   
gb|KCW56649.1|  hypothetical protein EUGRSUZ_I02356                     112   4e-25   
ref|XP_006435157.1|  hypothetical protein CICLE_v10000849mg             112   4e-25   
ref|XP_006473639.1|  PREDICTED: endoglucanase 10-like                   112   4e-25   
gb|KEH21214.1|  endo-1,4-beta-glucanase                                 112   4e-25   
gb|KDO84820.1|  hypothetical protein CISIN_1g009846mg                   112   4e-25   
ref|XP_010112045.1|  Endoglucanase 9                                    112   4e-25   
ref|XP_002982868.1|  hypothetical protein SELMODRAFT_117027             112   4e-25   
gb|ABD62082.1|  endo-1,4-beta-glucancase precursor                      112   4e-25   
gb|EYU19432.1|  hypothetical protein MIMGU_mgv1a005008mg                112   4e-25   
ref|XP_010445170.1|  PREDICTED: endoglucanase 20-like                   112   4e-25   
gb|EPS65630.1|  hypothetical protein M569_09145                         112   4e-25   
ref|XP_006466419.1|  PREDICTED: endoglucanase 2-like                    113   4e-25   
ref|XP_009335173.1|  PREDICTED: endoglucanase 2-like                    112   4e-25   
gb|KDP25304.1|  hypothetical protein JCGZ_20460                         112   4e-25   
ref|XP_009393121.1|  PREDICTED: endoglucanase 1-like                    112   4e-25   
ref|XP_009405235.1|  PREDICTED: endoglucanase 13-like                   112   4e-25   
gb|KDO76515.1|  hypothetical protein CISIN_1g006835mg                   111   4e-25   
ref|XP_004495939.1|  PREDICTED: endoglucanase 17-like                   112   4e-25   
ref|XP_003519870.1|  PREDICTED: endoglucanase 24-like                   112   4e-25   
gb|KFK44119.1|  hypothetical protein AALP_AA1G218000                    112   5e-25   
ref|XP_009360195.1|  PREDICTED: endoglucanase CX-like                   112   5e-25   
ref|XP_002990970.1|  hypothetical protein SELMODRAFT_132689             112   5e-25   
ref|XP_008374126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    112   5e-25   
gb|KJB58119.1|  hypothetical protein B456_009G195400                    111   5e-25   
ref|XP_006286136.1|  hypothetical protein CARUB_v10007690mg             112   5e-25   
ref|XP_004238345.1|  PREDICTED: endoglucanase 2-like                    112   5e-25   
gb|ABY58190.1|  endo-1,4-D-glucanase                                    109   5e-25   
gb|KHN30675.1|  Endoglucanase 17                                        111   5e-25   
ref|XP_008792937.1|  PREDICTED: endoglucanase 15-like                   111   6e-25   
gb|KDP46724.1|  hypothetical protein JCGZ_06512                         112   6e-25   
ref|XP_010667385.1|  PREDICTED: endoglucanase 2-like                    112   6e-25   
ref|XP_009403726.1|  PREDICTED: endoglucanase 9-like isoform X1         111   6e-25   
ref|XP_010061046.1|  PREDICTED: endoglucanase 10-like                   112   6e-25   
gb|KHN45917.1|  Endoglucanase 2                                         112   6e-25   
emb|CDP12078.1|  unnamed protein product                                112   6e-25   
gb|ABY58177.1|  endo-1,4-D-glucanase                                    109   6e-25   
ref|XP_002299423.1|  hypothetical protein POPTR_0001s11430g             112   6e-25   
gb|ABY58189.1|  endo-1,4-D-glucanase                                    109   6e-25   
ref|XP_003611058.1|  Endo-1 4-beta-glucanase                            111   6e-25   
ref|XP_006653871.1|  PREDICTED: endoglucanase 13-like                   113   6e-25   
gb|KDP28191.1|  hypothetical protein JCGZ_13962                         112   6e-25   
ref|XP_004149748.1|  PREDICTED: endoglucanase 6-like                    113   6e-25   
ref|XP_011041962.1|  PREDICTED: endoglucanase 17                        112   6e-25   
gb|AAL30455.1|AF362950_1  endo-beta-1,4-glucanase precursor             110   6e-25   
ref|NP_001234882.1|  endo-1,4-beta-glucanase precursor                  112   7e-25   
ref|XP_009403727.1|  PREDICTED: endoglucanase 9-like isoform X2         111   7e-25   
ref|XP_002893081.1|  glycosyl hydrolase family 9 protein                112   7e-25   
ref|XP_002320998.1|  endo-1 family protein                              112   7e-25   
dbj|BAB39482.1|  endo-1,4-beta glucanase                                111   8e-25   
ref|NP_194087.1|  glycosyl hydrolase 9B15                               111   8e-25   
ref|XP_009589429.1|  PREDICTED: endoglucanase 11-like                   112   8e-25   
gb|KDO76514.1|  hypothetical protein CISIN_1g006835mg                   111   8e-25   
ref|XP_010433888.1|  PREDICTED: endoglucanase 20-like                   111   8e-25   
ref|XP_007050983.1|  Glycosyl hydrolase 9B13                            112   8e-25   
gb|KEH21213.1|  endo-1,4-beta-glucanase                                 112   8e-25   
ref|XP_006416450.1|  hypothetical protein EUTSA_v10007364mg             112   8e-25   
pir||JA0174  cellulase (EC 3.2.1.4) - kidney bean (fragment)            106   9e-25   
emb|CAA52343.1|  cellulase                                              111   9e-25   
ref|XP_006342034.1|  PREDICTED: endoglucanase 10-like                   112   9e-25   
ref|XP_003536878.1|  PREDICTED: endoglucanase 17-like                   111   9e-25   
gb|KEH27424.1|  endo-1,4-beta-glucanase                                 110   9e-25   
ref|XP_007163509.1|  hypothetical protein PHAVU_001G239900g             111   1e-24   
ref|XP_006359861.1|  PREDICTED: endoglucanase 17-like                   111   1e-24   
gb|AAC78504.1|  cellulase                                               111   1e-24   
gb|KJB58120.1|  hypothetical protein B456_009G195400                    111   1e-24   
ref|XP_010113364.1|  Endoglucanase 24                                   112   1e-24   
ref|XP_008387935.1|  PREDICTED: endoglucanase 2                         111   1e-24   
ref|XP_010448686.1|  PREDICTED: endoglucanase 20                        111   1e-24   



>emb|CAF18445.1| endo-1,4-beta-D-glucanase KORRIGAN [Pisum sativum]
Length=229

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGASIPK KV+YNCKGGWKWRD+ 
Sbjct  96   LREFARTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKTKVKYNCKGGWKWRDTS  155

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNILVGAMVAGPD HDGFHDVR+NYNYTEPTLAGNAGLVAALVALSG++S  IDKNT
Sbjct  156  KPNPNILVGAMVAGPDRHDGFHDVRSNYNYTEPTLAGNAGLVAALVALSGDKSIPIDKNT  215

Query  359  IFSAV  345
            +FSAV
Sbjct  216  LFSAV  220



>gb|AID55380.1| glycoside hydrolase family 9 A2 [Gossypium hirsutum]
Length=621

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++Q+DYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRDSK
Sbjct  481  LREFAKTQMDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDSK  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ST IDKNT
Sbjct  541  KPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSTGIDKNT  600

Query  359  IFSAV  345
            IFSAV
Sbjct  601  IFSAV  605



>gb|KJB70736.1| hypothetical protein B456_011G089500 [Gossypium raimondii]
Length=621

 Score =   215 bits (548),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++Q+DYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRDSK
Sbjct  481  LREFAKTQMDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDSK  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ST IDKNT
Sbjct  541  KPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSTGIDKNT  600

Query  359  IFSAV  345
            IFSAV
Sbjct  601  IFSAV  605



>gb|KDP32467.1| hypothetical protein JCGZ_13392 [Jatropha curcas]
Length=620

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRDSK
Sbjct  480  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDSK  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++TRIDKNT
Sbjct  540  KPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTRIDKNT  599

Query  359  IFSAV  345
            IFSAV
Sbjct  600  IFSAV  604



>gb|AAZ08322.1| endo-1,4-beta-glucanase [Eucalyptus globulus]
Length=456

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA+ QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRD+ 
Sbjct  316  LRDFAKRQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDTS  375

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ S +IDKNT
Sbjct  376  KPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDGSAKIDKNT  435

Query  359  IFSAV  345
            IFSAV
Sbjct  436  IFSAV  440



>ref|XP_007147545.1| hypothetical protein PHAVU_006G133700g [Phaseolus vulgaris]
 gb|ESW19539.1| hypothetical protein PHAVU_006G133700g [Phaseolus vulgaris]
Length=619

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRDS 
Sbjct  479  LRNFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDSS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSG++ST IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGDKSTSIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|ADB82903.1| membrane-bound endo-beta-1,4-glucanase [Populus alba x Populus 
grandidentata]
Length=619

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDGHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>emb|CBI29606.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSY+ GFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRDS 
Sbjct  361  LREFAKTQIDYILGKNPRKMSYIAGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSS  420

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  421  KPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNT  480

Query  359  IFSAV  345
            IFSAV
Sbjct  481  IFSAV  485



>gb|AHA41508.1| endo-1,4 -beta-glucanase [Populus deltoides]
Length=619

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>ref|XP_006385837.1| endo-1 family protein [Populus trichocarpa]
 gb|ERP63634.1| endo-1 family protein [Populus trichocarpa]
Length=619

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|AAT75041.1| Cel9A [Populus tremula x Populus tremuloides]
Length=619

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|AAS45400.1| endo-1,4-beta-glucanase [Populus tremuloides]
Length=619

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>ref|XP_003546229.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=618

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA++QIDYILG NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ 
Sbjct  478  LRNFAKTQIDYILGNNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTS  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ST IDKNT
Sbjct  538  KPNPNTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSTSIDKNT  597

Query  359  IFSAV  345
            IFSAV
Sbjct  598  IFSAV  602



>ref|XP_011022354.1| PREDICTED: endoglucanase 25-like [Populus euphratica]
Length=619

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNKVRYNCKGGWKWRD+ 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKVRYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVR+NYNYTEPT+AGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDRHDGFHDVRSNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>ref|XP_002519394.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF43011.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=621

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  481  LRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ +T+IDKNT
Sbjct  541  KPNPNTIVGAMVAGPDRHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDGTTKIDKNT  600

Query  359  IFSAV  345
            IFSAV
Sbjct  601  IFSAV  605



>ref|XP_010065200.1| PREDICTED: endoglucanase 25-like [Eucalyptus grandis]
 gb|KCW62542.1| hypothetical protein EUGRSUZ_G00035 [Eucalyptus grandis]
Length=623

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA+ QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRD+ 
Sbjct  483  LRDFAKRQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDTS  542

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ S +IDKNT
Sbjct  543  KPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDGSAKIDKNT  602

Query  359  IFSAV  345
            IFSAV
Sbjct  603  IFSAV  607



>gb|KHN14382.1| Endoglucanase 25 [Glycine soja]
Length=652

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA++QIDYILG NPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ 
Sbjct  512  LRNFAKTQIDYILGNNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTS  571

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ST IDKNT
Sbjct  572  KPNPNTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSTSIDKNT  631

Query  359  IFSAV  345
            IFSAV
Sbjct  632  IFSAV  636



>ref|XP_002299405.1| endo-1 family protein [Populus trichocarpa]
 gb|EEE84210.1| endo-1 family protein [Populus trichocarpa]
Length=619

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTT  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|AFY03622.1| endo-1,4-beta-glucanase [Eucalyptus globulus]
Length=623

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA+ QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRD+ 
Sbjct  483  LRDFAKRQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDTS  542

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+   +IDKNT
Sbjct  543  KPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDGXAKIDKNT  602

Query  359  IFSAV  345
            IFSAV
Sbjct  603  IFSAV  607



>ref|XP_004238641.1| PREDICTED: endoglucanase 25-like [Solanum lycopersicum]
Length=616

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPK VHHRGAS+PKNKV+YNCKGGWKWRDS 
Sbjct  476  LREFAQTQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGASVPKNKVKYNCKGGWKWRDSS  535

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNILVGAMVAGPD +DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++S  IDKNT
Sbjct  536  KPNPNILVGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNT  595

Query  359  IFSAV  345
            IFSAV
Sbjct  596  IFSAV  600



>gb|ADY68792.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium herbaceum 
subsp. africanum]
Length=619

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|KJB66548.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=618

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  478  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  538  KPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNT  597

Query  359  IFSAV  345
            IFSAV
Sbjct  598  IFSAV  602



>gb|AAS87601.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|ADY68790.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium barbadense]
 gb|AEN70799.1| endo-1,4-beta-glucanase [Gossypium mustelinum]
 gb|AEN70801.1| endo-1,4-beta-glucanase [Gossypium darwinii]
 gb|AEN70805.1| endo-1,4-beta-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEN70807.1| endo-1,4-beta-glucanase [Gossypium barbadense var. peruvianum]
Length=619

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|AAP83128.1| endo-1,4-beta-glucanase [Gossypium hirsutum]
Length=619

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|ADY68794.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
Length=619

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|AEN70798.1| endo-1,4-beta-glucanase [Gossypium turneri]
 gb|AEN70811.1| endo-1,4-beta-glucanase [Gossypium armourianum]
 gb|AEN70812.1| endo-1,4-beta-glucanase [Gossypium harknessii]
Length=619

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|AAQ08018.1| endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|ADY68793.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium raimondii]
 gb|ADY68795.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|AEN70795.1| endo-1,4-beta-glucanase [Gossypium thurberi]
 gb|AEN70796.1| endo-1,4-beta-glucanase [Gossypium laxum]
 gb|AEN70800.1| endo-1,4-beta-glucanase [Gossypium mustelinum]
 gb|AEN70813.1| endo-1,4-beta-glucanase [Gossypium davidsonii]
 gb|AEN70814.1| endo-1,4-beta-glucanase [Gossypium klotzschianum]
 gb|AEN70815.1| endo-1,4-beta-glucanase [Gossypium aridum]
 gb|AEN70817.1| endo-1,4-beta-glucanase [Gossypium lobatum]
 gb|AEN70818.1| endo-1,4-beta-glucanase [Gossypium trilobum]
 gb|AID55374.1| glycoside hydrolase family 9 A1 [Gossypium hirsutum]
 gb|KJB66547.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=619

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|AEN70816.1| endo-1,4-beta-glucanase [Gossypium gossypioides]
Length=619

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|ABD62083.1| endo-1,4-beta-glucancase precursor [Glycine max]
Length=604

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA+SQIDYILG NPRKMSYVVGFGNHYPKHVHHRGAS+PKNK++Y+CKGGWKWRD+ 
Sbjct  478  LRSFAKSQIDYILGNNPRKMSYVVGFGNHYPKHVHHRGASVPKNKIKYSCKGGWKWRDTS  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ T IDKNT
Sbjct  538  KPNPNTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKGTSIDKNT  597

Query  359  IFSAV  345
            IFSAV
Sbjct  598  IFSAV  602



>ref|XP_003535026.1| PREDICTED: endoglucanase 25 [Glycine max]
 gb|KHN40745.1| Endoglucanase 25 [Glycine soja]
Length=618

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA+SQIDYILG NPRKMSYVVGFGNHYPKHVHHRGAS+PKNK++Y+CKGGWKWRD+ 
Sbjct  478  LRSFAKSQIDYILGNNPRKMSYVVGFGNHYPKHVHHRGASVPKNKIKYSCKGGWKWRDTS  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ T IDKNT
Sbjct  538  KPNPNTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKGTSIDKNT  597

Query  359  IFSAV  345
            IFSAV
Sbjct  598  IFSAV  602



>gb|AGV22123.1| endo-1,4-beta-glucanase 1 [Betula luminifera]
Length=618

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNPRKMSYVVGFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRDS 
Sbjct  478  LREFARTQIDYILGKNPRKMSYVVGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSS  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ +T IDKNT
Sbjct  538  NPNPNTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDSTTGIDKNT  597

Query  359  IFSAV  345
            IFSAV
Sbjct  598  IFSAV  602



>gb|KDO53876.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=441

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGASIPKNK+RYNCKGGWK RDS 
Sbjct  300  LREFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKLRDSS  359

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERS-TRIDKN  363
            KPNPN LVGA+VAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE+S T IDKN
Sbjct  360  KPNPNTLVGALVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKSRTTIDKN  419

Query  362  TIFSAV  345
            TIFSAV
Sbjct  420  TIFSAV  425



>gb|AEN70810.1| endo-1,4-beta-glucanase [Gossypium hirsutum subsp. latifolium]
Length=619

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNKLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|AEN70809.1| endo-1,4-beta-glucanase [Gossypium hirsutum subsp. latifolium]
Length=619

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNKLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATVIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>ref|XP_002266927.3| PREDICTED: endoglucanase 25 [Vitis vinifera]
Length=1061

 Score =   211 bits (538),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSY+ GFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRDS 
Sbjct  478  LREFAKTQIDYILGKNPRKMSYIAGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSS  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  538  KPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNT  597

Query  359  IFSAV  345
            IFSAV
Sbjct  598  IFSAV  602



>gb|ADY68791.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium barbadense]
 gb|AEN70802.1| endo-1,4-beta-glucanase [Gossypium darwinii]
 gb|AEN70803.1| endo-1,4-beta-glucanase [Gossypium tomentosum]
 gb|AEN70804.1| endo-1,4-beta-glucanase [Gossypium tomentosum]
 gb|AEN70806.1| endo-1,4-beta-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEN70808.1| endo-1,4-beta-glucanase [Gossypium barbadense var. peruvianum]
Length=619

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRK+SYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKLSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>ref|XP_009770880.1| PREDICTED: endoglucanase 25-like [Nicotiana sylvestris]
Length=619

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FAE+QIDYILGKNPRKMSYVVGFGNHYPK VHHRGASIPKNKV+YNCKGGWKWRDS 
Sbjct  479  LRRFAETQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGASIPKNKVKYNCKGGWKWRDSS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPNI+VGAMVAGPD HDGFHDVR+NYNYTEPTLAGNAGLVAALVALSG+R   +DKNT
Sbjct  539  KANPNIIVGAMVAGPDKHDGFHDVRSNYNYTEPTLAGNAGLVAALVALSGDRDIGVDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>ref|XP_006356407.1| PREDICTED: endoglucanase 25-like [Solanum tuberosum]
Length=616

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPK VHHRGAS+PKNKV+YNCKGGWKWRDS 
Sbjct  476  LREFAQTQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGASVPKNKVKYNCKGGWKWRDSS  535

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD +DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++S  IDKNT
Sbjct  536  KPNPNTLVGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNT  595

Query  359  IFSAV  345
            IFSAV
Sbjct  596  IFSAV  600



>ref|XP_009600540.1| PREDICTED: endoglucanase 25-like [Nicotiana tomentosiformis]
Length=617

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FAE+QIDYILGKNPRKMSYVVGFGNHYPK VHHRGASIPKNKV+YNCKGGWKWRDS 
Sbjct  477  LRRFAETQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGASIPKNKVKYNCKGGWKWRDSS  536

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPNI+VGAMVAGPD HDGFHDVR+NYNYTEPTLAGNAGLVAALVALSG+R   +DKNT
Sbjct  537  KANPNIIVGAMVAGPDKHDGFHDVRSNYNYTEPTLAGNAGLVAALVALSGDRDVGVDKNT  596

Query  359  IFSAV  345
            IFSAV
Sbjct  597  IFSAV  601



>gb|AFD33696.1| korrigan [Eucalyptus camaldulensis]
Length=623

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA+ QIDYILGKNPRKMSY+VGFGNHYP+ VHHRGASIPKNKV+YNCKGGWKWRD+ 
Sbjct  483  LRDFAKRQIDYILGKNPRKMSYIVGFGNHYPRRVHHRGASIPKNKVKYNCKGGWKWRDTS  542

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ S +IDKNT
Sbjct  543  KPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDGSAKIDKNT  602

Query  359  IFSAV  345
            IFSAV
Sbjct  603  IFSAV  607



>ref|XP_003529689.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=619

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRDS 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDSS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ +VGAMVAGPD HD FHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPHTIVGAMVAGPDKHDHFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNT  598

Query  359  IFSAV  345
            +FSAV
Sbjct  599  LFSAV  603



>ref|XP_003594425.1| Endoglucanase [Medicago truncatula]
 gb|ABD32918.1| Glycoside transferase, six-hairpin, subgroup [Medicago truncatula]
 gb|AES64676.1| membrane-anchored endo-1,4-beta-glucanase [Medicago truncatula]
Length=622

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNPRKMSYVVGFGNHYPKHVHHR ASIPKNKV+YNCKGGWKWR+S 
Sbjct  482  LREFARTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRAASIPKNKVKYNCKGGWKWRESS  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNILVGAMVAGPD HDGFHDVR NYNYTEPTLAGNAGLVAALVALSG++S  IDKNT
Sbjct  542  KPNPNILVGAMVAGPDRHDGFHDVRKNYNYTEPTLAGNAGLVAALVALSGDKSIPIDKNT  601

Query  359  IFSAV  345
            +FSAV
Sbjct  602  LFSAV  606



>gb|AEN70797.1| endo-1,4-beta-glucanase [Gossypium schwendimanii]
Length=619

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HD F DVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPNTLVGAMVAGPDKHDAFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKATGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|AFR40585.1| cellulase, partial [Populus nigra]
 gb|AFR40590.1| cellulase, partial [Populus nigra]
 gb|AFR40592.1| cellulase, partial [Populus nigra]
 gb|AFR40593.1| cellulase, partial [Populus nigra]
Length=131

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            YILGKNPRK+SYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKISYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            MVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_011088109.1| PREDICTED: endoglucanase 25-like [Sesamum indicum]
Length=596

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QI+YILGKNPRKMSYVVGFGNHYPK VHHRGASIPKNKV+YNCKGGWKWRDS 
Sbjct  456  LREFAQTQINYILGKNPRKMSYVVGFGNHYPKRVHHRGASIPKNKVKYNCKGGWKWRDSS  515

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ S  IDKNT
Sbjct  516  KPNPNTIVGAMVAGPDRHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDSSVGIDKNT  575

Query  359  IFSAV  345
            IFSAV
Sbjct  576  IFSAV  580



>gb|AFR40584.1| cellulase, partial [Populus nigra]
Length=131

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            YILGKNPRK+SYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKISYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTMKPNPNTLVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            MVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_003550680.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=619

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRDS 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDSS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ +VGAMVAGPD HD FHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT
Sbjct  539  KPNPHTIVGAMVAGPDKHDHFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNT  598

Query  359  IFSAV  345
            +FSAV
Sbjct  599  LFSAV  603



>ref|XP_004171003.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25-like [Cucumis 
sativus]
Length=622

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 120/128 (94%), Gaps = 3/128 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRD+ 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDTT  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG---ERSTRID  369
            KPNPN LVGAMVAGPD  DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG   E++T ID
Sbjct  539  KPNPNTLVGAMVAGPDKRDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGENSEKATGID  598

Query  368  KNTIFSAV  345
            KNTIFSAV
Sbjct  599  KNTIFSAV  606



>ref|XP_004133745.1| PREDICTED: endoglucanase 25-like [Cucumis sativus]
 gb|KGN56301.1| hypothetical protein Csa_3G113920 [Cucumis sativus]
Length=622

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/128 (88%), Positives = 120/128 (94%), Gaps = 3/128 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRD+ 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDTT  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG---ERSTRID  369
            KPNPN LVGAMVAGPD  DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG   E++T ID
Sbjct  539  KPNPNTLVGAMVAGPDKRDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGENSEKATGID  598

Query  368  KNTIFSAV  345
            KNTIFSAV
Sbjct  599  KNTIFSAV  606



>ref|XP_007154086.1| hypothetical protein PHAVU_003G089600g [Phaseolus vulgaris]
 gb|ESW26080.1| hypothetical protein PHAVU_003G089600g [Phaseolus vulgaris]
Length=620

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHR ASIPKNK++YNCKGGWKWRD+ 
Sbjct  480  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRAASIPKNKIKYNCKGGWKWRDTS  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++S+ IDKNT
Sbjct  540  KPNPHTIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSSGIDKNT  599

Query  359  IFSAV  345
            +FSAV
Sbjct  600  LFSAV  604



>ref|XP_004486415.1| PREDICTED: endoglucanase 25-like [Cicer arietinum]
Length=620

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSY+VGFGN+YPKHVHHRGASIPKNKV+YNCKGGWKWRD+ 
Sbjct  480  LREFAKTQIDYILGKNPRKMSYIVGFGNNYPKHVHHRGASIPKNKVKYNCKGGWKWRDTS  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGFHDVR NYNYTEPTLAGNAGLVAALVALSG+RS  IDKNT
Sbjct  540  KPNPNTIVGAMVAGPDRHDGFHDVRMNYNYTEPTLAGNAGLVAALVALSGDRSIPIDKNT  599

Query  359  IFSAV  345
            +FSAV
Sbjct  600  LFSAV  604



>ref|NP_001284449.1| endoglucanase 25-like [Cucumis melo]
 dbj|BAF30815.1| endoglucanase [Cucumis melo]
Length=622

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 120/128 (94%), Gaps = 3/128 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  479  LRDFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTT  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG---ERSTRID  369
            KPNPN LVGAMVAGPD  DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG   E++T ID
Sbjct  539  KPNPNTLVGAMVAGPDRRDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGENSEKATGID  598

Query  368  KNTIFSAV  345
            KNTIFSAV
Sbjct  599  KNTIFSAV  606



>gb|AFR40563.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40564.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40565.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40566.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40567.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40568.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40569.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40570.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40571.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40572.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40573.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40574.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40575.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40576.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40577.1| cellulase, partial [Populus trichocarpa]
Length=131

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            MVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AIE16186.1| endo-1,4-beta-glucanase [Nicotiana tabacum]
Length=617

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FAE+QIDYILGKNPRKMSYVVGFGNHYPK VHHRGASIPKNKV+YNCKGGWKWRDS 
Sbjct  477  LRRFAETQIDYILGKNPRKMSYVVGFGNHYPKRVHHRGASIPKNKVKYNCKGGWKWRDSS  536

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPNI+VGAMVAGPD HDGFHD R+NYNYTEPTLAGNAGLVAALVALSG+R   +DKNT
Sbjct  537  KANPNIIVGAMVAGPDKHDGFHDARSNYNYTEPTLAGNAGLVAALVALSGDRDVGVDKNT  596

Query  359  IFSAV  345
            IFSAV
Sbjct  597  IFSAV  601



>ref|XP_011026717.1| PREDICTED: endoglucanase 25-like isoform X3 [Populus euphratica]
Length=1093

 Score =   209 bits (532),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNKVRYNCKGGWKWRD+ 
Sbjct  480  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKVRYNCKGGWKWRDTT  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN LVGAMVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVA SG+++T IDKNT
Sbjct  540  KPNPNSLVGAMVAGPDRHDGFRDVRTNYNYTEPTIAGNAGLVAALVASSGDKTTGIDKNT  599

Query  359  IFSA  348
            IFSA
Sbjct  600  IFSA  603



>gb|AEO97184.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97211.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=610

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  713  NFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKP  534
            NF  + IDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KP
Sbjct  472  NFYSTDIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKP  531

Query  533  NPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIF  354
            NPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIF
Sbjct  532  NPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIF  591

Query  353  SAV  345
            SAV
Sbjct  592  SAV  594



>ref|XP_010533226.1| PREDICTED: endoglucanase 25 [Tarenaya hassleriana]
Length=622

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQIDY+LGKNPRKMSYVVGFG+ YPKHVHHRGASIPKNK+RYNCKGGWKWRDSK
Sbjct  481  LREFARSQIDYVLGKNPRKMSYVVGFGDRYPKHVHHRGASIPKNKIRYNCKGGWKWRDSK  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER-STRIDKN  363
            KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++ S  IDKN
Sbjct  541  KPNPNTVVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKDSGSIDKN  600

Query  362  TIFSAV  345
            TIFSAV
Sbjct  601  TIFSAV  606



>ref|XP_010088712.1| Endoglucanase 25 [Morus notabilis]
 gb|EXB36893.1| Endoglucanase 25 [Morus notabilis]
Length=622

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QI+YILG NPRKMSY+VGFGNHYPKHVHHRGASIPKNK++YNCKGGW WRD+K
Sbjct  482  LRDFAKTQINYILGNNPRKMSYIVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWHWRDTK  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN++VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAAL+ALSGE++  IDKNT
Sbjct  542  NPNPNVIVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALIALSGEKNAGIDKNT  601

Query  359  IFSAV  345
            IFSAV
Sbjct  602  IFSAV  606



>gb|AEO97182.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97209.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97236.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97237.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97242.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97246.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97249.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97253.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97255.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97257.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97260.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97261.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97262.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97264.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97268.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97271.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97273.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97274.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AFZ78626.1| korrigan [Populus tomentosa]
Length=610

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  713  NFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKP  534
            NF  + IDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KP
Sbjct  472  NFYSTDIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKP  531

Query  533  NPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIF  354
            NPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIF
Sbjct  532  NPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIF  591

Query  353  SAV  345
            SAV
Sbjct  592  SAV  594



>gb|AEO97265.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  713  NFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKP  534
            NF  + IDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KP
Sbjct  472  NFYSTDIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKP  531

Query  533  NPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIF  354
            NPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIF
Sbjct  532  NPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIF  591

Query  353  SAV  345
            SAV
Sbjct  592  SAV  594



>ref|XP_006431347.1| hypothetical protein CICLE_v10000600mg [Citrus clementina]
 ref|XP_006470776.1| PREDICTED: endoglucanase 25-like [Citrus sinensis]
 gb|ESR44587.1| hypothetical protein CICLE_v10000600mg [Citrus clementina]
 gb|KDO53874.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=621

 Score =   204 bits (520),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGASIPKNK+RYNCKGGWK RDS 
Sbjct  480  LREFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKLRDSS  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERS-TRIDKN  363
            KPNPN LVGA+VAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE+S T IDKN
Sbjct  540  KPNPNTLVGALVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKSRTTIDKN  599

Query  362  TIFSAV  345
            TIFSAV
Sbjct  600  TIFSAV  605



>gb|KDO53875.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=620

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSY+VGFGNHYPKHVHHRGASIPKNK+RYNCKGGWK RDS 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKLRDSS  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERS-TRIDKN  363
            KPNPN LVGA+VAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE+S T IDKN
Sbjct  539  KPNPNTLVGALVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKSRTTIDKN  598

Query  362  TIFSAV  345
            TIFSAV
Sbjct  599  TIFSAV  604



>gb|AEO97239.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97240.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97241.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97243.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97244.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97245.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97247.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97248.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97250.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97251.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97254.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97256.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97258.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97259.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97263.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97266.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97269.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97270.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97272.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  713  NFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKP  534
            NF  + IDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KP
Sbjct  472  NFYSTDIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKP  531

Query  533  NPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIF  354
            NPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIF
Sbjct  532  NPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIF  591

Query  353  SAV  345
            SAV
Sbjct  592  SAV  594



>gb|AEO97252.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97267.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  713  NFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKP  534
            NF  + IDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KP
Sbjct  472  NFYSTDIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKP  531

Query  533  NPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIF  354
            NPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIF
Sbjct  532  NPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIF  591

Query  353  SAV  345
            SAV
Sbjct  592  SAV  594



>ref|XP_011092233.1| PREDICTED: endoglucanase 25-like [Sesamum indicum]
Length=617

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++Q++YILGKNPRKMSYVVGFGNHYPK VHHRGAS+PKNKV+YNCKGGWKWRD+ 
Sbjct  477  LREFAQTQMNYILGKNPRKMSYVVGFGNHYPKRVHHRGASVPKNKVKYNCKGGWKWRDTS  536

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ S  IDKNT
Sbjct  537  KPNPNTIVGAMVAGPDRHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDTSMTIDKNT  596

Query  359  IFSAV  345
            IFSAV
Sbjct  597  IFSAV  601



>gb|AEO97238.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -3

Query  713  NFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKP  534
            NF  + IDYILGKNPRKMSY+VGFGNHYPKH+HHRGASIPKNK+RYNCKGGWKWRD+ KP
Sbjct  472  NFYSTDIDYILGKNPRKMSYIVGFGNHYPKHLHHRGASIPKNKIRYNCKGGWKWRDTSKP  531

Query  533  NPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIF  354
            NPN LVGAMVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIF
Sbjct  532  NPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIF  591

Query  353  SAV  345
            SAV
Sbjct  592  SAV  594



>gb|AFR40589.1| cellulase, partial [Populus nigra]
Length=131

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            YILGKNPRK+ YVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKIXYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTXKPNPNTLVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            MVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AFR40578.1| cellulase, partial [Populus fremontii]
 gb|AFR40579.1| cellulase, partial [Populus fremontii]
 gb|AFR40580.1| cellulase, partial [Populus fremontii]
Length=131

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            MVAGPD HDGF DVR NYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFRDVRANYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>emb|CDP17765.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FAESQIDYILGKNPRKMSYVVGFGNHYP+ VHHRGASIPKNK++YNCKGGWK RDS+
Sbjct  476  LRQFAESQIDYILGKNPRKMSYVVGFGNHYPRRVHHRGASIPKNKIKYNCKGGWKLRDSR  535

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN LVGAMVAGPD  DGFHDVRTNYNYTEPTLAGNAGLVAALVALSGE+S  +DKNT
Sbjct  536  NPNPNTLVGAMVAGPDKFDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGEKSVGVDKNT  595

Query  359  IFSAV  345
            IFSAV
Sbjct  596  IFSAV  600



>gb|AEO97185.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97212.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=610

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  713  NFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKP  534
            NF  + IDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KP
Sbjct  472  NFYSTDIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKP  531

Query  533  NPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIF  354
            NPN LVGAMVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIF
Sbjct  532  NPNTLVGAMVAGPDRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIF  591

Query  353  SAV  345
            SAV
Sbjct  592  SAV  594



>gb|AFR40581.1| cellulase, partial [Populus fremontii]
Length=131

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            MVAGPD HDGF DVR NYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFRDVRXNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>gb|AEO97183.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97210.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97275.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97276.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97277.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97278.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97279.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97280.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97281.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97282.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97284.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97285.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97286.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97287.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97289.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97290.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97293.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97295.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97296.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97298.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97301.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97304.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97307.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97311.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97312.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97313.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AFZ78627.1| korrigan [Populus tomentosa]
Length=610

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  713  NFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKP  534
            NF  + IDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KP
Sbjct  472  NFYSTDIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKP  531

Query  533  NPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIF  354
            NPN LVGAMVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIF
Sbjct  532  NPNTLVGAMVAGPDRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIF  591

Query  353  SAV  345
            SAV
Sbjct  592  SAV  594



>gb|AFR40588.1| cellulase, partial [Populus nigra]
Length=131

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            YILGKNPRK  YVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKXXYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            MVAGPD HDGFHDVRTNYNYTEPT+AGNAGLV ALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVXALVALSGDKTTGIDKNTIFSAV  115



>gb|AEO97283.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97288.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97291.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97292.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97294.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97297.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97299.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97300.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97302.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97303.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97305.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97306.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97308.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97309.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97310.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  713  NFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKP  534
            NF  + IDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KP
Sbjct  472  NFYSTDIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTTKP  531

Query  533  NPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIF  354
            NPN LVGAMVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIF
Sbjct  532  NPNTLVGAMVAGPDRHDGFRDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIF  591

Query  353  SAV  345
            SAV
Sbjct  592  SAV  594



>ref|XP_010682188.1| PREDICTED: endoglucanase 25 [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNPRKMSY+VGFG HYPKHVHHRGASIPKNK++Y+CKGGWKWRD+K
Sbjct  479  LRRFARTQIDYILGKNPRKMSYLVGFGKHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSG++S  IDKNT
Sbjct  539  KPNPNTIVGAMVAGPDRHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNT  598

Query  359  IFSAV  345
            +FSAV
Sbjct  599  MFSAV  603



>ref|NP_001233943.1| endo-1,4-beta-glucanase [Solanum lycopersicum]
 gb|AAC49704.1| endo-1,4-beta-glucanase [Solanum lycopersicum]
Length=617

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FAE+QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWK+RDS 
Sbjct  477  LRKFAETQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKYRDSS  536

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN +VGAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSG+R   IDKNT
Sbjct  537  KANPNTIVGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGDRDVGIDKNT  596

Query  359  IFSAV  345
            +FSAV
Sbjct  597  LFSAV  601



>ref|XP_006358489.1| PREDICTED: endoglucanase 25-like [Solanum tuberosum]
Length=617

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FAE+QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWK+RDS 
Sbjct  477  LRKFAETQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKYRDSS  536

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN +VGAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSG+R   IDKNT
Sbjct  537  KANPNTIVGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGDRDVGIDKNT  596

Query  359  IFSAV  345
            +FSAV
Sbjct  597  LFSAV  601



>ref|XP_008347974.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 13, partial 
[Malus domestica]
Length=629

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ 
Sbjct  54   LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTS  113

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNT
Sbjct  114  KANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNT  173

Query  359  IFSAV  345
            IFSAV
Sbjct  174  IFSAV  178



>ref|XP_008339246.1| PREDICTED: endoglucanase 25-like [Malus domestica]
Length=622

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  482  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYNCKGGWKWRDTP  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNT
Sbjct  542  KANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNT  601

Query  359  IFSAV  345
            IFSAV
Sbjct  602  IFSAV  606



>ref|XP_010521418.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=620

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFG+ YPKHVHHRGASIPKNKVRYNCKGGWKWRDSK
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGDRYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER-STRIDKN  363
             PNPN +VGAMVAGPD  DGFHD+RTNYNYTEPTLAGNAGLVAALVALSG++ S  IDKN
Sbjct  539  NPNPNTIVGAMVAGPDKRDGFHDIRTNYNYTEPTLAGNAGLVAALVALSGDKDSGSIDKN  598

Query  362  TIFSAV  345
            TIFSAV
Sbjct  599  TIFSAV  604



>dbj|BAD95336.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
Length=256

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  114  LRDFARSQIDYILGKNPRKMSYVVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSK  173

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD  DG+ DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDK
Sbjct  174  KPNPNTIEGAMVAGPDKRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDK  233

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  234  NTIFSAV  240



>ref|XP_009340771.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25-like [Pyrus 
x bretschneideri]
Length=619

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ 
Sbjct  479  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTP  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNT
Sbjct  539  KANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>dbj|BAC22690.1| endo-1,4-beta-D-glucanase [Pyrus communis]
Length=621

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ 
Sbjct  481  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTP  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNT
Sbjct  541  KANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNT  600

Query  359  IFSAV  345
            IFSAV
Sbjct  601  IFSAV  605



>ref|XP_009399913.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=691

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QIDYILGKNP+KMSYVVGFG  YPKHVHHRGASIPKN V+YNCKGGWKWRD+K
Sbjct  552  LRDFARTQIDYILGKNPKKMSYVVGFGQRYPKHVHHRGASIPKNGVKYNCKGGWKWRDTK  611

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN ++GAMVAGPD HDGFHD+RTNYNYTEPTLAGNAGLVAALVALSGE ST +DKNT
Sbjct  612  KPNPNTIIGAMVAGPDKHDGFHDIRTNYNYTEPTLAGNAGLVAALVALSGE-STGVDKNT  670

Query  359  IFSAV  345
            IFSAV
Sbjct  671  IFSAV  675



>emb|CAN68337.1| hypothetical protein VITISV_025978 [Vitis vinifera]
Length=616

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -3

Query  698  QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNIL  519
            +IDYILGKNPRKMSY+ GFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRDS KPNPN L
Sbjct  483  KIDYILGKNPRKMSYIAGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDSSKPNPNTL  542

Query  518  VGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            VGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  543  VGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTIFSAV  600



>dbj|BAF42036.1| cellulase1 [Pyrus communis]
Length=622

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ 
Sbjct  482  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTP  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNT
Sbjct  542  KANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNT  601

Query  359  IFSAV  345
            IFSAV
Sbjct  602  IFSAV  606



>ref|XP_009765308.1| PREDICTED: endoglucanase 25-like [Nicotiana sylvestris]
Length=616

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QI+YILGKNPRKMSYVVGFGN YPK VHHRGASIPKNKV+YNCKGGWKWRDS 
Sbjct  476  LREFAQTQINYILGKNPRKMSYVVGFGNRYPKRVHHRGASIPKNKVKYNCKGGWKWRDSS  535

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN LVGAMVAGPD +DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++S  IDKNT
Sbjct  536  KNNPNTLVGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNT  595

Query  359  IFSAV  345
            IFSAV
Sbjct  596  IFSAV  600



>ref|XP_009595607.1| PREDICTED: endoglucanase 25-like [Nicotiana tomentosiformis]
Length=616

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QI+YILGKNPRKMSYVVGFGN YPK VHHRGASIPKNKV+YNCKGGWKWRDS 
Sbjct  476  LREFAQTQINYILGKNPRKMSYVVGFGNRYPKRVHHRGASIPKNKVKYNCKGGWKWRDSS  535

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN LVGAMVAGPD +DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG++S  IDKNT
Sbjct  536  KNNPNTLVGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKSVGIDKNT  595

Query  359  IFSAV  345
            IFSAV
Sbjct  596  IFSAV  600



>gb|AFR40591.1| cellulase, partial [Populus nigra]
Length=131

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            YILGKNPRK  YVVGFGNHYPKHVHHRGASIPKN +RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKXXYVVGFGNHYPKHVHHRGASIPKNXIRYNCKGGWKWRDTTKPNPNTLVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            MVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFXDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_010533225.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=623

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQIDYILGKNPRKMSYVVGFG  YP+ VHHRGASIPKNK RYNC+GGWKWRDSK
Sbjct  482  LREFARSQIDYILGKNPRKMSYVVGFGERYPRRVHHRGASIPKNKTRYNCRGGWKWRDSK  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER-STRIDKN  363
            KPNPN +VGAMVAGPD HDGFHDVRTNY+YTEPTLAGNAGLVAALVALSG+R S  IDKN
Sbjct  542  KPNPNTIVGAMVAGPDKHDGFHDVRTNYSYTEPTLAGNAGLVAALVALSGDRGSGSIDKN  601

Query  362  TIFSAV  345
            TIFSA+
Sbjct  602  TIFSAL  607



>ref|XP_008379019.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Malus domestica]
Length=1066

 Score =   201 bits (511),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK++Y+CKGGWKWRD+ 
Sbjct  482  LREFAKTQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKIKYSCKGGWKWRDTS  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNT
Sbjct  542  KANPNTIDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNT  601

Query  359  IFSAV  345
            IFSAV
Sbjct  602  IFSAV  606



>ref|XP_007023831.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
 gb|EOY26453.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
Length=1080

 Score =   201 bits (510),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNPRKMSY+VGFGNHYP+HVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  457  LRDFAKTQIDYILGKNPRKMSYIVGFGNHYPRHVHHRGASIPKNKIKYNCKGGWKWRDTT  516

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPT  438
            KPNPN LVGAMVAGPD HDGFHDVRTNYNYTEPT
Sbjct  517  KPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPT  550



>gb|AFR40586.1| cellulase, partial [Populus nigra]
Length=126

 Score =   184 bits (466),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            YILGKNPRK  YVVGFGNHYPKHVHHRGASIPKN +RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YILGKNPRKXXYVVGFGNHYPKHVHHRGASIPKNXIRYNCKGGWKWRDTMKPNPNTLVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSA  348
            MVAGPD HDGF DVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSA
Sbjct  61   MVAGPDRHDGFXDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSA  114



>ref|XP_007222007.1| hypothetical protein PRUPE_ppa002911mg [Prunus persica]
 gb|EMJ23206.1| hypothetical protein PRUPE_ppa002911mg [Prunus persica]
Length=622

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNP+KMSYVVGFGN YPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  482  LREFAKTQIDYILGKNPQKMSYVVGFGNRYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN L GAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE++  IDKNT
Sbjct  542  KANPNTLDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKNIGIDKNT  601

Query  359  IFSAV  345
            IFSAV
Sbjct  602  IFSAV  606



>ref|XP_010266669.1| PREDICTED: endoglucanase 9-like [Nelumbo nucifera]
Length=619

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QI+YILGKNP+KMSYVVGFGN YPKHVHHRGASIPKN+++YNCKGGWKWRD+ 
Sbjct  480  LRDFARTQINYILGKNPQKMSYVVGFGNRYPKHVHHRGASIPKNRIKYNCKGGWKWRDTP  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE+ T IDKNT
Sbjct  540  KPNPNTIVGAMVAGPDKHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEK-TGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>ref|XP_006281810.1| hypothetical protein CARUB_v10027986mg [Capsella rubella]
 gb|EOA14708.1| hypothetical protein CARUB_v10027986mg [Capsella rubella]
Length=621

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSY+VG+G  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFARSQIDYILGKNPRKMSYLVGYGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD HDGF DVR NYNYTEPTLAGNAGLVAAL+ALSGE     +IDK
Sbjct  539  KPNPNTIEGAMVAGPDKHDGFRDVRMNYNYTEPTLAGNAGLVAALIALSGEEEATGKIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_006858422.1| hypothetical protein AMTR_s00071p00064260 [Amborella trichopoda]
 gb|ERN19889.1| hypothetical protein AMTR_s00071p00064260 [Amborella trichopoda]
Length=617

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA +QIDYILGKNPRKMSY+VGFGNHYPKHVHHR ASIPKNK++Y+CKGGWKWRD+ 
Sbjct  478  LRNFARTQIDYILGKNPRKMSYIVGFGNHYPKHVHHRAASIPKNKIKYSCKGGWKWRDTP  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KP+PN LVGAMVAGPD HDGF DVR NYNYTEPTLAGNA LVAALVALSGE S  IDKNT
Sbjct  538  KPSPNTLVGAMVAGPDKHDGFKDVRGNYNYTEPTLAGNAALVAALVALSGE-SHSIDKNT  596

Query  359  IFSAV  345
            IFSAV
Sbjct  597  IFSAV  601



>gb|AFR40583.1| cellulase, partial [Populus nigra]
Length=122

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            Y  GKNPRK   VVGFGNHYPKHVHHRGASIPKNK+RYNCKGGWKWRD+ KPNPN LVGA
Sbjct  1    YXXGKNPRKXXXVVGFGNHYPKHVHHRGASIPKNKIRYNCKGGWKWRDTMKPNPNTLVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            MVAGPD HDGFHDVRTNYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFHDVRTNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|XP_010482263.1| PREDICTED: endoglucanase 25-like [Camelina sativa]
Length=621

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSYVVGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFARSQIDYILGKNPRKMSYVVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_008803421.1| PREDICTED: endoglucanase 10-like [Phoenix dactylifera]
Length=617

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA++QIDYILG NP+KMSYVVG+G  YPKHVHHRGASIPKN VRY+CKGGWKWRD+K
Sbjct  478  LRNFAKTQIDYILGNNPQKMSYVVGYGKRYPKHVHHRGASIPKNGVRYSCKGGWKWRDTK  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            +PNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLV ALV+LSG + T +DKNT
Sbjct  538  RPNPNTLVGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVFALVSLSGVK-TGVDKNT  596

Query  359  IFSAV  345
            IFSAV
Sbjct  597  IFSAV  601



>ref|XP_010938102.1| PREDICTED: endoglucanase 9-like [Elaeis guineensis]
Length=622

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QIDYILGKNP KMSYVVGFGNHYPKHVHHRGASIPKN VRY+CKGGWKWRD+K
Sbjct  483  LRDFARTQIDYILGKNPHKMSYVVGFGNHYPKHVHHRGASIPKNGVRYSCKGGWKWRDTK  542

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ + GAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE++  +DKNT
Sbjct  543  KPNPHTIAGAMVAGPDRHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKNG-VDKNT  601

Query  359  IFSAV  345
            IFSAV
Sbjct  602  IFSAV  606



>ref|XP_010909007.1| PREDICTED: endoglucanase 10-like [Elaeis guineensis]
Length=617

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA++QIDYILG NP+KMSYVVG+G  YPKHVHHRGASIPKN VRY+CKGGWKWRD+K
Sbjct  478  LRNFAKTQIDYILGNNPQKMSYVVGYGKRYPKHVHHRGASIPKNGVRYSCKGGWKWRDTK  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            +PNPN LVGAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLV ALV+LSG + T +DKNT
Sbjct  538  RPNPNTLVGAMVAGPDRHDGFHDVRTNYNYTEPTLAGNAGLVFALVSLSGVK-TGVDKNT  596

Query  359  IFSAV  345
            IFSAV
Sbjct  597  IFSAV  601



>ref|XP_010441020.1| PREDICTED: endoglucanase 25 [Camelina sativa]
Length=621

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFARSQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_010921267.1| PREDICTED: endoglucanase 9-like [Elaeis guineensis]
Length=622

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA++QIDY+LGKNPRKMSYVVGFGN YPKHVHHR ASIPKN V+Y+CKGGWKWRD+K
Sbjct  483  LRNFAQTQIDYVLGKNPRKMSYVVGFGNRYPKHVHHRAASIPKNGVKYSCKGGWKWRDTK  542

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ +VGAMVAGPD  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE+S  +DKNT
Sbjct  543  KPNPHTIVGAMVAGPDRRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKSG-VDKNT  601

Query  359  IFSAV  345
            IFSAV
Sbjct  602  IFSAV  606



>emb|CDX83181.1| BnaA03g23250D [Brassica napus]
Length=621

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LREFARTQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDK  366
            KPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>emb|CAB51903.1| cellulase [Brassica napus]
Length=621

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LREFARTQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDK  366
            KPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_010442441.1| PREDICTED: endoglucanase 25 [Camelina sativa]
Length=621

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFARSQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_009134026.1| PREDICTED: endoglucanase 25 [Brassica rapa]
Length=621

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LREFARTQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDK  366
            KPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDK
Sbjct  539  KPNPNTIEGAMVAGPDRRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>gb|AFL65037.1| endoglucanase, partial [Pinus pinaster]
Length=448

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QI+YILGKNP KMSYVVG+G+HYPKHVHHRGASIPKNK++Y+CKGGWKWRDS 
Sbjct  308  LRDFARTQINYILGKNPMKMSYVVGYGSHYPKHVHHRGASIPKNKIKYSCKGGWKWRDSP  367

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            +PNPN++VGAMVAGPD  D FHDVRTNYNYTEPTLAGNAGLVAALV+LSG  +  IDKNT
Sbjct  368  RPNPNVIVGAMVAGPDKRDMFHDVRTNYNYTEPTLAGNAGLVAALVSLSGGDTGGIDKNT  427

Query  359  IFSAV  345
            +FSAV
Sbjct  428  MFSAV  432



>ref|XP_002865753.1| hypothetical protein ARALYDRAFT_495032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42012.1| hypothetical protein ARALYDRAFT_495032 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFARSQIDYILGKNPRKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEAEATGKIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_009123553.1| PREDICTED: endoglucanase 25 [Brassica rapa]
Length=621

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+F+ SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFSRSQIDYILGKNPRKMSYLVGFGPKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDK  366
            KPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>emb|CDX71601.1| BnaC09g26420D [Brassica napus]
Length=621

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+F+ SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFSRSQIDYILGKNPRKMSYLVGFGPKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDK  366
            KPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>emb|CDY37768.1| BnaA10g05530D [Brassica napus]
Length=621

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+F+ SQIDYILGKNPRKMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFSRSQIDYILGKNPRKMSYLVGFGPKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDK  366
            KPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_008218604.1| PREDICTED: endoglucanase 25 [Prunus mume]
Length=1109

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNP+KMSYVVGFGN YPKHVHHRGASIPKNK++YNCKGGWKWRD+ 
Sbjct  482  LREFAKTQIDYILGKNPQKMSYVVGFGNRYPKHVHHRGASIPKNKIKYNCKGGWKWRDTS  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN L GAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE++  IDKNT
Sbjct  542  KANPNTLDGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKNIGIDKNT  601

Query  359  IFSA  348
            IFSA
Sbjct  602  IFSA  605



>ref|XP_009355455.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Pyrus x bretschneideri]
Length=1064

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILGKNP+KMSY+VGFGN YPKHVHHRGASIPKNK++Y+CKGGWKWRD+ 
Sbjct  482  LREFAKTQIDYILGKNPKKMSYIVGFGNQYPKHVHHRGASIPKNKIKYSCKGGWKWRDTS  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN + GAMVAGPD HDGF DVR+NYNYTEPTLAGNAGLVAALVALSGE+S  IDKNT
Sbjct  542  KANPNTINGAMVAGPDKHDGFRDVRSNYNYTEPTLAGNAGLVAALVALSGEKSVGIDKNT  601

Query  359  IFSAV  345
            IFSA+
Sbjct  602  IFSAI  606



>gb|AAM63370.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
Length=621

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFARSQIDYILGKNPRKMSYVVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD  DG+ DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_007216021.1| hypothetical protein PRUPE_ppa014845mg, partial [Prunus persica]
 gb|EMJ17220.1| hypothetical protein PRUPE_ppa014845mg, partial [Prunus persica]
Length=561

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILGKNP+KMSYVVGFGNH+PKHVHH GASIPK K++Y CK GWKWRDS 
Sbjct  419  LRDFAKTQIDYILGKNPQKMSYVVGFGNHFPKHVHHSGASIPKKKIKYTCKEGWKWRDSL  478

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKN  363
            KPNP  +VGAMVAGPD HDGFHDVR NYNYTEPTL GNAGLVAALVALSG+R+T  IDKN
Sbjct  479  KPNPYTIVGAMVAGPDKHDGFHDVRANYNYTEPTLVGNAGLVAALVALSGDRTTDGIDKN  538

Query  362  TIFSAV  345
            T+FSA+
Sbjct  539  TMFSAI  544



>gb|AAK59818.1| AT5g49720/K2I5_8 [Arabidopsis thaliana]
Length=621

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFARSQIDYILGKNPRKMSYVVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD  DG+ DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>gb|AAN72232.1| At5g49720/K2I5_8 [Arabidopsis thaliana]
Length=621

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFARSQIDYILGKNPRKMSYVVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD  DG+ DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|NP_199783.1| endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
 sp|Q38890.1|GUN25_ARATH RecName: Full=Endoglucanase 25; AltName: Full=Cellulase homolog 
OR16pep; AltName: Full=Endo-1,4-beta glucanase 25; AltName: 
Full=Protein KORRIGAN; AltName: Full=Protein RADIALLY SWOLLEN 
2 [Arabidopsis thaliana]
 gb|AAB60304.1| cellulase [Arabidopsis thaliana]
 gb|AAC33467.1| cellulase [Arabidopsis thaliana]
 gb|AAC35344.1| cellulase [Arabidopsis thaliana]
 gb|AAC83240.1| endo-1,4-beta-D-glucanase KORRIGAN [Arabidopsis thaliana]
 dbj|BAA98160.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
 gb|AED95850.1| endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
Length=621

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LRDFARSQIDYILGKNPRKMSYVVGFGTKYPRHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD  DG+ DVR NYNYTEPTLAGNAGLVAALVALSGE     +IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGYRDVRMNYNYTEPTLAGNAGLVAALVALSGEEEATGKIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_009406859.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=623

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QIDY+LGKNP+K+SYVVGFG  YPKHVHHRGASIPKN V+YNCKGGWKWRD+K
Sbjct  484  LRDFARTQIDYVLGKNPQKLSYVVGFGARYPKHVHHRGASIPKNGVKYNCKGGWKWRDTK  543

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALVALSGE    +DKNT
Sbjct  544  KPNPNTIVGAMVAGPDRHDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGE-GNGVDKNT  602

Query  359  IFSAV  345
            IFSAV
Sbjct  603  IFSAV  607



>gb|ABR16291.1| unknown [Picea sitchensis]
 gb|ACN40901.1| unknown [Picea sitchensis]
Length=617

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA +QI+YILGKNP KMSY+VG+G+HYPKHVHHRGASIPKNK++Y+CKGGWKWRDS 
Sbjct  477  LRNFARTQINYILGKNPMKMSYLVGYGSHYPKHVHHRGASIPKNKIKYSCKGGWKWRDSP  536

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            +PNPN+LVGAMVAGPD  D FHDVRTNYNYTEPTLAGNAGLVAALV+LSG  +  IDKNT
Sbjct  537  RPNPNVLVGAMVAGPDKRDMFHDVRTNYNYTEPTLAGNAGLVAALVSLSGGDTGGIDKNT  596

Query  359  IFSAV  345
            +FSAV
Sbjct  597  MFSAV  601



>ref|XP_008782747.1| PREDICTED: endoglucanase 9-like [Phoenix dactylifera]
Length=622

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDY+LGKNPRKMSYVVGFGNHYPKHVHHRGASIPKN V+Y+CKGGWKWR++K
Sbjct  483  LRDFAQTQIDYVLGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNGVKYSCKGGWKWRNTK  542

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ ++GAMVAGPD  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE++  +DKNT
Sbjct  543  KPNPHNIIGAMVAGPDRRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEKNG-VDKNT  601

Query  359  IFSAV  345
            IFSAV
Sbjct  602  IFSAV  606



>gb|AEL88496.1| membrane-bound endo-1,4-beta-glucanase [Picea glauca]
Length=617

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA +QI+YILGKNP KMSY+VG+G+HYPKHVHHRGASIPKNK++Y+CKGGWKWRDS 
Sbjct  477  LRNFARTQINYILGKNPMKMSYLVGYGSHYPKHVHHRGASIPKNKIKYSCKGGWKWRDSP  536

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            +PNPN+LVGAMVAGPD  D FHDVRTNYNYTEPTLAGNAGLVAALV+LSG  +  IDKNT
Sbjct  537  RPNPNVLVGAMVAGPDKRDMFHDVRTNYNYTEPTLAGNAGLVAALVSLSGGDTGGIDKNT  596

Query  359  IFSAV  345
            +FSAV
Sbjct  597  MFSAV  601



>ref|XP_008243721.1| PREDICTED: endoglucanase 9-like [Prunus mume]
Length=564

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILG+NP+KMSYVVGFGNH+PK VHHRGASIPK K++Y+CKGGWKWR S 
Sbjct  422  LRDFAKTQIDYILGRNPQKMSYVVGFGNHFPKQVHHRGASIPKKKIKYSCKGGWKWRGSL  481

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKN  363
            KPNP  +VGAMVAGPD HDGFHDVR NYNYTEPTL GNAGLVAALVALSG+R+T  IDKN
Sbjct  482  KPNPYTIVGAMVAGPDKHDGFHDVRANYNYTEPTLVGNAGLVAALVALSGDRTTDGIDKN  541

Query  362  TIFSAV  345
            T+FSA+
Sbjct  542  TMFSAI  547



>emb|CDY21449.1| BnaC03g27480D [Brassica napus]
Length=621

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNP KMSY+VGFG  YPKHVHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LREFARTQIDYILGKNPPKMSYLVGFGTKYPKHVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDK  366
            KPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAGLVAALVALSGE   S  IDK
Sbjct  539  KPNPNTIEGAMVAGPDKRDGFRDVRTNYNYTEPTLAGNAGLVAALVALSGEEEASGTIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_004301591.2| PREDICTED: endoglucanase 25 [Fragaria vesca subsp. vesca]
Length=1115

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA+ QIDYILGKNP KMSY+VGFGNHYPK VHHR ASIPKNK++YNCKGGWKWRDS 
Sbjct  478  LRDFAKFQIDYILGKNPAKMSYIVGFGNHYPKRVHHRAASIPKNKIKYNCKGGWKWRDST  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPNI+ GAMVAGPD  DGF DVR+NYNYTEPTLAGNAGLVAALV LSG++ST IDKNT
Sbjct  538  KANPNIIEGAMVAGPDKRDGFRDVRSNYNYTEPTLAGNAGLVAALVGLSGDKSTGIDKNT  597

Query  359  IFSAV  345
            IFSAV
Sbjct  598  IFSAV  602



>ref|XP_008793381.1| PREDICTED: endoglucanase 9-like [Phoenix dactylifera]
Length=622

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QIDY+LGKNPRKMSYVVGFGN Y KHVHHRGASIPKN VRY+CKGGWKWRD+K
Sbjct  483  LRDFARTQIDYMLGKNPRKMSYVVGFGNRYAKHVHHRGASIPKNGVRYSCKGGWKWRDTK  542

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            +PNP+ + GAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAAL+ALSGE++  +DKNT
Sbjct  543  RPNPHTIFGAMVAGPDRHDGFRDVRTNYNYTEPTLAGNAGLVAALIALSGEKNG-VDKNT  601

Query  359  IFSAV  345
            IFSAV
Sbjct  602  IFSAV  606



>gb|ABR15471.1| endoglucanase [Pinus taeda]
Length=619

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QI+YILGKNP KMSY+VG+G+HYPKHVHHRGASIPKNK++Y+CKGGWKWRDS 
Sbjct  479  LRDFARTQINYILGKNPMKMSYLVGYGSHYPKHVHHRGASIPKNKIKYSCKGGWKWRDSP  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            +PNPN++VGAMVAGPD  D FHDVRTNYNYTEPTLAGNAGLVAALV+LSG  +  IDKNT
Sbjct  539  RPNPNVIVGAMVAGPDKRDMFHDVRTNYNYTEPTLAGNAGLVAALVSLSGGDTGGIDKNT  598

Query  359  IFSAV  345
            +FSAV
Sbjct  599  MFSAV  603



>gb|KFK26611.1| hypothetical protein AALP_AA8G271400 [Arabis alpina]
Length=621

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 112/127 (88%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNPRKMSY+VGFG  YP+ VHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  479  LREFARTQIDYILGKNPRKMSYLVGFGPRYPRRVHHRGASIPKNKVKYNCKGGWKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            KPNPN + GAMVAGPD HDGF DVR NYNYTEPTLAGNAGLVAALVALSG+  T   IDK
Sbjct  539  KPNPNTIEGAMVAGPDKHDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGDEDTAGTIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_009395086.1| PREDICTED: endoglucanase 10-like [Musa acuminata subsp. malaccensis]
Length=619

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA++QIDYILG NP+KMSYVVG+G  YPKHVHHRGASIPKN V+Y+CKGGWKWRD+K
Sbjct  480  LRDFAKTQIDYILGNNPQKMSYVVGYGKRYPKHVHHRGASIPKNGVKYSCKGGWKWRDTK  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAALV+LSG  +T IDKNT
Sbjct  540  KPNPNTIVGAMVAGPDRHDGFKDVRTNYNYTEPTLAGNAGLVAALVSLSGV-TTGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>ref|XP_009417855.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QIDYILGKNP+KMSYVVGFG  YPKHVHHRGASIPKN V+Y+CKGGWKWRD+K
Sbjct  481  LRDFARTQIDYILGKNPQKMSYVVGFGKRYPKHVHHRGASIPKNGVKYSCKGGWKWRDTK  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN + GAMVAGPD  DGF DVRTNYNYTEPTLAGNAGLVAALV+LSGE  T +DKNT
Sbjct  541  KPNPNTIFGAMVAGPDRQDGFRDVRTNYNYTEPTLAGNAGLVAALVSLSGE-GTGVDKNT  599

Query  359  IFSAV  345
            +FSAV
Sbjct  600  MFSAV  604



>ref|NP_001183308.1| hypothetical protein [Zea mays]
 gb|ACR36366.1| unknown [Zea mays]
 tpg|DAA45168.1| TPA: hypothetical protein ZEAMMB73_159477 [Zea mays]
Length=619

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QI+YILGKNP KMSYVVGFGNHYPKHVHHRGASIPKN V Y CKGGWKWRD+K
Sbjct  480  LRSFARTQIEYILGKNPLKMSYVVGFGNHYPKHVHHRGASIPKNGVHYGCKGGWKWRDTK  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNI+VGAMVAGPD HDGF DVR NYNYTE TLAGNAGLVAALVALSGE    +DKNT
Sbjct  540  KPNPNIIVGAMVAGPDRHDGFKDVRKNYNYTEATLAGNAGLVAALVALSGE-GHGVDKNT  598

Query  359  IFSAV  345
            +FSAV
Sbjct  599  MFSAV  603



>emb|CDX92628.1| BnaC07g38860D [Brassica napus]
Length=619

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSYVVGFG  YPKHVHHRGASIPK+  R +CKGGWKWRD++
Sbjct  478  LRDFARSQIDYILGKNPRKMSYVVGFGQRYPKHVHHRGASIPKSVKRESCKGGWKWRDTR  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKN  363
            K NPN +VGAMVAGPD HDGFHD+RTNYNYTEPTLAGNAGLVAALVALSGER+   IDKN
Sbjct  538  KNNPNTIVGAMVAGPDKHDGFHDLRTNYNYTEPTLAGNAGLVAALVALSGERTFGAIDKN  597

Query  362  TIFSAV  345
            T+FSAV
Sbjct  598  TMFSAV  603



>ref|XP_009137436.1| PREDICTED: endoglucanase 21-like [Brassica rapa]
 emb|CDY10998.1| BnaA03g46570D [Brassica napus]
Length=619

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNPRKMSYVVGFG  YPKHVHHRGASIPK+  + +CKGGWKWRD+K
Sbjct  478  LRDFARSQIDYILGKNPRKMSYVVGFGQRYPKHVHHRGASIPKSVKKESCKGGWKWRDTK  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKN  363
            K NPN +VGAMVAGPD HDGFHD+RTNYNYTEPTLAGNAGLVAALVALSGER+   IDKN
Sbjct  538  KNNPNTIVGAMVAGPDKHDGFHDLRTNYNYTEPTLAGNAGLVAALVALSGERTFGAIDKN  597

Query  362  TIFSAV  345
            T+FSAV
Sbjct  598  TMFSAV  603



>ref|XP_006402246.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
 gb|ESQ43699.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
Length=620

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +Q+DYILGKNPR MSY+VGFG  YPK VHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  478  LREFARTQVDYILGKNPRNMSYLVGFGQKYPKRVHHRGASIPKNKVKYNCKGGWKWRDSK  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDK  366
            KPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE   S  IDK
Sbjct  538  KPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEEDASRTIDK  597

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  598  NTIFSAV  604



>ref|XP_006402245.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
 gb|ESQ43698.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
Length=648

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +Q+DYILGKNPR MSY+VGFG  YPK VHHRGASIPKNKV+YNCKGGWKWRDSK
Sbjct  506  LREFARTQVDYILGKNPRNMSYLVGFGQKYPKRVHHRGASIPKNKVKYNCKGGWKWRDSK  565

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER--STRIDK  366
            KPNPN + GAMVAGPD  DGF DVR NYNYTEPTLAGNAGLVAALVALSGE   S  IDK
Sbjct  566  KPNPNTIEGAMVAGPDKRDGFRDVRMNYNYTEPTLAGNAGLVAALVALSGEEDASRTIDK  625

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  626  NTIFSAV  632



>ref|XP_010088713.1| Endoglucanase 25 [Morus notabilis]
 gb|EXB36894.1| Endoglucanase 25 [Morus notabilis]
Length=212

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = -3

Query  698  QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNIL  519
            +IDYILG NPRKMSY+VGFG+HYPKHV HRGA IP N+++YNCKGGWKWRD+KKPNPN++
Sbjct  25   RIDYILGNNPRKMSYLVGFGSHYPKHVRHRGAFIPNNEIKYNCKGGWKWRDTKKPNPNVI  84

Query  518  VGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            VGAMVAGPD  DGFHDVRTNYNY EPTLAGNAGL+AALVALSGE++   DK+ IFSAV
Sbjct  85   VGAMVAGPDKDDGFHDVRTNYNYAEPTLAGNAGLIAALVALSGEKNVG-DKSAIFSAV  141



>ref|XP_004984503.1| PREDICTED: endoglucanase 9-like [Setaria italica]
Length=619

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QI+YILGKNP KMSYVVGFG HYPKHVHHRGASIPKN V Y CKGGWKWRD+K
Sbjct  480  LRGFARTQIEYILGKNPLKMSYVVGFGKHYPKHVHHRGASIPKNGVHYGCKGGWKWRDTK  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNI+VGAMVAGPD HDGF D R NYNYTE TLAGNAGLVAALVALSGE S  +DKNT
Sbjct  540  KPNPNIIVGAMVAGPDRHDGFKDARKNYNYTEATLAGNAGLVAALVALSGE-SHGVDKNT  598

Query  359  IFSAV  345
            +FSAV
Sbjct  599  MFSAV  603



>gb|AFR40582.1| cellulase, partial [Populus fremontii]
Length=131

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  689  YILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGA  510
            YI GKNPRKM  VVGFGNHYPKHVHHRGA IPKNK+RYNCKGG  WRD+ KPNPN  VGA
Sbjct  1    YIXGKNPRKMXXVVGFGNHYPKHVHHRGAXIPKNKIRYNCKGGXXWRDTTKPNPNXXVGA  60

Query  509  MVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
            MVAGPD HDGF DVR NYNYTEPT+AGNAGLVAALVALSG+++T IDKNTIFSAV
Sbjct  61   MVAGPDRHDGFRDVRXNYNYTEPTIAGNAGLVAALVALSGDKTTGIDKNTIFSAV  115



>ref|NP_001142480.1| uncharacterized protein LOC100274698 [Zea mays]
 gb|ACG24268.1| hypothetical protein [Zea mays]
Length=198

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+K
Sbjct  56   LRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTK  115

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD  DG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDK
Sbjct  116  KANPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDK  175

Query  365  NTIFSAV  345
            NTIFSA+
Sbjct  176  NTIFSAI  182



>ref|XP_010529892.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=623

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQIDYILGKNP+ MSY+VGFG  YPK VHHRGASIPKN+ RY+CKGGWKWRDSK
Sbjct  482  LRKFARSQIDYILGKNPQSMSYIVGFGQRYPKRVHHRGASIPKNRNRYSCKGGWKWRDSK  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGER-STRIDKN  363
             PNPNI+VGAMVAGPD  D FHDVR NYNYTEPTLAGNAGLVAALVALSG++ S  IDKN
Sbjct  542  MPNPNIIVGAMVAGPDKRDRFHDVRNNYNYTEPTLAGNAGLVAALVALSGDKDSGSIDKN  601

Query  362  TIFSAV  345
            T+FSAV
Sbjct  602  TMFSAV  607



>gb|KHN40215.1| Endoglucanase 25 [Glycine soja]
Length=122

 Score =   171 bits (433),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -3

Query  662  MSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNILVGAMVAGPDAHD  483
            MSYVVGFGNHYPKHVHHRGASIPKNKV+YNCKGGWKWRDS KPNP+ +VGAMVAGPD HD
Sbjct  1    MSYVVGFGNHYPKHVHHRGASIPKNKVKYNCKGGWKWRDSSKPNPHTIVGAMVAGPDKHD  60

Query  482  GFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNTIFSAV  345
             FHDVRTNYNYTEPTLAGNAGLVAALVALSG+++T IDKNT+FSAV
Sbjct  61   HFHDVRTNYNYTEPTLAGNAGLVAALVALSGDKTTGIDKNTLFSAV  106



>gb|EYU35397.1| hypothetical protein MIMGU_mgv1a003033mg [Erythranthe guttata]
Length=613

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FAE+Q++YILGKNPRKMSYVVG+G HYPK VHHRGASIPKN V+Y CKGG KWRDS 
Sbjct  473  LREFAETQMNYILGKNPRKMSYVVGYGTHYPKQVHHRGASIPKNNVKYTCKGGLKWRDST  532

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPNI+VGAMVAGPD +DGF D R NYNYTEPTLAGNAGLVAALVALSG+    IDKNT
Sbjct  533  KANPNIIVGAMVAGPDRNDGFKDKRNNYNYTEPTLAGNAGLVAALVALSGDTDVGIDKNT  592

Query  359  IFSAV  345
            IFSAV
Sbjct  593  IFSAV  597



>ref|XP_009400506.1| PREDICTED: endoglucanase 10-like [Musa acuminata subsp. malaccensis]
Length=619

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA++QIDYILG NPRKMSY+VG+G  YPKHVHHRGASIPKN  RY CKGG+KWRDS 
Sbjct  480  LRGFAKTQIDYILGNNPRKMSYIVGYGKRYPKHVHHRGASIPKNGARYGCKGGYKWRDST  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            +PNPN +VGAMVAGPD HDGF DVR NYNYTEPTLAGNAGLVAAL++LSG + T +DKNT
Sbjct  540  RPNPNTIVGAMVAGPDRHDGFRDVRVNYNYTEPTLAGNAGLVAALISLSGVK-TGVDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>gb|ADQ73896.1| endo-1,4-beta-glucanase [Avena strigosa]
Length=338

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 110/129 (85%), Gaps = 5/129 (4%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA+SQIDYILGKNP+KMSYVVG+G  YPK VHHRGASIP N V Y CKGG+KWR+SK
Sbjct  195  LRKFAKSQIDYILGKNPQKMSYVVGYGKKYPKRVHHRGASIPHNGVHYGCKGGFKWRESK  254

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaL----SGERSTRI  372
            K NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAGLVAAL++L    +G R T +
Sbjct  255  KANPNILVGAMVAGPDRHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGSR-TSV  313

Query  371  DKNTIFSAV  345
            DKNTIFSAV
Sbjct  314  DKNTIFSAV  322



>ref|XP_002465324.1| hypothetical protein SORBIDRAFT_01g036480 [Sorghum bicolor]
 gb|EER92322.1| hypothetical protein SORBIDRAFT_01g036480 [Sorghum bicolor]
Length=620

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QI+YILGKNP KMSYVVGFGNHYPKHVHHRGASIPKN V Y CKGGWKWRD+K
Sbjct  481  LRSFARTQIEYILGKNPLKMSYVVGFGNHYPKHVHHRGASIPKNGVHYGCKGGWKWRDTK  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNI+VGAMVAGPD HD F D R NYNYTE TL GNAGLVAALVALSGE    +DKN 
Sbjct  541  KPNPNIIVGAMVAGPDRHDRFKDARKNYNYTEATLVGNAGLVAALVALSGE-GHGVDKNA  599

Query  359  IFSAV  345
            +FSAV
Sbjct  600  MFSAV  604



>gb|EEE58992.1| hypothetical protein OsJ_10702 [Oryza sativa Japonica Group]
Length=619

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA +QI+YILGKNP KMSYVVG+GN YPK VHHRGASIPKN V Y CKGGWKWR++K
Sbjct  480  LRNFARTQIEYILGKNPLKMSYVVGYGNRYPKRVHHRGASIPKNGVHYGCKGGWKWRETK  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNI+VGAMVAGPD HDGF DVR NYNYTE TLAGNAGLVAALVALSGE    +DKNT
Sbjct  540  KPNPNIIVGAMVAGPDRHDGFKDVRKNYNYTEATLAGNAGLVAALVALSGE-GHGVDKNT  598

Query  359  IFSAV  345
            +FSAV
Sbjct  599  MFSAV  603



>ref|XP_006431346.1| hypothetical protein CICLE_v10003884mg, partial [Citrus clementina]
 gb|ESR44586.1| hypothetical protein CICLE_v10003884mg, partial [Citrus clementina]
Length=477

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            +R FA++QIDYILG NP+KMSY+VGFG+ YP++VHHRGASIPKNK++Y+CKGGWKWR S 
Sbjct  345  MRRFAKTQIDYILGNNPQKMSYLVGFGSPYPQYVHHRGASIPKNKIKYSCKGGWKWRHSS  404

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKN  363
            KPNPN LVGAMVAGP  HDGFHDVR+NYNYT PTL  NAGLVAALVALSG++ST  IDK+
Sbjct  405  KPNPNTLVGAMVAGPHKHDGFHDVRSNYNYTVPTLHDNAGLVAALVALSGKKSTGGIDKS  464

Query  362  TIFSAV  345
            TIF+ V
Sbjct  465  TIFTEV  470



>ref|NP_001050004.1| Os03g0329500 [Oryza sativa Japonica Group]
 sp|P0C1U4.1|GUN9_ORYSJ RecName: Full=Endoglucanase 9; AltName: Full=Endo-1,4-beta glucanase 
9; AltName: Full=OsCel9D; AltName: Full=OsGLU1 [Oryza 
sativa Japonica Group]
 gb|ABF95745.1| membrane-anchored endo-1,4-beta-glucanase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11918.1| Os03g0329500 [Oryza sativa Japonica Group]
 dbj|BAF37261.1| endo-beta-1,4-D-glucanase [Oryza sativa]
 gb|EAY89858.1| hypothetical protein OsI_11408 [Oryza sativa Indica Group]
Length=619

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA +QI+YILGKNP KMSYVVG+GN YPK VHHRGASIPKN V Y CKGGWKWR++K
Sbjct  480  LRNFARTQIEYILGKNPLKMSYVVGYGNRYPKRVHHRGASIPKNGVHYGCKGGWKWRETK  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNI+VGAMVAGPD HDGF DVR NYNYTE TLAGNAGLVAALVALSGE    +DKNT
Sbjct  540  KPNPNIIVGAMVAGPDRHDGFKDVRKNYNYTEATLAGNAGLVAALVALSGE-GHGVDKNT  598

Query  359  IFSAV  345
            +FSAV
Sbjct  599  MFSAV  603



>ref|XP_009137865.1| PREDICTED: endoglucanase 21 [Brassica rapa]
Length=610

 Score =   180 bits (456),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNP+ MSYVV FG  YP+HVHH+GASIPK+  + +CKGGWKWRD+K
Sbjct  469  LRDFARSQIDYILGKNPQNMSYVVDFGQRYPRHVHHKGASIPKSVKKESCKGGWKWRDTK  528

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKN  363
            + NPNI+VGAMVAGPD HDGFHD+R+NYNYTEPTLAGNAGLVAALVALSGE +   IDKN
Sbjct  529  RDNPNIIVGAMVAGPDKHDGFHDLRSNYNYTEPTLAGNAGLVAALVALSGEETLESIDKN  588

Query  362  TIFSAV  345
            TIFSAV
Sbjct  589  TIFSAV  594



>emb|CDY34271.1| BnaA01g13740D [Brassica napus]
Length=561

 Score =   179 bits (454),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNP+ MSYVV FG  YP+HVHH+GASIPK+  + +CKGGWKWRD+K
Sbjct  420  LRDFARSQIDYILGKNPQNMSYVVDFGQRYPRHVHHKGASIPKSVKKESCKGGWKWRDTK  479

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKN  363
            + NPNI+VGAMVAGPD HDGFHD+R+NYNYTEPTLAGN GLVAALVALSGE +   IDKN
Sbjct  480  RDNPNIIVGAMVAGPDKHDGFHDLRSNYNYTEPTLAGNGGLVAALVALSGEETLESIDKN  539

Query  362  TIFSAV  345
            TIFSAV
Sbjct  540  TIFSAV  545



>ref|NP_001147537.1| endo-1,4-beta-glucanase [Zea mays]
 gb|ACG27857.1| endo-1,4-beta-glucanase [Zea mays]
 gb|AFW88475.1| endo-1,4-beta-glucanase [Zea mays]
Length=620

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA +QIDYILGKNP KMSYVVGFG  YP+HVHHRGASIPKN V Y CKGGWKWRD+K
Sbjct  480  LRSFARTQIDYILGKNPLKMSYVVGFGKRYPRHVHHRGASIPKNGVHYGCKGGWKWRDAK  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN + GAMVAGPD HDGF D R NYNYTE TLAGNAGLVAALVALSG+    +DKNT
Sbjct  540  KPNPNTIAGAMVAGPDRHDGFKDARRNYNYTEATLAGNAGLVAALVALSGDGHGGVDKNT  599

Query  359  IFSAV  345
            +FSAV
Sbjct  600  MFSAV  604



>ref|XP_006650027.1| PREDICTED: endoglucanase 9-like [Oryza brachyantha]
Length=619

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA +QI+YILGKNP KMS+VVG+G HYPK VHHRGASIPKN V Y CKGGWKWR++K
Sbjct  480  LRNFARTQIEYILGKNPLKMSFVVGYGKHYPKRVHHRGASIPKNGVHYGCKGGWKWRETK  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNI+VGAMVAGPD HDGF DVR NYNYTE TLAGNAGLVAALVALSGE    +DKNT
Sbjct  540  KPNPNIIVGAMVAGPDHHDGFKDVRRNYNYTEATLAGNAGLVAALVALSGE-GHGVDKNT  598

Query  359  IFSAV  345
            +FSAV
Sbjct  599  MFSAV  603



>gb|EMT00674.1| Endoglucanase 10 [Aegilops tauschii]
Length=555

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA+SQ+DYILGKNP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+SK
Sbjct  413  LRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESK  472

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAGLVAAL++L+   + R  IDK
Sbjct  473  KANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGRYSIDK  532

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  533  NTIFSAV  539



>gb|EMS52550.1| Endoglucanase 10 [Triticum urartu]
Length=555

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA+SQ+DYILGKNP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+SK
Sbjct  413  LRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESK  472

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAGLVAAL++L+   + R  IDK
Sbjct  473  KANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGRYSIDK  532

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  533  NTIFSAV  539



>dbj|BAJ94336.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA+SQ+DYILGKNP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+SK
Sbjct  479  LRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAGLVAAL++L+   + R  IDK
Sbjct  539  KANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGRYSIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>dbj|BAA94257.1| endo-1,4-beta-glucanase Cel1 [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA+SQ+DYILGKNP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+SK
Sbjct  479  LRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAGLVAAL++L+   + R  IDK
Sbjct  539  KANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGRYSIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>gb|ABP96983.1| cellulase [Colocasia esculenta]
Length=618

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA +QIDYILG NP+KMSY+VG+G  YPKHV+HRGASIPKN V+Y CK GWK RD+ 
Sbjct  479  LRNFARTQIDYILGNNPQKMSYLVGYGKRYPKHVYHRGASIPKNGVKYGCKAGWKLRDTT  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN +VGAM+AGPD HDGF DVRTNYNYTEPTLAGNAGLVAALV+LSG ++  IDKNT
Sbjct  539  KPNPNTIVGAMIAGPDKHDGFKDVRTNYNYTEPTLAGNAGLVAALVSLSGVQAG-IDKNT  597

Query  359  IFSAV  345
            IFSAV
Sbjct  598  IFSAV  602



>ref|XP_006650552.1| PREDICTED: endoglucanase 10-like [Oryza brachyantha]
Length=618

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DY+LGKNP+KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWR++K
Sbjct  479  LRKFARSQLDYVLGKNPQKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGFKWRETK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPNIL+GAMVAGPD HDGF DVRTNYNYTEPTLA NAGLVAAL++LS  + T IDKNT
Sbjct  539  KANPNILIGAMVAGPDRHDGFKDVRTNYNYTEPTLAANAGLVAALISLSNAK-TGIDKNT  597

Query  359  IFSAV  345
            IFSA+
Sbjct  598  IFSAI  602



>emb|CBB36505.1| Hordeum vulgare protein similar to endo-1,4-b-glucanase BAA94257 
[Saccharum hybrid cultivar R570]
Length=626

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+K
Sbjct  484  LRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTK  543

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HDG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDK
Sbjct  544  KANPNILVGAMVAGPDRHDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDK  603

Query  365  NTIFSAV  345
            NTIFSA+
Sbjct  604  NTIFSAI  610



>emb|CDI66528.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
 emb|CDI66541.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=621

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+K
Sbjct  479  LRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HDG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDK
Sbjct  539  KANPNILVGAMVAGPDRHDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDK  598

Query  365  NTIFSAV  345
            NTIFSA+
Sbjct  599  NTIFSAI  605



>emb|CDI66602.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=624

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+K
Sbjct  482  LRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTK  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HDG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDK
Sbjct  542  KANPNILVGAMVAGPDRHDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDK  601

Query  365  NTIFSAV  345
            NTIFSA+
Sbjct  602  NTIFSAI  608



>ref|XP_002515321.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF47305.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=598

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA SQIDYILGKNP  MSY+VGFG+H+P+  HHRGASIP +KV+Y CK GW+W+ S+
Sbjct  458  LRNFARSQIDYILGKNPCDMSYIVGFGSHFPQQAHHRGASIPNSKVKYRCKDGWQWQVSR  517

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            +PNPN ++GAMVAGPD  DGF D+R NYNYTEPT+AGNAGL+AALVAL+G R+++IDKNT
Sbjct  518  RPNPNTIIGAMVAGPDKEDGFQDIRYNYNYTEPTIAGNAGLIAALVALTGGRTSKIDKNT  577

Query  359  IFSAV  345
            IFSA+
Sbjct  578  IFSAI  582



>gb|ACZ82300.1| beta-1,4 glycosidase [Phyllostachys edulis]
Length=617

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP KMSYVVGFGN YPK VHHR ASIP N V+Y CKGG+KWR+SK
Sbjct  478  LRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRVHHREASIPHNGVKYGCKGGFKWRESK  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPNIL+GAMVAGPD HDGF DVRTNYNYTEPTLA NAGLVAAL++LS +  T IDKNT
Sbjct  538  KANPNILIGAMVAGPDRHDGFKDVRTNYNYTEPTLAANAGLVAALISLS-DVKTGIDKNT  596

Query  359  IFSAV  345
            +FSA+
Sbjct  597  LFSAI  601



>ref|XP_003560035.1| PREDICTED: endoglucanase 10 [Brachypodium distachyon]
Length=621

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA+SQIDYILG NP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+SK
Sbjct  479  LRKFAKSQIDYILGNNPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWRESK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERS--TRIDK  366
            K NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAGL+AAL++L+   +  T IDK
Sbjct  539  KANPNILVGAMVAGPDRHDGFKDIRTNYNYTEPTLAANAGLIAALISLADIDTGRTAIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_010433798.1| PREDICTED: endoglucanase 21-like [Camelina sativa]
Length=622

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 110/126 (87%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNF+ SQIDYILGKNPRKMSYVVGFG  YPK VHHRGASIP+N ++ +CKGG KW  SK
Sbjct  482  LRNFSRSQIDYILGKNPRKMSYVVGFGQRYPKQVHHRGASIPQN-MKESCKGGLKWEKSK  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKN  363
            K NPNI+ GAMVAGPD HDGFHDVRTNYNYTEPTL+GNAGLVAALVALSGE +   IDKN
Sbjct  541  KDNPNIIKGAMVAGPDKHDGFHDVRTNYNYTEPTLSGNAGLVAALVALSGEEAVGDIDKN  600

Query  362  TIFSAV  345
            T+FSAV
Sbjct  601  TMFSAV  606



>gb|ABF98747.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
Length=497

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DY+LGKNP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWR++K
Sbjct  356  LRKFARSQLDYVLGKNPLKMSYVVGFGNKYPKRAHHRGASIPHNGVKYGCKGGFKWRETK  415

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG-ERSTRIDKN  363
            KPNPNIL+GA+VAGPD HDGF DVRTNYNYTEPTLA NAGLVAAL++L+     + IDKN
Sbjct  416  KPNPNILIGALVAGPDRHDGFKDVRTNYNYTEPTLAANAGLVAALISLTNIHVKSGIDKN  475

Query  362  TIFSAV  345
            TIFSAV
Sbjct  476  TIFSAV  481



>emb|CDI66566.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=621

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 109/127 (86%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP KMSYVVGFGN YP+  HHRGASIP N V+Y CKGG+KWRD+K
Sbjct  479  LRKFARSQLDYILGKNPLKMSYVVGFGNKYPRRPHHRGASIPHNGVKYGCKGGYKWRDTK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HDG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDK
Sbjct  539  KANPNILVGAMVAGPDRHDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDK  598

Query  365  NTIFSAV  345
            NTIFSA+
Sbjct  599  NTIFSAI  605



>ref|XP_002463915.1| hypothetical protein SORBIDRAFT_01g008860 [Sorghum bicolor]
 gb|EER90913.1| hypothetical protein SORBIDRAFT_01g008860 [Sorghum bicolor]
Length=621

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 109/127 (86%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+K
Sbjct  479  LRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HDG+ DVRTNYNY+EPTLA NAGLVAAL+++S  ++ R  IDK
Sbjct  539  KANPNILVGAMVAGPDRHDGYKDVRTNYNYSEPTLAANAGLVAALISISDIKTGRFGIDK  598

Query  365  NTIFSAV  345
            NTIFSA+
Sbjct  599  NTIFSAI  605



>ref|XP_006413454.1| hypothetical protein EUTSA_v10024681mg [Eutrema salsugineum]
 gb|ESQ54907.1| hypothetical protein EUTSA_v10024681mg [Eutrema salsugineum]
Length=624

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR F+ SQIDYILGKNPRKMSYVVGFG  YP+HVHHRGASIP +  + +CKGGWKWRDSK
Sbjct  483  LREFSRSQIDYILGKNPRKMSYVVGFGQRYPRHVHHRGASIPMSVKKESCKGGWKWRDSK  542

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKN  363
            K NPN + GAMVAGP+ +DGFHDVR NYNYTEPTLAGNAGLVAALVALSG ++   IDKN
Sbjct  543  KGNPNTITGAMVAGPNKYDGFHDVRANYNYTEPTLAGNAGLVAALVALSGGKTVGGIDKN  602

Query  362  TIFSAV  345
            TIFSAV
Sbjct  603  TIFSAV  608



>ref|NP_001051192.1| Os03g0736300 [Oryza sativa Japonica Group]
 sp|Q84R49.1|GUN10_ORYSJ RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; AltName: Full=OsGLU2 [Oryza sativa Japonica Group]
 gb|AAP03405.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|AAR07086.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|ABF98746.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13106.1| Os03g0736300 [Oryza sativa Japonica Group]
 dbj|BAG91933.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76139.1| hypothetical protein OsI_13426 [Oryza sativa Indica Group]
 gb|EEE59884.1| hypothetical protein OsJ_12485 [Oryza sativa Japonica Group]
Length=620

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DY+LGKNP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWR++K
Sbjct  479  LRKFARSQLDYVLGKNPLKMSYVVGFGNKYPKRAHHRGASIPHNGVKYGCKGGFKWRETK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG-ERSTRIDKN  363
            KPNPNIL+GA+VAGPD HDGF DVRTNYNYTEPTLA NAGLVAAL++L+     + IDKN
Sbjct  539  KPNPNILIGALVAGPDRHDGFKDVRTNYNYTEPTLAANAGLVAALISLTNIHVKSGIDKN  598

Query  362  TIFSAV  345
            TIFSAV
Sbjct  599  TIFSAV  604



>emb|CDY03467.1| BnaC01g16150D [Brassica napus]
Length=561

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNP+ MSYVV FG  YP+HVHH+GASIPK+  + +CKGGWKWRD+K
Sbjct  420  LRDFARSQIDYILGKNPQNMSYVVDFGQRYPRHVHHKGASIPKSVKKESCKGGWKWRDTK  479

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKN  363
            + NPN +VGAMVAGPD HD FHD+R+NYNYTEPTLAGNAGLVAALVALSGE +   IDKN
Sbjct  480  RDNPNTIVGAMVAGPDKHDEFHDLRSNYNYTEPTLAGNAGLVAALVALSGEETLESIDKN  539

Query  362  TIFSAV  345
            TIFSAV
Sbjct  540  TIFSAV  545



>gb|AAM13693.1| endo-1,4-beta-glucanase [Triticum aestivum]
Length=620

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA+SQ+DYILGKNP+KMSYVVGFG  YPK VHHRGASIP N V+Y CKGG+KWR+ K
Sbjct  479  LRKFAKSQLDYILGKNPQKMSYVVGFGKKYPKRVHHRGASIPHNGVKYGCKGGFKWREFK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HDGF D+RTNYNYTEPTLA NAGLVAAL++L+   + R  IDK
Sbjct  539  KANPNILVGAMVAGPDKHDGFKDIRTNYNYTEPTLAANAGLVAALISLADIDTGRYSIDK  598

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  599  NTIFSAV  605



>ref|XP_008342152.1| PREDICTED: endoglucanase 9-like [Malus domestica]
Length=511

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYI+GKNPR +SY+VGFG  +P+ VHHRGASIPKNK++Y CKGG KWRDSK
Sbjct  371  LRRFARTQIDYIIGKNPRGISYIVGFGERFPQQVHHRGASIPKNKIKYGCKGGLKWRDSK  430

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNI+VGAMVAGPD HD F DVR+NYNYTEPTLAGNAGLVAALVALS      +DKN+
Sbjct  431  KPNPNIIVGAMVAGPDEHDNFQDVRSNYNYTEPTLAGNAGLVAALVALSTGNPAGVDKNS  490

Query  359  IFSAV  345
            +F AV
Sbjct  491  MFYAV  495



>ref|XP_003557996.1| PREDICTED: endoglucanase 9 [Brachypodium distachyon]
Length=621

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 110/126 (87%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDS  543
            LR+FA +QI+YILGKNP KMSYVVG+GNHYPKHVHHRGASIPK K V Y CK GWKWRDS
Sbjct  481  LRSFARTQIEYILGKNPLKMSYVVGYGNHYPKHVHHRGASIPKKKGVHYGCKEGWKWRDS  540

Query  542  KKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKN  363
            KKPNP+I+VGAMVAGPD HD F DVR NYNYTE TLAGNAGLV ALVALSGE +  +DKN
Sbjct  541  KKPNPHIVVGAMVAGPDRHDRFKDVRKNYNYTEATLAGNAGLVTALVALSGE-AHGLDKN  599

Query  362  TIFSAV  345
            T+FSAV
Sbjct  600  TMFSAV  605



>gb|ACN28577.1| unknown [Zea mays]
 gb|ACN34658.1| unknown [Zea mays]
 gb|AFW67687.1| hypothetical protein ZEAMMB73_593933 [Zea mays]
Length=621

 Score =   174 bits (442),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+K
Sbjct  479  LRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD  DG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDK
Sbjct  539  KANPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDK  598

Query  365  NTIFSAV  345
            NTIFSA+
Sbjct  599  NTIFSAI  605



>ref|NP_001151770.1| endo-1,4-beta-glucanase Cel1 [Zea mays]
 gb|ACG44266.1| endo-1,4-beta-glucanase Cel1 [Zea mays]
Length=621

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+K
Sbjct  479  LRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD  DG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDK
Sbjct  539  KANPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDK  598

Query  365  NTIFSAV  345
            NTIFSA+
Sbjct  599  NTIFSAI  605



>tpg|DAA51201.1| TPA: endo-1,4-beta-glucanase Cel1 [Zea mays]
Length=621

 Score =   174 bits (441),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWRD+K
Sbjct  479  LRKFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD  DG+ DVRTNYNYTEPTLA NAGLVAAL+++S  ++ R  IDK
Sbjct  539  KANPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDK  598

Query  365  NTIFSAV  345
            NTIFSA+
Sbjct  599  NTIFSAI  605



>ref|XP_009339798.1| PREDICTED: endoglucanase 9-like [Pyrus x bretschneideri]
Length=618

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYI+GKNPR +SY+VGFG  +P+ VHHRGASIPKNK++Y CKGG KWRDSK
Sbjct  478  LRRFARTQIDYIIGKNPRGISYIVGFGERFPQQVHHRGASIPKNKIKYGCKGGLKWRDSK  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPNI+VGAMVAGPD HD F DVR+NYNYTEPTLAGNAGLVAALVALS      +DKN+
Sbjct  538  KPNPNIIVGAMVAGPDEHDNFQDVRSNYNYTEPTLAGNAGLVAALVALSTGNPAGVDKNS  597

Query  359  IFSAV  345
            +F AV
Sbjct  598  MFYAV  602



>gb|EPS69180.1| hypothetical protein M569_05586 [Genlisea aurea]
Length=615

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+F++SQI+YILG+NPR+MSYVVGFG  YP HVHHRGASIPKNK + +C+GGWKWRDS 
Sbjct  476  LRDFSKSQINYILGQNPRQMSYVVGFGRRYPTHVHHRGASIPKNK-KASCEGGWKWRDSS  534

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN + GAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVAL+   +  IDKNT
Sbjct  535  KPNPNTIRGAMVAGPDRHDGFHDVRTNYNYTEPTLAGNAGLVAALVALAAGDNAGIDKNT  594

Query  359  IFSAV  345
            +FSAV
Sbjct  595  MFSAV  599



>ref|XP_010277803.1| PREDICTED: endoglucanase 12-like [Nelumbo nucifera]
Length=615

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQIDYILGKNP KMSYVVG+G+ YPKHVHHRGASIP +  +Y+C GGWKWRDS+
Sbjct  475  LRQFATSQIDYILGKNPLKMSYVVGYGSKYPKHVHHRGASIPHDHNKYSCTGGWKWRDSR  534

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN +VGAMV GPD  D F DVRTNYNYTEPTLAGNAGLVAALV+L+G     IDKNT
Sbjct  535  NPNPNTIVGAMVGGPDRFDQFRDVRTNYNYTEPTLAGNAGLVAALVSLTGSAGGGIDKNT  594

Query  359  IFSAV  345
            IFSAV
Sbjct  595  IFSAV  599



>ref|XP_006444448.1| hypothetical protein CICLE_v10024241mg [Citrus clementina]
 gb|ESR57688.1| hypothetical protein CICLE_v10024241mg [Citrus clementina]
Length=610

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
             R+FA++Q+DYILGKNP+ MSY+VGFG  +P+HV HRGASIPKN ++YNC+GG KWRDS 
Sbjct  473  FRSFAKTQMDYILGKNPQNMSYIVGFGTRFPQHVLHRGASIPKNNIKYNCQGGRKWRDSA  532

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN+++GAMV GPD +DGF D R+NYNYTEPT+AGNAGLVAALVALSGE++ +ID+NT
Sbjct  533  KPNPNVIIGAMVGGPDQNDGFLDSRSNYNYTEPTIAGNAGLVAALVALSGEKTAQIDRNT  592

Query  359  IFSAV  345
            +F A+
Sbjct  593  LFYAI  597



>ref|XP_004981854.1| PREDICTED: endoglucanase 10-like [Setaria italica]
Length=621

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 108/127 (85%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ+DYILGKNP+KMSYVVGFGN YPK  HHRGASIP N V+Y CKGG+KWR+SK
Sbjct  479  LRKFARSQLDYILGKNPQKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGFKWRESK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR--IDK  366
            K NPNILVGAMVAGPD HD F D+RTNYNYTEPTLA NAGLVAAL++++   + R  IDK
Sbjct  539  KANPNILVGAMVAGPDKHDRFKDIRTNYNYTEPTLAANAGLVAALISIADIPTGRYSIDK  598

Query  365  NTIFSAV  345
            NTIFSA+
Sbjct  599  NTIFSAI  605



>ref|XP_006480121.1| PREDICTED: endoglucanase 25-like [Citrus sinensis]
Length=610

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
             R+FA++Q+DYILGKNP+ MSY+VGFG  +P+HV HRGASIP+N ++YNC+GG KWRDS 
Sbjct  473  FRSFAKTQMDYILGKNPQNMSYIVGFGTRFPQHVLHRGASIPRNNIKYNCQGGRKWRDSA  532

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN+++GAMV GPD +DGF D R+NYNYTEPT+AGNAGLVAALVALSGE++ +ID+NT
Sbjct  533  KPNPNVIIGAMVGGPDQNDGFLDSRSNYNYTEPTIAGNAGLVAALVALSGEKTAQIDRNT  592

Query  359  IFSAV  345
            +F A+
Sbjct  593  LFYAI  597



>gb|KDO87072.1| hypothetical protein CISIN_1g046335mg [Citrus sinensis]
Length=613

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
             R+FA++Q+DYILGKNP+ MSY+VGFG  +P+HV HRGASIP+N ++YNC+GG KWRDS 
Sbjct  476  FRSFAKTQMDYILGKNPQNMSYIVGFGTRFPQHVLHRGASIPRNNIKYNCQGGRKWRDSA  535

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN+++GAMV GPD +DGF D R+NYNYTEPT+AGNAGLVAALVALSGE++ +ID+NT
Sbjct  536  KPNPNVIIGAMVGGPDQNDGFLDSRSNYNYTEPTIAGNAGLVAALVALSGEKTAQIDRNT  595

Query  359  IFSAV  345
            +F A+
Sbjct  596  LFYAI  600



>ref|XP_006403190.1| hypothetical protein EUTSA_v10003366mg, partial [Eutrema salsugineum]
 gb|ESQ44643.1| hypothetical protein EUTSA_v10003366mg, partial [Eutrema salsugineum]
Length=528

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 100/126 (79%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNP+ MSYVVGFG  YPKHVHHRGASIPKN+ + +CKGGWKWRDSK
Sbjct  388  LRDFARSQIDYILGKNPQNMSYVVGFGERYPKHVHHRGASIPKNE-KVSCKGGWKWRDSK  446

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTla-gnaglvaalvaLSGERSTRIDKN  363
            + NPN + GAMVAGPD HDGFHDVR NYNYTEPTL      + A + ALS E   + D N
Sbjct  447  QENPNTIEGAMVAGPDKHDGFHDVRANYNYTEPTLTGNAGLVTAVVAALSAEDKLKFDPN  506

Query  362  TIFSAV  345
            ++FSA+
Sbjct  507  SMFSAL  512



>ref|NP_194157.1| endoglucanase 21 [Arabidopsis thaliana]
 sp|Q9STW8.1|GUN21_ARATH RecName: Full=Endoglucanase 21; AltName: Full=Endo-1,4-beta glucanase 
21 [Arabidopsis thaliana]
 emb|CAB45061.1| endo-1, 4-beta-glucanase like protein [Arabidopsis thaliana]
 emb|CAB79336.1| endo-1, 4-beta-glucanase like protein [Arabidopsis thaliana]
 gb|AEE84879.1| endoglucanase 21 [Arabidopsis thaliana]
Length=620

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 110/126 (87%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNF+ SQIDYILGKNPRKMSYVVG+G  YPK VHHRGASIPKN ++  C GG+KW+ SK
Sbjct  480  LRNFSRSQIDYILGKNPRKMSYVVGYGQRYPKQVHHRGASIPKN-MKETCTGGFKWKKSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKN  363
            K NPN + GAMVAGPD HDGFHD+RTNYNYTEPTLAGNAGLVAALVALSGE++   IDKN
Sbjct  539  KNNPNAINGAMVAGPDKHDGFHDIRTNYNYTEPTLAGNAGLVAALVALSGEKAVGGIDKN  598

Query  362  TIFSAV  345
            T+FSAV
Sbjct  599  TMFSAV  604



>ref|XP_010448587.1| PREDICTED: endoglucanase 21-like [Camelina sativa]
Length=620

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNF+ SQIDYILGKNPRKMSYVVGFG  YPK VHHRGASIP+N ++ +C GG+KW++SK
Sbjct  480  LRNFSRSQIDYILGKNPRKMSYVVGFGQRYPKQVHHRGASIPRN-MKESCTGGYKWKNSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKN  363
            K NPNI+ GAMVAGPD  DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ +   IDKN
Sbjct  539  KDNPNIIKGAMVAGPDKQDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGKEAVWGIDKN  598

Query  362  TIFSAV  345
            T+FSAV
Sbjct  599  TMFSAV  604



>emb|CDY45056.1| BnaA08g02190D [Brassica napus]
Length=540

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 108/125 (86%), Gaps = 2/125 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+F+ SQIDYILGKNP+ MSYVVGFG  YPK VHHRGASIPKN+ + +CKGGWKWR+S 
Sbjct  402  LRDFSRSQIDYILGKNPQNMSYVVGFGERYPKRVHHRGASIPKNR-KESCKGGWKWRESS  460

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN++ GAMVAGPD HDGFHDVRTN NYTEPTL GNAGL+AALVALSG++   +DKN 
Sbjct  461  KENPNVIEGAMVAGPDGHDGFHDVRTNSNYTEPTLTGNAGLIAALVALSGQKD-NLDKNG  519

Query  359  IFSAV  345
            IFSA+
Sbjct  520  IFSAI  524



>ref|XP_006283336.1| hypothetical protein CARUB_v10004382mg [Capsella rubella]
 gb|EOA16234.1| hypothetical protein CARUB_v10004382mg [Capsella rubella]
Length=622

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 110/126 (87%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+F+ SQIDYILGKNPRKMSYVVG+G  YPKHVHHRGASIP+NK + +C GGWKW+ SK
Sbjct  482  LRDFSRSQIDYILGKNPRKMSYVVGYGQRYPKHVHHRGASIPRNK-KESCTGGWKWKKSK  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKN  363
              NPNI+ GAMVAGPD +DGFHDVRTNYNYTEPTLAGNAGLVAALVALSG  +   IDKN
Sbjct  541  DANPNIIYGAMVAGPDKNDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGGIAVGGIDKN  600

Query  362  TIFSAV  345
            T+FSAV
Sbjct  601  TMFSAV  606



>ref|XP_010439066.1| PREDICTED: endoglucanase 21 [Camelina sativa]
Length=618

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNF+ SQIDYILGKNPRKMSYVVGFG  YPK VHHRGASIP+N ++ +C GG KW  SK
Sbjct  478  LRNFSRSQIDYILGKNPRKMSYVVGFGQRYPKQVHHRGASIPRN-MKESCTGGSKWEKSK  536

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKN  363
            K NPNI+ GAMVAGPD HDGFHDVRTNYNYTEPTLAGNAGLVAALVALSG+ +   IDKN
Sbjct  537  KDNPNIIKGAMVAGPDKHDGFHDVRTNYNYTEPTLAGNAGLVAALVALSGKEAVWGIDKN  596

Query  362  TIFSAV  345
            T+FSAV
Sbjct  597  TMFSAV  602



>ref|XP_002867672.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43931.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=620

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 108/126 (86%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+F+ SQIDYILGKNPRKMSYVVG+G  YPK VHHRGASIPKNK R  C GG KW+ SK
Sbjct  480  LRDFSRSQIDYILGKNPRKMSYVVGYGQRYPKQVHHRGASIPKNK-RETCTGGLKWKKSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKN  363
            K NPN + GAMVAGPD HDGFHDVR+NYNYTEPTLAGNAGLVAALVALSGE+    IDKN
Sbjct  539  KGNPNTIDGAMVAGPDKHDGFHDVRSNYNYTEPTLAGNAGLVAALVALSGEKPVGGIDKN  598

Query  362  TIFSAV  345
            T+FSAV
Sbjct  599  TMFSAV  604



>gb|KDO53877.1| hypothetical protein CISIN_1g041590mg [Citrus sinensis]
Length=493

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 105/119 (88%), Gaps = 1/119 (1%)
 Frame = -3

Query  698  QIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSKKPNPNIL  519
             IDYILG NP+KMSY+VGFG+ YP++VHHRGASIPKNK++Y+CK GWKWRDS KPNPN L
Sbjct  368  MIDYILGNNPQKMSYLVGFGSPYPQYVHHRGASIPKNKIKYSCKRGWKWRDSSKPNPNTL  427

Query  518  VGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST-RIDKNTIFSAV  345
            VGAMVAGP  HDGFHDVR+NYNYT PTL  NAGLVAALVALSG++ST  IDK+TIF+ V
Sbjct  428  VGAMVAGPHKHDGFHDVRSNYNYTVPTLHDNAGLVAALVALSGKKSTGGIDKSTIFTEV  486



>gb|KFK22234.1| hypothetical protein AALP_AAs42893U000400 [Arabis alpina]
Length=616

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR F++SQIDYILG NPR MSYVVGFG  YPKHVHHRGASIPKN  + +CKGGW WRD K
Sbjct  474  LREFSKSQIDYILGDNPRGMSYVVGFGKRYPKHVHHRGASIPKNAKKQSCKGGWHWRDIK  533

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERST--RIDK  366
            K NPN + GAMVAGPD HDGFHD+R NYNYTEPTLAGNAGLVAALVAL+   ++   IDK
Sbjct  534  KENPNTIEGAMVAGPDKHDGFHDLRINYNYTEPTLAGNAGLVAALVALTRPPNSFGTIDK  593

Query  365  NTIFSAV  345
            NTIFSAV
Sbjct  594  NTIFSAV  600



>ref|XP_002960146.1| hypothetical protein SELMODRAFT_266522 [Selaginella moellendorffii]
 gb|EFJ37685.1| hypothetical protein SELMODRAFT_266522 [Selaginella moellendorffii]
Length=620

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            +RNFA+SQ+DYILGKNPRKMSYVVG+GN YPK VHHR ASIPKNK +Y C+ GW++RDSK
Sbjct  479  MRNFAKSQVDYILGKNPRKMSYVVGYGNKYPKQVHHRAASIPKNKRKYGCQEGWRFRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLS-GERSTRIDKN  363
            K NPN +VGAMV GPD  D FHDVR+NYN+TEPTLAGNAGL  ALVALS G+ S+ +D +
Sbjct  539  KANPNTIVGAMVGGPDTKDRFHDVRSNYNFTEPTLAGNAGLAFALVALSGGDSSSGVDAS  598

Query  362  TIFSAV  345
             IFSA+
Sbjct  599  NIFSAI  604



>ref|XP_008235173.1| PREDICTED: endoglucanase 9-like [Prunus mume]
Length=605

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNPR +SYVVGF  H+P+HVHHRGASIP NK++Y CKGG KWR S+
Sbjct  465  LRRFARTQIDYILGKNPRGISYVVGFSEHFPQHVHHRGASIPHNKIKYGCKGGLKWRKSR  524

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN +VGAMVAGPD HD F DVR NYNYTEP+L GNAGLVAALVALS    + ID+N+
Sbjct  525  TPNPNTIVGAMVAGPDKHDNFQDVRFNYNYTEPSLVGNAGLVAALVALSSGTPSGIDRNS  584

Query  359  IFSAV  345
            +F AV
Sbjct  585  MFYAV  589



>gb|EMS51342.1| Endoglucanase 9 [Triticum urartu]
Length=694

 Score =   166 bits (421),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDS  543
            LR+FA +Q++YILGKNP KMSYVVG+G HYPK VHHRGASIPK K V   CKGGW WRD+
Sbjct  554  LRSFARTQMEYILGKNPLKMSYVVGYGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDT  613

Query  542  KKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKN  363
            KKPNP+I+VGAMVAGPD HDGF D+R N NYTEPTLAGNAGLVAALVALSGE    +DKN
Sbjct  614  KKPNPHIIVGAMVAGPDRHDGFKDIRKNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKN  672

Query  362  TIFSAV  345
            T+FSAV
Sbjct  673  TMFSAV  678



>ref|XP_007199407.1| hypothetical protein PRUPE_ppa026228mg [Prunus persica]
 gb|EMJ00606.1| hypothetical protein PRUPE_ppa026228mg [Prunus persica]
Length=605

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA +QIDYILGKNPR +SYVVGF  H+P+HVHHRGASIP NK++Y CKGG KW++S+
Sbjct  465  LRRFARTQIDYILGKNPRGISYVVGFSEHFPQHVHHRGASIPHNKIKYGCKGGLKWKNSR  524

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN +VGAMVAGPD HD F DVR NYNYTEP+L GNAGLVAALVALS      ID+N+
Sbjct  525  TPNPNTIVGAMVAGPDKHDNFQDVRFNYNYTEPSLVGNAGLVAALVALSSGTPAGIDRNS  584

Query  359  IFSAV  345
            +F AV
Sbjct  585  MFYAV  589



>ref|XP_002514768.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF47322.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=624

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQIDYILGKNP  MSYVVG+G  +P+HVHHR ASIP +K RY+C GGWKWRDS+
Sbjct  484  LRTFATSQIDYILGKNPMNMSYVVGYGTKFPRHVHHRAASIPHDKKRYSCTGGWKWRDSR  543

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN + GAMV GPD  D FHDVRT+YNYTEPTLAGNAGLVAAL +L+      IDKNT
Sbjct  544  NPNPNNITGAMVGGPDRFDKFHDVRTSYNYTEPTLAGNAGLVAALASLTVSGGHGIDKNT  603

Query  359  IFSAV  345
            IFSAV
Sbjct  604  IFSAV  608



>ref|XP_002983992.1| hypothetical protein SELMODRAFT_268803 [Selaginella moellendorffii]
 gb|EFJ15004.1| hypothetical protein SELMODRAFT_268803 [Selaginella moellendorffii]
Length=610

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            +RNFA+SQ+DYILGKNPRKMSYVVG+GN YPK VHHR ASIPKNK +Y C+ GW++RDSK
Sbjct  469  MRNFAKSQVDYILGKNPRKMSYVVGYGNKYPKQVHHRAASIPKNKRKYGCQEGWRFRDSK  528

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLS-GERSTRIDKN  363
            K NPN +VGAMV GPD  D FHDVR+NYN+TEPTLAGNAGL  ALVALS G+ S+ +D +
Sbjct  529  KANPNTIVGAMVGGPDTKDRFHDVRSNYNFTEPTLAGNAGLAFALVALSGGDSSSGVDAS  588

Query  362  TIFS  351
             IFS
Sbjct  589  NIFS  592



>emb|CBI18623.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI+YILGKNP KMSY+VG+G  +PKHVHHRGASIP +  +Y+C GGWKWRDS+
Sbjct  298  LRSFATSQINYILGKNPMKMSYLVGYGTKFPKHVHHRGASIPNDNKKYSCTGGWKWRDSR  357

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNP+ + GAMV GP   D F D+RTNYNYTEPTLAGNAGLVAALV+L+G     IDKNT
Sbjct  358  NPNPHNITGAMVGGPIRTDNFQDIRTNYNYTEPTLAGNAGLVAALVSLTGSGGMSIDKNT  417

Query  359  IFSAV  345
            IFSAV
Sbjct  418  IFSAV  422



>gb|EPS66085.1| hypothetical protein M569_08689 [Genlisea aurea]
Length=615

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR F+ +QI+YILG+NPRK SYVVGFG+ YP HVHHRGASIPKN+ + +C GGWKWRD  
Sbjct  475  LREFSSTQINYILGRNPRKTSYVVGFGSRYPTHVHHRGASIPKNR-KASCAGGWKWRDGP  533

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGE-RSTRIDKN  363
            KPNPN++ GAMVAGPD HDGF DVRTNYNYTEPTLAGNAGLVAAL++LS       +DKN
Sbjct  534  KPNPNVIRGAMVAGPDRHDGFRDVRTNYNYTEPTLAGNAGLVAALISLSSSGDGVGVDKN  593

Query  362  TIFSAV  345
            T+FSAV
Sbjct  594  TMFSAV  599



>gb|EMT18790.1| Endoglucanase 9 [Aegilops tauschii]
Length=604

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 107/126 (85%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDS  543
            LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGASIPK K V   CKGGW WRD+
Sbjct  464  LRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDT  523

Query  542  KKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKN  363
            KKPNP+I+VGAMVAGPD HDGF DVR N NYTEPTLAGNAGLVAALVALSGE    +DKN
Sbjct  524  KKPNPHIIVGAMVAGPDRHDGFKDVRRNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKN  582

Query  362  TIFSAV  345
            T+FSAV
Sbjct  583  TMFSAV  588



>gb|AGK26802.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 107/126 (85%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDS  543
            LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGASIPK K V   CKGGW WRD+
Sbjct  482  LRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDT  541

Query  542  KKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKN  363
            KKPNP+I+VGAMVAGPD HDGF DVR N NYTEPTLAGNAGLVAALVALSGE    +DKN
Sbjct  542  KKPNPHIIVGAMVAGPDRHDGFKDVRRNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKN  600

Query  362  TIFSAV  345
            T+FSAV
Sbjct  601  TMFSAV  606



>gb|AGK26803.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 107/126 (85%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDS  543
            LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGASIPK K V   CKGGW WRD+
Sbjct  482  LRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDT  541

Query  542  KKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKN  363
            KKPNP+I+VGAMVAGPD HDGF DVR N NYTEPTLAGNAGLVAALVALSGE    +DKN
Sbjct  542  KKPNPHIIVGAMVAGPDRHDGFKDVRRNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKN  600

Query  362  TIFSAV  345
            T+FSAV
Sbjct  601  TMFSAV  606



>gb|AGK26798.1| endo-beta-1,4-glucanase [Triticum aestivum]
 gb|AGK26799.1| endo-beta-1,4-glucanase [Triticum aestivum]
 gb|AGK26800.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 107/126 (85%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDS  543
            LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGASIPK K V   CKGGW WRD+
Sbjct  482  LRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDT  541

Query  542  KKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKN  363
            KKPNP+I+VGAMVAGPD HDGF DVR N NYTEPTLAGNAGLVAALVALSGE    +DKN
Sbjct  542  KKPNPHIIVGAMVAGPDRHDGFKDVRRNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKN  600

Query  362  TIFSAV  345
            T+FSAV
Sbjct  601  TMFSAV  606



>gb|AGK26801.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 107/126 (85%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDS  543
            LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGASIPK K V   CKGGW WRD+
Sbjct  482  LRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGASIPKKKGVHPGCKGGWTWRDT  541

Query  542  KKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKN  363
            KKPNP+I+VGAMVAGPD HDGF DVR N NYTEPTLAGNAGLVAALVALSGE    +DKN
Sbjct  542  KKPNPHIIVGAMVAGPDRHDGFKDVRRNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKN  600

Query  362  TIFSAV  345
            T+FSAV
Sbjct  601  TMFSAV  606



>gb|KDP32490.1| hypothetical protein JCGZ_13415 [Jatropha curcas]
Length=623

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            L+ FA SQIDYILGKNP  MSYVVG+G  +P+HVHHRGASIP +K RY+CKGGWKWRD++
Sbjct  483  LQTFANSQIDYILGKNPMNMSYVVGYGTKFPRHVHHRGASIPHDKNRYSCKGGWKWRDTR  542

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN + GAMV GPD  D FHDVR+NYN +EPTLAGNAGLVAAL +L+      IDKNT
Sbjct  543  NPNPNNITGAMVGGPDRFDKFHDVRSNYNSSEPTLAGNAGLVAALASLTSSGGFGIDKNT  602

Query  359  IFSAV  345
            IFSAV
Sbjct  603  IFSAV  607



>dbj|BAK04500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 2/126 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNK-VRYNCKGGWKWRDS  543
            LR+FA +Q++YILGKNP KMSYVVG G HYPK VHHRGASIPK K +   CKGGW WRD+
Sbjct  482  LRSFARTQMEYILGKNPLKMSYVVGHGKHYPKRVHHRGASIPKKKGIHPGCKGGWTWRDT  541

Query  542  KKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKN  363
            KKPNP+I+VGAMVAGPD HDGF D+R N NYTEPTLAGNAGLVAALVALSGE    +DKN
Sbjct  542  KKPNPHIIVGAMVAGPDRHDGFKDIRKNRNYTEPTLAGNAGLVAALVALSGE-GHGVDKN  600

Query  362  TIFSAV  345
            T+FSAV
Sbjct  601  TMFSAV  606



>ref|XP_010646848.1| PREDICTED: endoglucanase 12 [Vitis vinifera]
Length=529

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI+YILGKNP KMSY+VG+G  +PKHVHHRGASIP +  +Y+C GGWKWRDS+
Sbjct  389  LRSFATSQINYILGKNPMKMSYLVGYGTKFPKHVHHRGASIPNDNKKYSCTGGWKWRDSR  448

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNP+ + GAMV GP   D F D+RTNYNYTEPTLAGNAGLVAALV+L+G     IDKNT
Sbjct  449  NPNPHNITGAMVGGPIRTDNFQDIRTNYNYTEPTLAGNAGLVAALVSLTGSGGMSIDKNT  508

Query  359  IFSAV  345
            IFSAV
Sbjct  509  IFSAV  513



>gb|EYU33245.1| hypothetical protein MIMGU_mgv1a022358mg, partial [Erythranthe 
guttata]
Length=423

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 104/126 (83%), Gaps = 4/126 (3%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FAE QI YILG NPR M   VGFG+HYPKHVHHRG SIP + ++Y+CKGGW+WR+SK
Sbjct  285  LRQFAEKQIGYILGANPRNM---VGFGDHYPKHVHHRGPSIPNDNIKYSCKGGWRWRNSK  341

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaa-lvaLSGERSTRIDKN  363
            K NPN +VGAMVAGP  HDGF D+R NYNYTEP + GNAGLVAA LVALSG+ S+ ID+N
Sbjct  342  KSNPNTIVGAMVAGPYKHDGFEDLRENYNYTEPAITGNAGLVAAPLVALSGKESSGIDRN  401

Query  362  TIFSAV  345
            T+FSAV
Sbjct  402  TVFSAV  407



>gb|KDP28223.1| hypothetical protein JCGZ_13994 [Jatropha curcas]
Length=564

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 107/127 (84%), Gaps = 2/127 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+ A  QI+YILGKN + +SYVVGFGNH+P+HVHHRGASIP +KV+Y C+GGWKWR+++
Sbjct  435  LRDLARKQINYILGKNHQSISYVVGFGNHFPQHVHHRGASIPNDKVKYGCEGGWKWRNTR  494

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSG--ERSTRIDK  366
            +PNPNI+VGAMV GPD  D F D+R+NYNYTE T+AGNAGLVAALVALS     S+ IDK
Sbjct  495  RPNPNIIVGAMVGGPDQRDDFQDIRSNYNYTESTIAGNAGLVAALVALSDGPGNSSEIDK  554

Query  365  NTIFSAV  345
            NTIF A+
Sbjct  555  NTIFYAI  561



>gb|AFZ78629.1| korrigan [Populus tomentosa]
Length=621

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA SQI+YILG NP KMSYVVG+G  +P+HVHHRGAS P + VRY+C GGWKWRDS 
Sbjct  481  LRNFATSQINYILGDNPMKMSYVVGYGTKFPRHVHHRGASTPSDNVRYSCTGGWKWRDSS  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ + GAMV GPD  D F DVRTNYN+TEPTLAGNAGLVAALV+L+      I+KN+
Sbjct  541  KPNPHNITGAMVGGPDRFDQFRDVRTNYNFTEPTLAGNAGLVAALVSLTSSGGIGINKNS  600

Query  359  IFSAV  345
            IFSAV
Sbjct  601  IFSAV  605



>ref|XP_002312211.1| endo-1 family protein [Populus trichocarpa]
 gb|EEE89578.1| endo-1 family protein [Populus trichocarpa]
 gb|AEO97187.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97214.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=620

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI+YILG NP KMSYVVG+G  +P+HVHHRGAS P +K RY+C GGWKWRDS 
Sbjct  480  LRSFATSQINYILGDNPMKMSYVVGYGTKFPRHVHHRGASTPSDKTRYSCTGGWKWRDSS  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ + GAMV GPD  D F DVRTNYN+TEPTLAGNAGLVAAL +L+      IDKN+
Sbjct  540  KPNPHNITGAMVGGPDRFDQFRDVRTNYNFTEPTLAGNAGLVAALASLTSSGGIGIDKNS  599

Query  359  IFSAV  345
            IF+AV
Sbjct  600  IFTAV  604



>ref|XP_006448516.1| hypothetical protein CICLE_v10014583mg [Citrus clementina]
 gb|ESR61756.1| hypothetical protein CICLE_v10014583mg [Citrus clementina]
Length=637

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+F+ SQIDYILGKNP KMSYVVG+G  +P+HVHHRGASIP +  +Y+CKGGWKW ++ 
Sbjct  497  LRSFSTSQIDYILGKNPTKMSYVVGYGKKFPRHVHHRGASIPSDGKKYSCKGGWKWSNNP  556

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ + GAMVAGPD  D FHDVRTN+NYTEPTLAGNAGLVAAL +L+      IDKNT
Sbjct  557  KPNPHNITGAMVAGPDRFDKFHDVRTNHNYTEPTLAGNAGLVAALASLTTSAGIGIDKNT  616

Query  359  IFSAV  345
            +FSA+
Sbjct  617  MFSAI  621



>ref|XP_007028162.1| Six-hairpin glycosidases superfamily protein [Theobroma cacao]
 gb|EOY08664.1| Six-hairpin glycosidases superfamily protein [Theobroma cacao]
Length=619

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNFA SQ+DYILGKNP  MSYVVG+   +P+HVHHRGASIP N ++Y+C GGWKWRDS+
Sbjct  479  LRNFATSQVDYILGKNPMNMSYVVGYDKKFPRHVHHRGASIPHNNIKYSCTGGWKWRDSQ  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN + GAMV GPD  D F DVRTN NYTEPTLAGNAGL+AAL +L+      IDKNT
Sbjct  539  NPNPNNITGAMVGGPDRFDHFRDVRTNSNYTEPTLAGNAGLIAALASLTRSGGHGIDKNT  598

Query  359  IFSAV  345
            IFSAV
Sbjct  599  IFSAV  603



>ref|XP_010065082.1| PREDICTED: endoglucanase 12 [Eucalyptus grandis]
 gb|KCW87984.1| hypothetical protein EUGRSUZ_A00393 [Eucalyptus grandis]
Length=629

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQIDYILGKNP KMSYVVGFG  YPKHVHHRGASIP +  +Y+C GGWKWRD++
Sbjct  482  LRSFATSQIDYILGKNPMKMSYVVGFGAKYPKHVHHRGASIPNDHKKYSCTGGWKWRDTR  541

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
              NPN + GAMV GPD  D F DVRTNY+YTEPTLAGNAGLVAALV+L+      IDKN+
Sbjct  542  NNNPNTINGAMVGGPDRFDKFKDVRTNYSYTEPTLAGNAGLVAALVSLTESGGRAIDKNS  601

Query  359  IFSAV  345
            IFSAV
Sbjct  602  IFSAV  606



>ref|XP_008801082.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=618

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQ+DYILG NP+KMSYVVG+G +YPKHVHHRGASIP N V+Y+C GG KW ++K
Sbjct  478  LRSFAASQVDYILGDNPKKMSYVVGYGKNYPKHVHHRGASIPDNGVKYSCTGGRKWLNAK  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN++ GAMV GPD  DGF DVR NY YTEPTLAGNAGLVAALV+L+      +DKNT
Sbjct  538  SPNPNVITGAMVGGPDRSDGFVDVRKNYGYTEPTLAGNAGLVAALVSLTSSGGAGVDKNT  597

Query  359  IFSAV  345
            +FSAV
Sbjct  598  MFSAV  602



>ref|XP_006468640.1| PREDICTED: endoglucanase 12-like [Citrus sinensis]
Length=637

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI YILGKNP KMSYVVG+G  +P+HVHHRGASIP +  +Y+CKGGWKW ++ 
Sbjct  497  LRSFATSQIGYILGKNPMKMSYVVGYGKQFPRHVHHRGASIPSDGKKYSCKGGWKWSNNP  556

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ + GAMVAGPD  D FHDVRTN+NYTEPTLAGNAGLVAAL +L+      IDKNT
Sbjct  557  KPNPHNITGAMVAGPDRFDKFHDVRTNHNYTEPTLAGNAGLVAALASLTTSAGIGIDKNT  616

Query  359  IFSAV  345
            +FSA+
Sbjct  617  MFSAI  621



>gb|KDO77086.1| hypothetical protein CISIN_1g013288mg [Citrus sinensis]
Length=446

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI YILGKNP KMSYVVG+G  +P+HVHHRGASIP +  +Y+CKGGWKW ++ 
Sbjct  306  LRSFATSQIGYILGKNPMKMSYVVGYGKQFPRHVHHRGASIPSDGKKYSCKGGWKWSNNP  365

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ + GAMVAGPD  D F+DVRTN+NYTEPTLAGNAGLVAAL +L+      IDKNT
Sbjct  366  KPNPHNITGAMVAGPDRFDKFNDVRTNHNYTEPTLAGNAGLVAALASLTTSAGIGIDKNT  425

Query  359  IFSAV  345
            +FSA+
Sbjct  426  MFSAI  430



>ref|XP_011010912.1| PREDICTED: endoglucanase 12 [Populus euphratica]
 ref|XP_011010993.1| PREDICTED: endoglucanase 12 [Populus euphratica]
Length=620

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI+YILG NP KMSYVVG+G  +P+H+HHRGAS P +  RY+C GGWKWRDS 
Sbjct  480  LRSFATSQINYILGDNPMKMSYVVGYGTKFPRHIHHRGASTPSDNTRYSCTGGWKWRDSS  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ + GAMV GPD  D F DVRTNYN+TEPTLAGNAGLVAAL +L+      IDKN+
Sbjct  540  KPNPHNITGAMVGGPDRFDRFRDVRTNYNFTEPTLAGNAGLVAALASLTSSGGIGIDKNS  599

Query  359  IFSAV  345
            IFSAV
Sbjct  600  IFSAV  604



>ref|XP_011014628.1| PREDICTED: endoglucanase 12-like isoform X3 [Populus euphratica]
Length=549

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI+YILG NP KMSYVVG+G  +P+HVHHRGASIP +K  Y+C GGWKWRDS 
Sbjct  409  LRSFATSQINYILGDNPMKMSYVVGYGTKFPRHVHHRGASIPNDKRTYSCTGGWKWRDSP  468

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN + GAMV GPD +D F DVR NYN+TEPTLAGNAGLVAAL +L+      IDKN 
Sbjct  469  KPNPNNITGAMVGGPDRYDRFRDVRKNYNFTEPTLAGNAGLVAALSSLTSSGGVGIDKNR  528

Query  359  IFSAV  345
            +FSAV
Sbjct  529  MFSAV  533



>ref|XP_009141938.1| PREDICTED: endoglucanase 21-like [Brassica rapa]
Length=566

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+F+ SQ+DYILGKNP  +SYVVG+G  YPKHVHHRGASIPKN+ + +CKGGWKWR+S 
Sbjct  429  LRDFSRSQVDYILGKNPENISYVVGYGERYPKHVHHRGASIPKNR-KESCKGGWKWRESS  487

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN++ GAMVAGPD HD FHDVRT  NYTEPTL GNAGLVAALVALSGE+   +DKN 
Sbjct  488  KENPNVIEGAMVAGPDGHDVFHDVRTA-NYTEPTLTGNAGLVAALVALSGEKHM-LDKNR  545

Query  359  IFSAV  345
            +FS V
Sbjct  546  MFSGV  550



>ref|XP_006858738.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
 gb|ERN20205.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
Length=619

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA+SQI+YILG NPRKMSYVVG+G++YPKHVHHRGASIP N+ +  C GGWKWRDS 
Sbjct  480  LRQFAQSQINYILGDNPRKMSYVVGYGSNYPKHVHHRGASIPNNQ-KTTCTGGWKWRDSN  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN + GAMV GPD  D F DVR+NYNYTEPTLAGNAGLVAAL++L+G     ID N 
Sbjct  539  NPNPNTITGAMVGGPDRFDQFRDVRSNYNYTEPTLAGNAGLVAALISLTGSGGGGIDTNK  598

Query  359  IFSAV  345
            IFS +
Sbjct  599  IFSGI  603



>ref|XP_011014603.1| PREDICTED: endoglucanase 12-like isoform X1 [Populus euphratica]
 ref|XP_011014609.1| PREDICTED: endoglucanase 12-like isoform X1 [Populus euphratica]
 ref|XP_011014618.1| PREDICTED: endoglucanase 12-like isoform X2 [Populus euphratica]
Length=621

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI+YILG NP KMSYVVG+G  +P+HVHHRGASIP +K  Y+C GGWKWRDS 
Sbjct  481  LRSFATSQINYILGDNPMKMSYVVGYGTKFPRHVHHRGASIPNDKRTYSCTGGWKWRDSP  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN + GAMV GPD +D F DVR NYN+TEPTLAGNAGLVAAL +L+      IDKN 
Sbjct  541  KPNPNNITGAMVGGPDRYDRFRDVRKNYNFTEPTLAGNAGLVAALSSLTSSGGVGIDKNR  600

Query  359  IFSAV  345
            +FSAV
Sbjct  601  MFSAV  605



>ref|XP_011077092.1| PREDICTED: endoglucanase 12 [Sesamum indicum]
Length=620

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            L++FA SQ++YILG NP  MSYVVG+G  YP+HVHHRGASIP NKV+Y+C GGW+WRD+ 
Sbjct  480  LKDFATSQMNYILGANPMNMSYVVGYGPKYPRHVHHRGASIPNNKVKYSCTGGWRWRDAA  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN + GAMV GPD  D F DVRTNY+YTEPT+AGNAGLVAALV+L+      +DKNT
Sbjct  540  TPNPNTISGAMVGGPDRFDNFRDVRTNYSYTEPTVAGNAGLVAALVSLTSSGGIGVDKNT  599

Query  359  IFSAV  345
            IF+ V
Sbjct  600  IFTNV  604



>ref|XP_002315101.2| hypothetical protein POPTR_0010s18480g [Populus trichocarpa]
 gb|EEF01272.2| hypothetical protein POPTR_0010s18480g [Populus trichocarpa]
Length=505

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI+YILG NP KMSYVVG+G  +P+H+HHRGASIP +K  Y+C GGWKWRDS 
Sbjct  365  LRSFATSQINYILGDNPMKMSYVVGYGTKFPRHIHHRGASIPNDKRSYSCTGGWKWRDSP  424

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN + GAMV GPD  D F DVR NYN+TEPTLAGNAGLVAAL +L+      IDKN 
Sbjct  425  KPNPNNITGAMVGGPDRFDRFRDVRKNYNFTEPTLAGNAGLVAALSSLTSSGGIGIDKNR  484

Query  359  IFSAV  345
            +FSAV
Sbjct  485  MFSAV  489



>gb|AFZ78628.1| korrigan [Populus tomentosa]
Length=691

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI+YILG NP KMSYVVG+G  +P+H+HHRGASIP +K RY+C GGWKWRD  
Sbjct  481  LRSFATSQINYILGDNPMKMSYVVGYGTKFPRHIHHRGASIPNDKRRYSCTGGWKWRDRP  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN + GAMV GPD  D F DVR NYN+TEPTLAGNAGLVAALV+L+      I+KN+
Sbjct  541  KPNPNNITGAMVGGPDRFDRFRDVRKNYNFTEPTLAGNAGLVAALVSLTSSGGIGINKNS  600

Query  359  IFSAV  345
            IFSAV
Sbjct  601  IFSAV  605



>ref|XP_004250089.1| PREDICTED: endoglucanase 12 [Solanum lycopersicum]
Length=635

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA  Q++YILG+NP KMSY+VG+G+ +PKHVHHRGASIP  K +Y+C GGW+WRD+K
Sbjct  495  LRSFATFQMNYILGENPLKMSYIVGYGDKFPKHVHHRGASIPTGKTKYSCTGGWRWRDTK  554

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPN + + GAMV GPD  D F D+RTN++YTEPTLAGNAGLVAALV+L+G     IDKNT
Sbjct  555  KPNVHNMTGAMVGGPDKFDKFKDLRTNFSYTEPTLAGNAGLVAALVSLTGTGGYGIDKNT  614

Query  359  IFSAV  345
            IFSAV
Sbjct  615  IFSAV  619



>gb|AEO97186.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97213.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=621

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQI+YILG NP KMSYVVG+G  +P+H+HHRGASIP +K  Y+C GGWKWRDS 
Sbjct  481  LRSFATSQINYILGDNPMKMSYVVGYGTKFPRHIHHRGASIPNDKRSYSCTGGWKWRDSP  540

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNPN + GAMV GPD  D F DVR NYN+TEPTLAGNAGLVAAL +L+      IDKN 
Sbjct  541  KPNPNNITGAMVGGPDRFDRFRDVRKNYNFTEPTLAGNAGLVAALSSLTSSGGIGIDKNR  600

Query  359  IFSAV  345
            +FSAV
Sbjct  601  MFSAV  605



>ref|XP_004502103.1| PREDICTED: endoglucanase 12-like [Cicer arietinum]
Length=620

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            L+ FA SQ+DYI+GKNP  MSY+VG+GN++P+HVHHRGAS PK+   Y+C GGWKWRD+ 
Sbjct  480  LKTFATSQMDYIMGKNPMNMSYIVGYGNNFPRHVHHRGASTPKDHKHYSCTGGWKWRDTH  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            KPNP+ + GAMV GP+  D FHD R NYNYTEPTLAGNAGLVAAL++L+   ST ID NT
Sbjct  540  KPNPHNITGAMVGGPNRFDQFHDSRINYNYTEPTLAGNAGLVAALISLTSTPSTGIDINT  599

Query  359  IFSAV  345
            IFSA+
Sbjct  600  IFSAI  604



>ref|XP_010929679.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=619

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            L  FA SQ+DYILG NP+ +SYVVG+G +YP+ VHHRGASIP +++ Y+C  GWKWRDSK
Sbjct  480  LYGFAASQVDYILGNNPKNISYVVGYGKNYPRQVHHRGASIPHDRIAYSCTAGWKWRDSK  539

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN++ GAMV GP+  DGF DVR N NYTEPTLAGNAGL+AALV+L+     RIDKN 
Sbjct  540  SPNPNVITGAMVGGPNRFDGFSDVRNNKNYTEPTLAGNAGLIAALVSLTSSGGDRIDKNA  599

Query  359  IFSAV  345
            IFS+V
Sbjct  600  IFSSV  604



>ref|XP_003556773.1| PREDICTED: endoglucanase 12-like [Glycine max]
Length=630

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            L+ FA SQI+YILGKNP KMSY+VGFGN +PKHVHHRGASIP +    +C GGWKWRD+ 
Sbjct  487  LKAFATSQIEYILGKNPMKMSYIVGFGNKFPKHVHHRGASIPNDHKHRSCTGGWKWRDTP  546

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN + GAMV GPD  D F D R NYN+TEPTLAGNAGLVAAL++L+    + ID+NT
Sbjct  547  NPNPNTITGAMVGGPDRFDQFRDSRKNYNFTEPTLAGNAGLVAALISLTSTTGSGIDRNT  606

Query  359  IFSAV  345
            IFSA+
Sbjct  607  IFSAI  611



>gb|KHN09941.1| Endoglucanase 7 [Glycine soja]
Length=630

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            L+ FA SQI+YILGKNP KMSY+VGFGN +PKHVHHRGASIP +    +C GGWKWRD+ 
Sbjct  487  LKAFATSQIEYILGKNPMKMSYIVGFGNKFPKHVHHRGASIPNDHKHRSCTGGWKWRDTP  546

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN + GAMV GPD  D F D R NYN+TEPTLAGNAGLVAAL++L+    + ID+NT
Sbjct  547  NPNPNTITGAMVGGPDRFDQFRDSRKNYNFTEPTLAGNAGLVAALISLTSTTGSGIDRNT  606

Query  359  IFSAV  345
            IFSA+
Sbjct  607  IFSAI  611



>emb|CDP09829.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LRNF+++Q+DYILGKNP+ MSYVVG+G  YP HVHHRGASIP N ++Y+C GGWKWRD+ 
Sbjct  399  LRNFSKNQVDYILGKNPQNMSYVVGYGIKYPLHVHHRGASIPHNGIKYSCTGGWKWRDTP  458

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
            K NPN +VGA+VAGPD +DGF D R   NYT+P LAGNAGLV ALVALSG+ S RI+K++
Sbjct  459  KANPNTIVGALVAGPDENDGFKDNRRMMNYTQPRLAGNAGLVGALVALSGDGSIRINKSS  518

Query  359  IFSAV  345
            +FS V
Sbjct  519  MFSFV  523



>ref|XP_007146006.1| hypothetical protein PHAVU_006G0049001g, partial [Phaseolus vulgaris]
 gb|ESW18000.1| hypothetical protein PHAVU_006G0049001g, partial [Phaseolus vulgaris]
Length=495

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            L+ FA SQ+DYILGKNP KMSY+VGFGN +P+HVHHRGASIP +   ++C GGWKWRD+ 
Sbjct  351  LKKFATSQVDYILGKNPMKMSYIVGFGNKFPRHVHHRGASIPNDHKHHSCTGGWKWRDTS  410

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTla-gnaglvaalvaLSGERSTRIDKN  363
              NPN + GAMV GPD  D FHD R NYN+TEPTLA     + A +   S   S+ ID+N
Sbjct  411  NNNPNTITGAMVGGPDRFDQFHDSRKNYNFTEPTLAGNAGIVAALISLTSTTGSSVIDRN  470

Query  362  TIFSAV  345
            TIFSA+
Sbjct  471  TIFSAI  476



>ref|XP_009782313.1| PREDICTED: endoglucanase 12 [Nicotiana sylvestris]
Length=634

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ++YILG NP KMSYVVG+GN +P+HVHHRGASIP  K +Y+C GGWKWRD+ 
Sbjct  494  LRRFATSQMNYILGDNPLKMSYVVGYGNKFPRHVHHRGASIPSGKTKYSCTGGWKWRDTS  553

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNP+ + GAMV GPD  D F D R N++YTEPTLAGNAGLVAALV+L+      +DKNT
Sbjct  554  NPNPHNITGAMVGGPDKFDRFKDARKNFSYTEPTLAGNAGLVAALVSLTSSGGYGVDKNT  613

Query  359  IFSAV  345
            IFSAV
Sbjct  614  IFSAV  618



>ref|XP_010912745.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=446

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQ++YILG NP+KMSYVVG+G +YPKHVHHRGASIP + V+Y+C  GWKW  +K
Sbjct  306  LRSFAASQVNYILGDNPKKMSYVVGYGKNYPKHVHHRGASIPDDGVKYSCTIGWKWFHAK  365

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN++ GAMV GPD  DGF D R +Y YTEPTLAGNAGLVAALV+++      +DKNT
Sbjct  366  SPNPNVITGAMVGGPDRFDGFKDARQSYGYTEPTLAGNAGLVAALVSVTSSGGAGVDKNT  425

Query  359  IFS  351
            +FS
Sbjct  426  MFS  428



>ref|XP_009602898.1| PREDICTED: endoglucanase 12 [Nicotiana tomentosiformis]
Length=635

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ++YILG NP KMSYVVG+GN +P+HVHHRGASIP  K +Y+C GGWKWRD+K
Sbjct  495  LRRFATSQMNYILGDNPLKMSYVVGYGNKFPRHVHHRGASIPSGKTKYSCTGGWKWRDTK  554

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNP+ + GAMV GPD  D F D R N++YTEPTLAGNAGLVAALV+L+      +DKN 
Sbjct  555  NPNPHNITGAMVGGPDKFDKFKDARKNFSYTEPTLAGNAGLVAALVSLTSSGGYGVDKNA  614

Query  359  IFSAV  345
            IFSAV
Sbjct  615  IFSAV  619



>ref|XP_010930303.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=618

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQ++YILG NP+KMSYVVG+GN YPK VHHRGASIP N V+Y+C GG KW  +K
Sbjct  478  LRSFAASQMNYILGDNPKKMSYVVGYGNKYPKQVHHRGASIPDNGVKYSCTGGRKWLYAK  537

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
              NPN++ GAMV GPD  DGF DVR +Y YTEPTLAGNAGLVAALV+L+      +DKNT
Sbjct  538  SSNPNVITGAMVGGPDRFDGFMDVRKDYGYTEPTLAGNAGLVAALVSLTSSGGAGVDKNT  597

Query  359  IFSAV  345
            IFSAV
Sbjct  598  IFSAV  602



>ref|XP_009385674.1| PREDICTED: endoglucanase 12-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR+FA SQ++YILG NP KMSYVVG+G +YPKHVHHRGASIP N V+Y+C GGWKWRD+K
Sbjct  476  LRSFATSQVNYILGDNPMKMSYVVGYGRNYPKHVHHRGASIPHNGVKYSCTGGWKWRDAK  535

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTR-IDKN  363
              NPN + GAMV GPD  D F D R NYNYTEPTLAGNAGLVAALV+L+   S+  +D N
Sbjct  536  TANPNTITGAMVGGPDRFDRFSDSRPNYNYTEPTLAGNAGLVAALVSLTSTSSSSGVDTN  595

Query  362  TIFSAV  345
            TIFSAV
Sbjct  596  TIFSAV  601



>ref|XP_010528623.1| PREDICTED: endoglucanase 7 [Tarenaya hassleriana]
Length=632

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            L+ FA SQ+DYILGKNP  MS+VVGFG+ +P+HVHHRGA+IP ++ R +C  GW+WRD+K
Sbjct  492  LKQFATSQVDYILGKNPLNMSFVVGFGSKFPRHVHHRGATIPSDRKRRSCSEGWQWRDTK  551

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN +VGAMV GP++ D FHD+R NYN +EPTLAGN+GLVAALV+L+   S  IDKNT
Sbjct  552  NPNPNNIVGAMVGGPNSFDQFHDLRHNYNASEPTLAGNSGLVAALVSLTNSESHGIDKNT  611

Query  359  IFSAV  345
            IF+AV
Sbjct  612  IFNAV  616



>gb|ACF87544.1| unknown [Zea mays]
 gb|ACN34482.1| unknown [Zea mays]
Length=450

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 101/129 (78%), Gaps = 4/129 (3%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ++YILG NP+KMSYVVGFG+ YP+HVHHRGAS P N V+Y+C GG+KWRDSK
Sbjct  306  LREFARSQVNYILGDNPKKMSYVVGFGSKYPRHVHHRGASTPHNGVKYSCTGGYKWRDSK  365

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLS----GERSTRI  372
            K +PN+L GAMV GPD +DGF D R  +   EPTL GNAGLVAALVAL+    G   T +
Sbjct  366  KADPNLLAGAMVGGPDKNDGFKDSRNTFGQNEPTLVGNAGLVAALVALTNSGRGAGVTTV  425

Query  371  DKNTIFSAV  345
            DKNT+FSAV
Sbjct  426  DKNTMFSAV  434



>gb|ACT54547.1| endo-1,4-beta-glucanase [Dimocarpus longan]
Length=628

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            +++FA SQ+DYILGKNP KMSYVVGFGN +P+HVHHR ASIP +K  Y+C GG+KWRD++
Sbjct  488  IQSFATSQVDYILGKNPMKMSYVVGFGNKFPRHVHHRAASIPHDKKYYSCTGGFKWRDTR  547

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN + GAMV GPD  D F D+R+NY+YTEPTLAGNAGLVAALV+L+      I+KNT
Sbjct  548  NPNPNNITGAMVGGPDRFDQFRDLRSNYSYTEPTLAGNAGLVAALVSLTSSGGRGINKNT  607

Query  359  IFSAV  345
            +FSAV
Sbjct  608  MFSAV  612



>emb|CDP21162.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            +R FA SQ+DYILGKNP  MSYVVG+G  +PKHVHHRGAS P N V+ +C GGWKWRDS+
Sbjct  478  IREFAASQMDYILGKNPLNMSYVVGYGKKFPKHVHHRGASTPHN-VKTSCTGGWKWRDSR  536

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNPN + GAMV GPD  D F DVR +Y+YTEPTLAGNAGLVAALV+L+      +D+NT
Sbjct  537  NPNPNTITGAMVGGPDKFDKFQDVRKSYSYTEPTLAGNAGLVAALVSLTSTAGNGVDRNT  596

Query  359  IFSAV  345
            IFSAV
Sbjct  597  IFSAV  601



>tpg|DAA36812.1| TPA: hypothetical protein ZEAMMB73_340402, partial [Zea mays]
Length=496

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 101/129 (78%), Gaps = 4/129 (3%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ++YILG NP+KMSYVVGFG+ YP+HVHHRGAS P N V+Y+C GG+KWRDSK
Sbjct  352  LREFARSQVNYILGDNPKKMSYVVGFGSKYPRHVHHRGASTPHNGVKYSCTGGYKWRDSK  411

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLS----GERSTRI  372
            K +PN+L GAMV GPD +DGF D R  +   EPTL GNAGLVAALVAL+    G   T +
Sbjct  412  KADPNLLAGAMVGGPDKNDGFKDSRNTFGQNEPTLVGNAGLVAALVALTNSGRGAGVTTV  471

Query  371  DKNTIFSAV  345
            DKNT+FSAV
Sbjct  472  DKNTMFSAV  480



>ref|XP_008441913.1| PREDICTED: endoglucanase 7 [Cucumis melo]
Length=628

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            +RNFA SQIDYILG NP KMSYVVG+G  +P+ VHHRGASIP +   Y+CKGG+KWRD+ 
Sbjct  488  IRNFATSQIDYILGNNPLKMSYVVGYGTKFPRRVHHRGASIPSDNKYYSCKGGFKWRDNP  547

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKNT  360
             PNP+ + GAMV GPD  D FHDVRTN NYTEPTLAGNAGLVAALV+L+      IDKNT
Sbjct  548  GPNPHNITGAMVGGPDQFDKFHDVRTNPNYTEPTLAGNAGLVAALVSLTTTAGFGIDKNT  607

Query  359  IFSAV  345
            IFS +
Sbjct  608  IFSGI  612



>ref|XP_010673846.1| PREDICTED: endoglucanase 12-like [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIP-KNKVRYNCKGGWKWRDS  543
            LR FA SQ+DYILGKNP  MSYVVGFGN YPKHVHHR ASIP KN V+Y+CKGG+KWRDS
Sbjct  493  LRRFATSQVDYILGKNPLHMSYVVGFGNKYPKHVHHRAASIPHKNGVKYSCKGGYKWRDS  552

Query  542  KKPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLSGERSTRIDKN  363
            KKPNPN +VGAMV GPD  D F D R    YTEPTLAGNAGLVAAL++L+    + +D+N
Sbjct  553  KKPNPNTIVGAMVGGPDRFDRFKDNRKLDRYTEPTLAGNAGLVAALISLTTTAGSGVDRN  612

Query  362  TIFSAV  345
             IFS V
Sbjct  613  YIFSGV  618



>ref|NP_001147970.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
 gb|ACG29288.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
Length=623

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 101/129 (78%), Gaps = 4/129 (3%)
 Frame = -3

Query  719  LRNFAESQIDYILGKNPRKMSYVVGFGNHYPKHVHHRGASIPKNKVRYNCKGGWKWRDSK  540
            LR FA SQ++YILG NP+KMSYVVGFG+ YP+HVHHRGAS P N V+Y+C GG+KWRDSK
Sbjct  479  LREFARSQVNYILGDNPKKMSYVVGFGSKYPRHVHHRGASTPHNGVKYSCTGGYKWRDSK  538

Query  539  KPNPNILVGAMVAGPDAHDGFHDVRTNYNYTEPTlagnaglvaalvaLS----GERSTRI  372
            K +PN+L GAMV GPD +DGF D R  +   EPTL GNAGLVAALVAL+    G   T +
Sbjct  539  KADPNLLAGAMVGGPDKNDGFKDSRNTFGQNEPTLVGNAGLVAALVALTNSGRGAGVTTV  598

Query  371  DKNTIFSAV  345
            DKNT+FSAV
Sbjct  599  DKNTMFSAV  607



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425